SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

P-loop containing nucleoside triphosphate hydrolases alignments in Aminobacterium colombiense DSM 12261

These alignments are sequences aligned to the 0034832 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1a1va1                             ppa.............................................................
gi|294102520|ref|YP_003554378.1|  dieiarsakmkpivevaaqlgideeelelygkykakvtyglwnrikdrpdgklvlvtaitp...
gi|294102529|ref|YP_003554387.1|  dieiaqnaelkpivevaaqlginedeleyygkykakvtyglwnrikdrpdgklvlvtaitpt..
gi|294102437|ref|YP_003554295.1|  veiiigaqwgdegkgrvvdalgnrvevfaryqgganaghtvivedekyvfhllpsgmlypcklc
gi|294102168|ref|YP_003554026.1|  dsildklnprqqeavrycd.............................................
gi|294101779|ref|YP_003553637.1|  adwgpsgdqpeaieklveslk...........................................
gi|294102457|ref|YP_003554315.1|  tkfifvtggvvsslgkgitaaslgvllkkrgfrvsiikldpylnvdagtmnpfqhgevfvtddg
gi|294101625|ref|YP_003553483.1|  emkkirnigia.....................................................
gi|294101185|ref|YP_003553043.1|  tyealdkygrdlvkmarlgkldpvigrdeevrrvirilsrk.......................
gi|294102626|ref|YP_003554484.1|  tqpgqfkaitada...................................................
gi|294101765|ref|YP_003553623.1|  ydaafpakdivdfvdriineaakngasdihieglsawsrvrfridgycravysfsldfhpaiis
gi|294102479|ref|YP_003554337.1|  hpvplgviqgaikmedvwfaykdeqwvlkgvalevc............................
gi|294101904|ref|YP_003553762.1|  islthltkiftkgkesfkavddvhldida...................................
gi|294102557|ref|YP_003554415.1|  yikkivkdfgsyddpsnrvravdrvdlhv...................................
gi|294101807|ref|YP_003553665.1|  tlpvsrdmlgrifngrgepidggapilpdakldingmpmnpfsrdypsefiqtgistidgmnpm
gi|294101806|ref|YP_003553664.1|  vietiaviknesgeeknvvmlqrwpvrkprpvarrlppiiplttgqrvvdaffpi.........
gi|294102649|ref|YP_003554507.1|  misiqnlyktypceggdfealrnvsini....................................
gi|294101185|ref|YP_003553043.1|  ipvtrlmegerekllkldeilhqrvigqdeavelvadavirarsgikdprrpv...........
gi|294102868|ref|YP_003554726.1|  lqlkqlnkkfghsyavrdfsfdi.........................................
gi|294102500|ref|YP_003554358.1|  ltprmivecldryivgqekakravaialrnrmrrrnlprdlaneva..................
gi|294102409|ref|YP_003554267.1|  pneralkryrqiaddinglepeysaksdedlrslvadfkrranegesldnllvevfalvrevsr
gi|294102354|ref|YP_003554212.1|  kpedi...........................................................
gi|294101565|ref|YP_003553423.1|  ipvtqlteeetqrllrmeeeihcrligqeeavsavarairrarsgmkdprrpv...........
gi|294101424|ref|YP_003553282.1|  ievknlhksfgnlhvlqgvsmtvg........................................
gi|294101976|ref|YP_003553834.1|  kmpvglslvgqvlngrgrsidgtplsfidkdlpitgmpinpvrrtspnayvetgissidmmntl
gi|294101061|ref|YP_003552919.1|  ilrvedihksyggvevlrgisft.........................................
gi|294101048|ref|YP_003552906.1|  dksedavvavrgvsla................................................
gi|294101977|ref|YP_003553835.1|  engveltmkqrwevrrprpvlsrlsfdaplltgqrildtlfpiaig..................
gi|294101084|ref|YP_003552942.1|  lihvenlyksfedgevlngisidi........................................
gi|294101565|ref|YP_003553423.1|  ptldqlgidlseksrkdeldpvigrdkeiqrviqilar..........................
gi|294101786|ref|YP_003553644.1|  llkvdhlkkhfytpygtlfavddvsfs.....................................
gi|294101493|ref|YP_003553351.1|  lvrvdniyktysmgevdvtalqgvsfsv....................................
gi|294101884|ref|YP_003553742.1|  aekalhgdiralariislveneapeseeimkylyphtgkal.......................
gi|294101894|ref|YP_003553752.1|  dtpkpaevkkfldqyvigqedakkilsvavynhfkristmseenddiel...............
gi|294101778|ref|YP_003553636.1|  dnrpkvtfddvagcdeskeelseviqflrdpgkfralgakvp......................
gi|294102313|ref|YP_003554171.1|  ivnikeltkrypmgdhtftalssvdlef....................................
gi|294102640|ref|YP_003554498.1|  lldirnlkkyfnvskgllhavdditlt.....................................
gi|294101376|ref|YP_003553234.1|  isyedigglgpqiqrvremielplrfpqvfdrlg..............................
gi|294102641|ref|YP_003554499.1|  lldirnlsvrfntdsgivhavnnlnlsl....................................
gi|294101359|ref|YP_003553217.1|  s...............................................................
gi|294102459|ref|YP_003554317.1|  lrngdviwgmvrppkdqehyeallrvemvnfadpeaarkrphfgtltpifpdsrltletdpdei
gi|294101785|ref|YP_003553643.1|  ileirnlrvsyetedgtvealngidldldegvtlg.............................
gi|294101376|ref|YP_003553234.1|  pdvtwsdiggleaikeelieavqwplkynsvyekfni...........................
gi|294102074|ref|YP_003553932.1|  m...............................................................
gi|294102442|ref|YP_003554300.1|  irlagvtkifqpdivaledvyls.........................................
gi|294101577|ref|YP_003553435.1|  lkarkvckafkgrtvvssvdldvhmge.....................................
gi|294101171|ref|YP_003553029.1|  llelngvdkffggvhavqsmsf..........................................
gi|294102413|ref|YP_003554271.1|  vletkgltmcfggltavnsfnma.........................................
gi|294102187|ref|YP_003554045.1|  einrlhddllnevfgygpiqplldddtvteimvngceqvfverwgkieptdvffnndnhirrii
gi|294102332|ref|YP_003554190.1|  irisglrkrygsgdtavdalkmvnmhv.....................................
gi|294102831|ref|YP_003554689.1|  mlsiavtnqkg.....................................................
gi|294101321|ref|YP_003553179.1|  akphlnvgtighidh.................................................
gi|294101626|ref|YP_003553484.1|  akphlnvgtighidh.................................................
gi|294101069|ref|YP_003552927.1|  ilsvddlhfsygetpilknislsv........................................
gi|294102759|ref|YP_003554617.1|  mieivdlsitykteshdvsavknafls.....................................
gi|294101055|ref|YP_003552913.1|  ileihqlavafnnkkilknina..........................................
gi|294101254|ref|YP_003553112.1|  plvqmqeitkefagivanhnidfdv.......................................
gi|294102760|ref|YP_003554618.1|  tdkvsvfypsrdgknsgqwalrnisls.....................................
gi|294101659|ref|YP_003553517.1|  tlqgvgfsypeadssaldqvsfq.........................................
gi|294101172|ref|YP_003553030.1|  nilldvqnlqvsygairalrgislqv......................................
gi|294102017|ref|YP_003553875.1|  yirpqinnglnlkieggrhpvieatfldlpfvpndivldgde......................
gi|294101748|ref|YP_003553606.1|  vldslrgtrwkkavektrervreevknlvrlyarrellkgyafpvaseiyrhfveafpyvetpd
gi|294102409|ref|YP_003554267.1|  pmvrsdfpdviyrtslekfhavaeeveetysngqpvlvgttsienseriskllkarkiphqvln
gi|294102070|ref|YP_003553928.1|  fehvvgisalhkryiddlmdmavsllpsdeeeerdpeeirvs......................
gi|294102390|ref|YP_003554248.1|  dplpdflrlkhafpplydsilemhypqgreswkkardrlayqelfvlqtgmalrrgersrlaek
gi|294101403|ref|YP_003553261.1|  redilelaiddirskfgegsimrlgdpfkvqvevistgilpldvalgi................
gi|294101730|ref|YP_003553588.1|  ekrvsh..........................................................
gi|294102602|ref|YP_003554460.1|  vqaekirnlaiiahid................................................
gi|294102663|ref|YP_003554521.1|  ivsnlnlfygknqvlhninmdif.........................................
gi|294101436|ref|YP_003553294.1|  lkcgivglplcgkstvfnvitragaevkpyasgk..............................
gi|294102150|ref|YP_003554008.1|  slsrirnfc.......................................................
gi|294101607|ref|YP_003553465.1|  prvivv..........................................................
gi|294102035|ref|YP_003553893.1|  r...............................................................
gi|294102412|ref|YP_003554270.1|  lkieelhvyyggihavkgislh..........................................
gi|294101660|ref|YP_003553518.1|  msiiiknlthtyhpstpletvaleginltt..................................
gi|294102549|ref|YP_003554407.1|  lwisrltktfgtlravddfsleia........................................
gi|294102841|ref|YP_003554699.1|  pavvfedvsfgyengtmvldqasfqv......................................
gi|294101272|ref|YP_003553130.1|  mlrlshlgkkynglpvidqfdldi........................................
gi|294101433|ref|YP_003553291.1|  kkdvgkviavgs....................................................
gi|294101963|ref|YP_003553821.1|  khmepr..........................................................
gi|294101356|ref|YP_003553214.1|  dssekavaihfpqcprsgqevisvkdvkktygdnlifkdisfsv....................
gi|294102542|ref|YP_003554400.1|  rlknikhfysqrcvlqipsleigq........................................
gi|294101861|ref|YP_003553719.1|  lrpsslqdfvgqqklkdklsiyvqaarqrkeal...............................
gi|294102400|ref|YP_003554258.1|  vtgfstgfyqfdrmtg................................................
gi|294102043|ref|YP_003553901.1|  mfit............................................................
gi|294101077|ref|YP_003552935.1|  mpllrlksiafayprssplfthlsfeif....................................
gi|294102348|ref|YP_003554206.1|  llkvdsitvrrdnatilkdislrv........................................
gi|294102040|ref|YP_003553898.1|  k...............................................................
gi|294101613|ref|YP_003553471.1|  mfierlrlkgfksfggsheltf..........................................
gi|294101367|ref|YP_003553225.1|  epllkmenigkayfgnrvlkdvsft.......................................
gi|294101893|ref|YP_003553751.1|  pwntyteenlditkaqrildedhyglvkvkerileflavrqlagkea.................
gi|294101841|ref|YP_003553699.1|  dvg.............................................................
gi|294102070|ref|YP_003553928.1|  iaivgrpnvgksslfnrilgrreaivddmpgvtrdriygetewkgrqf................
gi|294102221|ref|YP_003554079.1|  mvhhv...........................................................
gi|294101356|ref|YP_003553214.1|  iqlvnithfygeqglynslnwsith.......................................
gi|294101345|ref|YP_003553203.1|  pllatqdlsigygpkkgttlvagpiat.....................................
gi|294102145|ref|YP_003554003.1|  eislvlgtaghidh..................................................
gi|294101756|ref|YP_003553614.1|  pivgrpnvgkssllnnilaykvsivsekpqttrnaihgiynepemqivftdtpgihrp......
gi|294102549|ref|YP_003554407.1|  pflemtrltvsgdrgkdvvknltltvhrgeivgiagitgngqseleeaisglrfvkegqllmgk
gi|294101372|ref|YP_003553230.1|  ytgeemveisthggtlvaqkclesligkgarlaepgeftrraflngkidlsqaeavlgiirsks
gi|294101016|ref|YP_003552874.1|  lnpnyifnsfvvgksnrlahaaslavaetpgea...............................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  idesgcekprssdlmavniidvrppqrftsgipeldrvlggg......................
gi|294102507|ref|YP_003554365.1|  pnpdladikgqagakraleiaa..........................................
gi|294101471|ref|YP_003553329.1|  flrkggsqivlfshlsvsf.............................................
gi|294101845|ref|YP_003553703.1|  mleelslrniggldsah...............................................
gi|294101553|ref|YP_003553411.1|  dvdykvvkslvdsirgrcigqevldsitpgqqvvaivyeelvslmgedvvpfiisskpp.....
gi|294101853|ref|YP_003553711.1|  lrveapipgkpyvgieipnpkrrgvllrrilesqafeqadynlplpmgvrvdsrpliigledl.
gi|294101780|ref|YP_003553638.1|  ahhnlkeidvaipsrvfs..............................................
gi|294102079|ref|YP_003553937.1|  mk..............................................................
gi|294101472|ref|YP_003553330.1|  flsvenlsildeenkplvrnvsfs........................................
gi|294102235|ref|YP_003554093.1|  itl.............................................................
gi|294102390|ref|YP_003554248.1|  ppgrtpiqtrwlkkkeegrlwafirercsareriywvcplidesetlsvas.............
gi|294101443|ref|YP_003553301.1|  qwerpladrmrpsslddfvgqnhllapgtplrqilqsgkvp.......................
gi|294101748|ref|YP_003553606.1|  ppynrvpvltmvgprkknl.............................................
gi|294101649|ref|YP_003553507.1|  m...............................................................
gi|294101715|ref|YP_003553573.1|  wtlpelskkpffvfydllhpllgekgipltiecg..............................
gi|294101925|ref|YP_003553783.1|  sieigkhsssdnlsvyvdihklil........................................
gi|294101367|ref|YP_003553225.1|  lagnilkvehlwvdmpgetvrdvsftvkegeifgigglagqgklgiangimgmypsggtvtfde
gi|294101751|ref|YP_003553609.1|  pvrpktggqkly....................................................
gi|294101046|ref|YP_003552904.1|  n...............................................................
gi|294101779|ref|YP_003553637.1|  t...............................................................
gi|294101226|ref|YP_003553084.1|  llignpnvgksvifsrltgvraissnypgttvgflegwlrynsevyriidvpga..........
gi|294101892|ref|YP_003553750.1|  ppqtlpevafvgrsnvgksmllnalmerklahvgstpgktrsvnfykieaev............
gi|294102315|ref|YP_003554173.1|  sdnlvlydskdltt..................................................
gi|294102188|ref|YP_003554046.1|  eriavlscrggaggssfsislalqlasmgkrtalidgdlymgdvafllntpyelnwtswanecl
gi|294102320|ref|YP_003554178.1|  e...............................................................
gi|294102169|ref|YP_003554027.1|  svmaadeefarrmrdeshhrgil.........................................
gi|294101254|ref|YP_003553112.1|  kkitvlgdrgipvvkdlsidvrereilglagiagngqqelcealaglrplkegrimiddeelth
gi|294102077|ref|YP_003553935.1|  ryrrekagip......................................................
gi|294102510|ref|YP_003554368.1|  hmakgkrkleelvqkldlilevrdaraphltsspmsdqlsricpvyivlsradlaeegatkawl
gi|294101748|ref|YP_003553606.1|  qvhlpvdggarawilggasvpllvvfsdqrqaedfvsdfenlwegeivrllyelplsvegvrnk
gi|294101141|ref|YP_003552999.1|  d...............................................................
gi|294101018|ref|YP_003552876.1|  lewaagl.........................................................
gi|294101692|ref|YP_003553550.1|  iwdsfmq.........................................................
gi|294101032|ref|YP_003552890.1|  mfr.............................................................
gi|294101031|ref|YP_003552889.1|  pk..............................................................
gi|294101431|ref|YP_003553289.1|  ek..............................................................
gi|294102167|ref|YP_003554025.1|  lvlg............................................................
gi|294101458|ref|YP_003553316.1|  aplcipqlevlikgmflkdrfldiirhfvlfqsdgkeikkilagyhqyhavnkalqstqratme
gi|294102320|ref|YP_003554178.1|  fkrleyqeqavlnakk................................................
gi|294101940|ref|YP_003553798.1|  rlgirrldtafdg...................................................
gi|294102120|ref|YP_003553978.1|  rtakglam........................................................
gi|294101791|ref|YP_003553649.1|  hvy.............................................................
gi|294102136|ref|YP_003553994.1|  mvkqidirkyrkmedlslvfs...........................................
gi|294101830|ref|YP_003553688.1|  r...............................................................
gi|294102042|ref|YP_003553900.1|  iaidiarlllcekknacgqclsccswhekthpdlvlsgslekaptisecreiavelslypvva.
gi|294102015|ref|YP_003553873.1|  il..............................................................
gi|294102787|ref|YP_003554645.1|  mrfiefkirsfgllenmeghfpagls......................................
gi|294102032|ref|YP_003553890.1|  lekfigqeravqaisfglsves..........................................
gi|294102010|ref|YP_003553868.1|  tllasli.........................................................
gi|294101586|ref|YP_003553444.1|  yifavsgmkn......................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ivagsprmemetlarelvlwknkkgylsgqeilpaetpwqnigmvfdapllplaeevlqryrip
gi|294102478|ref|YP_003554336.1|  ipvisvgnitlggtnktpfvemlsrhfynmgvrvgivsrgyggrtsepvvikgtssereivgde
gi|294101874|ref|YP_003553732.1|  h...............................................................
gi|294102071|ref|YP_003553929.1|  lqeh............................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  vvgngvvvdpeqllkelhtlqeqgkdrarlmisgsahvvmpyhkildkadeqfrskdkkigttg
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  aetdldlghyerfideslsadnnvttgkiystviskerhgcylggtvqviphitneiqdrilka
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  rikimasmdisdkrrpqdgqfniktgsqdfldvrvsslptvdgekialrlldsskipdniyqlg
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  vrgqklpifsgsglphnrmaaqiarqatvisghedfavvfaamgitfeeasffmedfrrtgaiq
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  rtlglrhfdvqlmggmalhegki.........................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  vrgqklpifsgsglpaneiaaqivqqaavpgretdflvifaamgitrrearyfidtfestgain
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  strlidlfap......................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  dkivaplgrrideaspmvdarlpdgsrvnavippvsidgptltvrkfrrepftaqdlialgtls
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  qlraeqeilqdmesshpmd.............................................
gi|294102409|ref|YP_003554267.1|  akyhekeaqivaqagrfgavtvat........................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  apilpesgrlkerflkeifpyplteaqkkvsleisqdmalnipmh...................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  rdithlpplkrrklglayipedriktglaplaslkdnallgyqykppflkrnffqnfrsirefa
gi|294101372|ref|YP_003553230.1|  eealraatrtlrgelssfakdiynemltisssievgldfpeedipfienegvesalytlkqgle
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  tpiilndprsplsvgiasvsedrrgvgllleepiswnviftalqmqqkylkpvlgglfkirdee
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  sgtvdgerylalgpkdlmimptaknpvqaelv................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  qppkqfiargvryipadrkgtglvpnmdikensilkkywnkpva....................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  qffssikqkawafnflegriqllrrdlaklrpahrelr..........................
gi|294101748|ref|YP_003553606.1|  slllqrgetlskwkqekgilatspggllspfltgegvfplrremgeergrllrwlevagyervd
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  qg..............................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ysinegltvgqtalwdiarriwnagehgwplgetwdilrepclagreiatsppadiftlnekgw
gi|294102478|ref|YP_003554336.1|  plllasrlphvpvavsrdrlkdvealqkhnvelivaddafqh......................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                10        20        
                                                                                 |         |        
d1a1va1                             ....................................---VPQSFQVAHLHAPTGSGKSTKVPAA
gi|294102520|ref|YP_003554378.1|  ....................................--------------TPAGEGKTTTTVGL
gi|294102529|ref|YP_003554387.1|  ....................................---------------PAGEGKTTTTVGL
gi|294102437|ref|YP_003554295.1|  rgigpcyvdkfnrcgiriedlfdpdilreklsfnle----------------------------
gi|294102168|ref|YP_003554026.1|  ....................................--------GPLLVLAGAGSGKTRVLAHK
gi|294101779|ref|YP_003553637.1|  ....................................-----NGTRFQTLLGVTGSGKTFTVANV
gi|294102457|ref|YP_003554315.1|  ...........addndiviaeiggtvgdiegqpfle----------------------------
gi|294101625|ref|YP_003553483.1|  ....................................--------------AHIDAGKTTTTERI
gi|294101185|ref|YP_003553043.1|  ....................................------TKNNPVLIGDPGVGKTAIVEGL
gi|294102626|ref|YP_003554484.1|  ....................................--------PLVAVSAGAGTGKTWTLAWR
gi|294101765|ref|YP_003553623.1|  ......................feqrdlelleklls-----QKEGLILVTGPTGSGKSTTLHAL
gi|294102479|ref|YP_003554337.1|  ....................................------PGERVAVVGETGGGKSTLMDLI
gi|294101904|ref|YP_003553762.1|  ....................................-------GELITFLGPSGCGKTTILRMI
gi|294102557|ref|YP_003554415.1|  ....................................-----KEGELITLLGPSGCGKTTLLRMI
gi|294101807|ref|YP_003553665.1|  ..........rtvmfvnladdpaierittprlalta------------------------A---
gi|294101806|ref|YP_003553664.1|  ....................................-----AKGGTACVPGPFGSGKTVIQHQL
gi|294102649|ref|YP_003554507.1|  ....................................-----QSGEIFGIIGLSGAGKSTLLRTL
gi|294101185|ref|YP_003553043.1|  ....................................--------GSFIFLGPTGVGKTELAKTL
gi|294102868|ref|YP_003554726.1|  ....................................-----NEGELVSLLGPSGCGKTTTLRMI
gi|294102500|ref|YP_003554358.1|  ....................................-------PKNILMVGPTGVGKTEIARRL
gi|294102409|ref|YP_003554267.1|  ....................................------------TEMKTGEGKTLVATLA
gi|294102354|ref|YP_003554212.1|  ....................................--------RSVAIAAHGGAGKTSLVEAI
gi|294101565|ref|YP_003553423.1|  ....................................--------GSFLFLGPTGVGKTELARRL
gi|294101424|ref|YP_003553282.1|  ....................................------EGEVVSVIGPSGSGKSTLARCI
gi|294101976|ref|YP_003553834.1|  ..........ngiffmnlasdsaverlltprmalta------------------------AEYF
gi|294101061|ref|YP_003552919.1|  ....................................----VRKGETKVFIGPSGTGKSTLLRCI
gi|294101048|ref|YP_003552906.1|  ....................................----ARQGEVFVIMGLSGSGKSTLIRCV
gi|294101977|ref|YP_003553835.1|  ....................................--------GAAVLPGGFGTGKTVTQQSL
gi|294101084|ref|YP_003552942.1|  ....................................-----HEGDLVSIIGPSGCGKSTFLRCL
gi|294101565|ref|YP_003553423.1|  ....................................-----RTKNNPVLLGDPGVGKTAIVEGL
gi|294101786|ref|YP_003553644.1|  ....................................----IKEGETLGVVGESGCGKSTLGRAV
gi|294101493|ref|YP_003553351.1|  ....................................-----KKGEFLSIMGASGSGKSTLMNII
gi|294101884|ref|YP_003553742.1|  ....................................---------VIGITGSPGAGKSTLVDKL
gi|294101894|ref|YP_003553752.1|  ....................................------QKSNVLLIGPTGSGKTLLAQSL
gi|294101778|ref|YP_003553636.1|  ....................................--------KGVLLLGPPGTGKTLLARAA
gi|294102313|ref|YP_003554171.1|  ....................................-----KKGEFCGLIGPSGSGKTTLLNII
gi|294102640|ref|YP_003554498.1|  ....................................----ITKGQTLGLVGESGCGKSTLGRVV
gi|294101376|ref|YP_003553234.1|  ....................................----VQPPKGVLLYGPPGTGKTVIARAV
gi|294102641|ref|YP_003554499.1|  ....................................-----RRGKALGFVGETGAGKTTTALAV
gi|294101359|ref|YP_003553217.1|  ....................................----------------------------
gi|294102459|ref|YP_003554317.1|  ....................................----IGKGQRALLVSPPKAGKTTVLKKI
gi|294101785|ref|YP_003553643.1|  ....................................------------IVGETGAGKTTLAKSI
gi|294101376|ref|YP_003553234.1|  ....................................-----TPPQGILLHGPSGTGKTLLVRAL
gi|294102074|ref|YP_003553932.1|  ....................................----------FVISGPSGAGKGTVRKAL
gi|294102442|ref|YP_003554300.1|  ....................................----IMQGEFVYLVGTTGSGKTTLMRLI
gi|294101577|ref|YP_003553435.1|  ....................................---------IVGLLGPNGAGKTTTFYMI
gi|294101171|ref|YP_003553029.1|  ....................................---ALNEKEIVGLIGPNGAGKTTIFNVV
gi|294102413|ref|YP_003554271.1|  ....................................----VPKGSIVGLIGPNGAGKTTVFNMI
gi|294102187|ref|YP_003554045.1|  .......................desvsflrvatea-------RYNIIVTGGTGSGKTTTLNVL
gi|294102332|ref|YP_003554190.1|  ....................................-----APGEVVGLIGPSGSGKSTLLKCL
gi|294102831|ref|YP_003554689.1|  ....................................-----------------GVGKTTTCVNL
gi|294101321|ref|YP_003553179.1|  ....................................-------------------GKTTLTAAI
gi|294101626|ref|YP_003553484.1|  ....................................-------------------GKTTLTAAI
gi|294101069|ref|YP_003552927.1|  ....................................-----KNQEMVMILGPNGSGKTTLLRCL
gi|294102759|ref|YP_003554617.1|  ....................................----IPRGRITGLVGESGSGKSSLLMAI
gi|294101055|ref|YP_003552913.1|  ....................................---NIYPHQITAIIGPSGCGKSTFLKSL
gi|294101254|ref|YP_003553112.1|  ....................................-----NRGEVHALLGENGAGKSTLMNIL
gi|294102760|ref|YP_003554618.1|  ....................................----LQQGESLALIGESGSGKTSLLRVL
gi|294101659|ref|YP_003553517.1|  ....................................----VREGEWLALLGSNGSGKSTLAKHL
gi|294101172|ref|YP_003553030.1|  ....................................-----KEGEIVCVIGANGAGKSTLMNAL
gi|294102017|ref|YP_003553875.1|  ....................................-------ERIALITGPNMAGKSTYLRMA
gi|294101748|ref|YP_003553606.1|  ....................................----------RLLVGDVGFGKTEIAMRA
gi|294102409|ref|YP_003554267.1|  ....................................----------------------------
gi|294102070|ref|YP_003553928.1|  ....................................------------IVGRPNVGKSSLVNAL
gi|294102390|ref|YP_003554248.1|  ....................................----------RLLQGDVGSGKTAVAVLA
gi|294101403|ref|YP_003553261.1|  ....................................--GGLPKGRIVEIFGPEGSGKTTVALHG
gi|294101730|ref|YP_003553588.1|  ....................................---------AYLFSGPRGCGKTTLARLL
gi|294102602|ref|YP_003554460.1|  ....................................------------------HGKTTLIDSI
gi|294102663|ref|YP_003554521.1|  ....................................------GKTVTALIGPSGCGKSSFIRCL
gi|294101436|ref|YP_003553294.1|  ....................................---------------------T------
gi|294102150|ref|YP_003554008.1|  ....................................------------IIAHIDHGKSTLADRL
gi|294101607|ref|YP_003553465.1|  ....................................------------TSGKGGVGKTTTTANV
gi|294102035|ref|YP_003553893.1|  ....................................--------RFVQVYMGDGKGKTTAALGL
gi|294102412|ref|YP_003554270.1|  ....................................----IPKGKIVTLIGANGAGKSSTIRSI
gi|294101660|ref|YP_003553518.1|  ....................................-----EKGQWLSIVGHTGSGKSTLAQHL
gi|294102549|ref|YP_003554407.1|  ....................................------SGTVHSLVGENGAGKSTVVKCV
gi|294102841|ref|YP_003554699.1|  ....................................-----PQGEFLVIIGPNGGGKTTLLRLI
gi|294101272|ref|YP_003553130.1|  ....................................-----EKGSFSVLIGPSGCGKSTLFDLL
gi|294101433|ref|YP_003553291.1|  ....................................--------------GKGGVGKSSISCLL
gi|294101963|ref|YP_003553821.1|  ....................................-------PPIVTVMGHVDHGKTTLLDYI
gi|294101356|ref|YP_003553214.1|  ....................................-----HRGEKIALVGVNGAGKSTLSRLI
gi|294102542|ref|YP_003554400.1|  ....................................-------GEILGLLGANGSGKSTLLRIL
gi|294101861|ref|YP_003553719.1|  ....................................--------DHILFYGPPGLGKTTLAGII
gi|294102400|ref|YP_003554258.1|  ....................................---GLQPGSLNIIAARPSMGKTALALNI
gi|294102043|ref|YP_003553901.1|  ....................................------------LEGIDGCGKSTQAAFL
gi|294101077|ref|YP_003552935.1|  ....................................------EKEKIYIRGENGAGKTTLFSLI
gi|294102348|ref|YP_003554206.1|  ....................................-----ESGEVTGVLGRNGAGKSSLAYAL
gi|294102040|ref|YP_003553898.1|  ....................................------SPKVIVLVGVNGSGKTTTAAKL
gi|294101613|ref|YP_003553471.1|  ....................................------SPGFTAIVGPNGSGKSNILDGL
gi|294101367|ref|YP_003553225.1|  ....................................----LEKGQILGLVGENGAGKSTLMNIL
gi|294101893|ref|YP_003553751.1|  ....................................------KGQVLCFVGPPGVGKTSLAQSI
gi|294101841|ref|YP_003553699.1|  ....................................------------LVGLPNAGKSSLLAAI
gi|294102070|ref|YP_003553928.1|  ....................................----------------------------
gi|294102221|ref|YP_003554079.1|  ....................................------KRQFVFFGGKGGTGKTTCAAAY
gi|294101356|ref|YP_003553214.1|  ....................................-------GSKTGLIGSNGTGKTTLFKII
gi|294101345|ref|YP_003553203.1|  ....................................---SLYEGELVCLIGPNGVGKTTLLKTL
gi|294102145|ref|YP_003554003.1|  ....................................-------------------GKTTLVKAL
gi|294101756|ref|YP_003553614.1|  ....................................----------------------------
gi|294102549|ref|YP_003554407.1|  ............................lhlmeryn----------------------------
gi|294101372|ref|YP_003553230.1|  .........................dlldrcntgfl----LREGIRVALVGRPNVGKSSLLNAL
gi|294101016|ref|YP_003552874.1|  ....................................-------YNPLFIWGGVGLGKTHLMHAI
gi|294101780|ref|YP_003553638.1|  ....................................-----------VITGPSGSGKSSLAFDT
gi|294101686|ref|YP_003553544.1|  ....................................----WVSGGVVLLGGQPGIGKSTLLLQV
gi|294102507|ref|YP_003554365.1|  ....................................-----AGHHNLLFIGSPGSGKTMLARAI
gi|294101471|ref|YP_003553329.1|  ....................................-----KKGEVVGLVGPSGKGKTTLGDIL
gi|294101845|ref|YP_003553703.1|  ....................................---LHFKGRFIAITGESGAGKSSIVRAL
gi|294101553|ref|YP_003553411.1|  ....................................--------TLCMMVGLQGSGKTTSAVKI
gi|294101853|ref|YP_003553711.1|  ....................................--------PHLLVAGTTGSGKSVFVNSC
gi|294101780|ref|YP_003553638.1|  ....................................-----------CISGVSGSGKSSLLYDV
gi|294102079|ref|YP_003553937.1|  ....................................-------NLVVAIDGPAGAGKSSVAKKV
gi|294101472|ref|YP_003553330.1|  ....................................----IPSESVFFLVGETGSGKTPIAQAI
gi|294102235|ref|YP_003554093.1|  ....................................-----------ALAGNPNTGKTSLFNLL
gi|294102390|ref|YP_003554248.1|  ....................................----------------------------
gi|294101443|ref|YP_003553301.1|  ....................................---------SCVLYGPPGVGKTTLVRLM
gi|294101748|ref|YP_003553606.1|  ....................................-----------------------IHRAV
gi|294101649|ref|YP_003553507.1|  ....................................---------RVILLGPPGAGKGTQAAEI
gi|294101715|ref|YP_003553573.1|  ....................................-----RSFHVLVVTGPNTGGKTVALKT-
gi|294101925|ref|YP_003553783.1|  ....................................--------RHCAILGSTGSGKSNTTVSI
gi|294101367|ref|YP_003553225.1|  ..................airevtkkyidtleikct----------------------------
gi|294101751|ref|YP_003553609.1|  ....................................-IEAMRAHDIVFAIGPAGTGKTYLAVCH
gi|294101046|ref|YP_003552904.1|  ....................................----------AVLSAPTGAGKTLVAYLW
gi|294101779|ref|YP_003553637.1|  ....................................------------LLGVTGSGKTFTVANV
gi|294101226|ref|YP_003553084.1|  ....................................----------------------------
gi|294101892|ref|YP_003553750.1|  ....................................----------------------------
gi|294102315|ref|YP_003554173.1|  ....................................---------HGMIIGMTGSGKTGLGIAL
gi|294102188|ref|YP_003554046.1|  ....................................----------------------------
gi|294102320|ref|YP_003554178.1|  ....................................----------------------------
gi|294102169|ref|YP_003554027.1|  ....................................---------VINIIGSPGAGKTTLLEAT
gi|294101254|ref|YP_003553112.1|  ....................................----------------------------
gi|294102077|ref|YP_003553935.1|  ....................................---------TVALTGYTNSGKSTLLQQL
gi|294102510|ref|YP_003554368.1|  ....................................----------LAVVGIPNVGKSLFLN--
gi|294101748|ref|YP_003553606.1|  .........................lvwtpgqyvvr----------------------------
gi|294101141|ref|YP_003552999.1|  ....................................---------RTCLLAPCGSGKTLAAWKW
gi|294101018|ref|YP_003552876.1|  ....................................----------NLLVGNNGSGKTNALEAI
gi|294101692|ref|YP_003553550.1|  ....................................-----QRNTVFVAEAPTGIGKTFALLAP
gi|294101032|ref|YP_003552890.1|  ....................................---------LTVASGKGGTGKTCIAASL
gi|294101031|ref|YP_003552889.1|  ....................................--------EIVIISGKGGTGKTCIMAAL
gi|294101431|ref|YP_003553289.1|  ....................................-------TKVIVIAGPSGSGKTTTAKRL
gi|294102167|ref|YP_003554025.1|  ....................................------------VTGDVGAGKSTVSQIW
gi|294101458|ref|YP_003553316.1|  ....................................------DRRVGVIWHTQGSGKSLSMVFY
gi|294102320|ref|YP_003554178.1|  ....................................---IVLEYGGVFISDVVGLGKTYISAML
gi|294101940|ref|YP_003553798.1|  ....................................----VYPGEMLNLAGAQGSLKTSLALHG
gi|294102120|ref|YP_003553978.1|  ....................................--ACVEDGSSLILGGGTGVGKTHLAIAM
gi|294101791|ref|YP_003553649.1|  ....................................------SGLTILLYGDLGAGKTVLVKGL
gi|294102136|ref|YP_003553994.1|  ....................................-------QGINILSGTNGTCKTSLLHIV
gi|294101830|ref|YP_003553688.1|  ....................................---------CLIITGMSGAGKSTVLNIL
gi|294102042|ref|YP_003553900.1|  ....................................----------------------------
gi|294102015|ref|YP_003553873.1|  ....................................-----------AIIGPTAVGKTKLSLEI
gi|294102787|ref|YP_003554645.1|  ....................................-----------LILGDNESGKTTLMSFL
gi|294102032|ref|YP_003553890.1|  ....................................------KGYNIFVLGNPGSGRTSYSLQR
gi|294102010|ref|YP_003553868.1|  ....................................--RLYEWPKAVAVTGALGSGKTEWVLNM
gi|294101586|ref|YP_003553444.1|  ....................................------------------SGKTKLCLLL
gi|294101458|ref|YP_003553316.1|  ....................................----------------------------
gi|294102625|ref|YP_003554483.1|  .............igflehaapergldsfkkmclfv----------------------------
gi|294102478|ref|YP_003554336.1|  ....................................----------------------------
gi|294101874|ref|YP_003553732.1|  ....................................---------VIAFVGPAGTGKSQRAQYV
gi|294102071|ref|YP_003553929.1|  ....................................----------------------------


                                    30                                40          50                
                                     |                                 |           |                
d1a1va1                             YAAQ......................G..YKVLVLN.PSVA.ATLGFGAYMSKA...H......
gi|294102520|ref|YP_003554378.1|  AQGLakl...................G..KKV----.----.------------...-......
gi|294102529|ref|YP_003554387.1|  GQ--......................-..-------.----.------------...-......
gi|294102437|ref|YP_003554295.1|  ----......................-..-------.----.------------...-......
gi|294102168|ref|YP_003554026.1|  IAYLiekgyas...............P..KGILAVT.FTNK.AAREMGERVQAL...V......
gi|294101779|ref|YP_003553637.1|  LAQF......................D..RPVLVLA.HNKT.LAAQLYTEFKTF...F......
gi|294102457|ref|YP_003554315.1|  ----......................-..-------.----.AIRQMATRVGRQ...-......
gi|294101625|ref|YP_003553483.1|  LFYTgr....................N..YKMGETH.E-GS.ATMDWMEQERER...-......
gi|294101185|ref|YP_003553043.1|  AQRIvrgdvpeglkd...........R..SIFALDM.GSLV.AGAKYRGEFEER...L......
gi|294102626|ref|YP_003554484.1|  FIWIlvtgrad...............T..NEILTLT.FTEK.AALEMAERIKNL...L......
gi|294101765|ref|YP_003553623.1|  IKQV......................N..ALTLNVT.TIED.PVERFHEGINQVe..V......
gi|294102479|ref|YP_003554337.1|  PRFYdpsr..................G..KVSVDGC.DVRT.LDLTELRKQIGI...V......
gi|294101904|ref|YP_003553762.1|  AGFEkpt...................E..-------.----.------------...-......
gi|294102557|ref|YP_003554415.1|  AGFEdptegdvffg............D..RRVNDV-.----.------------...-......
gi|294101807|ref|YP_003553665.1|  ----......................-..-------.----.------------...-......
gi|294101806|ref|YP_003553664.1|  AKWA......................E..SDIVVYV.GCGE.RGNEM-------...-......
gi|294102649|ref|YP_003554507.1|  NRLEepss..................G..SICIGDT.DITR.LSTPELRKLRRR...V......
gi|294101185|ref|YP_003553043.1|  AEALfdsed.................N..-------.---M.IRIDMSEYMEKF...-......
gi|294102868|ref|YP_003554726.1|  GGFLqpdegsiile............G..EDITHLP.PEKR.PTATVFQSYALF...P......
gi|294102500|ref|YP_003554358.1|  ADLV......................L..APFVKVE.AT--.------------...-......
gi|294102409|ref|YP_003554267.1|  VVLNalsgn.................G..VHVVTVN.DYLAkRDAEWMGPIYRF...L......
gi|294102354|ref|YP_003554212.1|  LFSN......................-..-------.----.------------...-......
gi|294101565|ref|YP_003553423.1|  ADFLfgse..................D..--AMIRL.DMSE.FME-------RHe..V......
gi|294101424|ref|YP_003553282.1|  CRLEdindgeiyly............G..QRVDNGK.HSNK.EVATLVGMIFQQ...F......
gi|294101976|ref|YP_003553834.1|  AFEK......................G..YDVLVIM.TDML.YYCESLREISAA...R......
gi|294101061|ref|YP_003552919.1|  NQLTipds..................G..-------.----.------------...-......
gi|294101048|ref|YP_003552906.1|  IRLIeptsgeiwv.............N..-------.----.------------...-......
gi|294101977|ref|YP_003553835.1|  AKWC......................N..AEIIIYI.GCGE.RGNEMTEVLEE-...-......
gi|294101084|ref|YP_003552942.1|  NCLEyidsgtitia............G..-------.----.------------...-......
gi|294101565|ref|YP_003553423.1|  AQKIqdgniaeilr............G..KKIVQLNiGNLV.AGTKYRGEFEER...-......
gi|294101786|ref|YP_003553644.1|  LRLCeptsgtvffd............G..-------.----.------------...-......
gi|294101493|ref|YP_003553351.1|  ----......................-..-------.----.------------...-......
gi|294101884|ref|YP_003553742.1|  ILEFrkk...................K..-------.----.------------...-......
gi|294101894|ref|YP_003553752.1|  AKKL......................N..VPFAMAD.ATTL.TEAGYVGEDVEN...-......
gi|294101778|ref|YP_003553636.1|  AGEA......................D..VPFFSVS.GS-D.FVEMFVGVGAAR...-......
gi|294102313|ref|YP_003554171.1|  GALDaps...................E..GSVV---.----.------------...-......
gi|294102640|ref|YP_003554498.1|  IGLIeat...................G..GEVLF--.----.------------...-......
gi|294101376|ref|YP_003553234.1|  ANET......................D..VYFTHIS.GP-E.IIGKFYGESEER...-......
gi|294102641|ref|YP_003554499.1|  LQLI......................-..-------.----.------------...-......
gi|294101359|ref|YP_003553217.1|  ----......................-..-KVLILS.PTRE.LSQQIWKEAKWFgnyI......
gi|294102459|ref|YP_003554317.1|  ANAVtvnh..................P..-------.----.------------...-......
gi|294101785|ref|YP_003553643.1|  MRIIptppghie..............S..-------.----.------------...-......
gi|294101376|ref|YP_003553234.1|  AHES......................G..VNFIPVK.GP-A.LMSKYVGESERA...-......
gi|294102074|ref|YP_003553932.1|  FEQM......................P..DLVYS--.----.------------...-......
gi|294102442|ref|YP_003554300.1|  TRELiqtr..................G..QVTVGDQ.NLRK.LRASQLPYYRRY...L......
gi|294101577|ref|YP_003553435.1|  VGLIkpd...................S..GR-----.----.------------...-......
gi|294101171|ref|YP_003553029.1|  TGVYdpd...................G..GRIL---.----.------------...-......
gi|294102413|ref|YP_003554271.1|  TGFYkpt...................E..-------.----.------------...-......
gi|294102187|ref|YP_003554045.1|  SSFIpn....................R..ERIVTIE.DAAE.LSMQQDHVVRME...-......
gi|294102332|ref|YP_003554190.1|  GA--......................-..-------.----.------------...-......
gi|294102831|ref|YP_003554689.1|  SAELgrl...................G..YSVL---.----.------------...-......
gi|294101321|ref|YP_003553179.1|  TKCLstk...................G..WSNFEAY.----.------------...-......
gi|294101626|ref|YP_003553484.1|  TKCLstk...................G..WSNFEAY.----.------------...-......
gi|294101069|ref|YP_003552927.1|  N---......................-..-------.----.------------...-......
gi|294102759|ref|YP_003554617.1|  PGLLpsntevs...............G..-------.----.------------...-......
gi|294101055|ref|YP_003552913.1|  NRLV......................-..-------.----.------------...-......
gi|294101254|ref|YP_003553112.1|  YGLYnpdrghilid............G..KKVSFSS.PKDA.-IAAGIGMVHQH...F......
gi|294102760|ref|YP_003554618.1|  LGLIspte..................G..NVELFGE.NIDK.CSHSQLIELRRR...C......
gi|294101659|ref|YP_003553517.1|  NALLlpsq..................G..ACFVYGM.DTRE.EKNLWAIRSHVA...Mvfqnpd
gi|294101172|ref|YP_003553030.1|  MSEVrrek..................G..LINFSGA.PLAQ.RSYDVVKQG---...-......
gi|294102017|ref|YP_003553875.1|  ALLVimaqm.................G..AFIPAAE.ASMG.LMDRVFTRIGAR...D......
gi|294101748|ref|YP_003553606.1|  AFKAsea...................G..KQVVVLV.PTTI.LAQQHYHTFRSRmagF......
gi|294102409|ref|YP_003554267.1|  ----......................-..-------.----.---N--------...-......
gi|294102070|ref|YP_003553928.1|  AGSD......................R..VL-----.----.------------...-......
gi|294102390|ref|YP_003554248.1|  LLQAveg...................G..YQGAFMA.PTEI.LAQQHYYRLHSFlepL......
gi|294101403|ref|YP_003553261.1|  IAEAqka...................G..G----IA.AFID.AEHALDPRLAAS...L......
gi|294101730|ref|YP_003553588.1|  AKSLnctgqkqsvepcndcpnclainG..GESLDVI.EIDG.ASNNSVDEVREL...K......
gi|294102602|ref|YP_003554460.1|  FKAA......................-..-------.----.------------...-......
gi|294102663|ref|YP_003554521.1|  NR--......................-..-------.----.------------...-......
gi|294101436|ref|YP_003553294.1|  ----......................-..-------.----.------------...-......
gi|294102150|ref|YP_003554008.1|  IEYT......................G..TVEIRKM.KAQL.LDSLDLERERGI...T......
gi|294101607|ref|YP_003553465.1|  SFALaka...................G..YKVVAI-.----.------------...-......
gi|294102035|ref|YP_003553893.1|  AIRAagw...................N..MKVGIIQ.FMKG.W--PQYGELASLar.F......
gi|294102412|ref|YP_003554270.1|  AGLVrsakgkilytsnegveenil..G..KTPEFIV.KKGI.AMSPEGRRILPH...L......
gi|294101660|ref|YP_003553518.1|  NALIvpe...................K..-------.----.------------...-......
gi|294102549|ref|YP_003554407.1|  YGLYsptagkfki.............D..NKILTIK.TPRD.AMKYGIGMVHQH...F......
gi|294102841|ref|YP_003554699.1|  LGLEkpa...................R..GKIEVLG.TTPD.RAVTS-------...-......
gi|294101272|ref|YP_003553130.1|  TGT-......................-..-------.----.------------...-......
gi|294101433|ref|YP_003553291.1|  AVALakk...................G..FSVGILD.A--D.ITGPSVPKLMGV...T......
gi|294101963|ref|YP_003553821.1|  RQ--......................-..-------.----.------------...-......
gi|294101356|ref|YP_003553214.1|  SQSEvptegnisygy...........N..VKMGFFS.QESA.QNLNYNRTIWEE...Isntgyl
gi|294102542|ref|YP_003554400.1|  AFLEtpt...................E..GTVYFKK.ERVE.TVSVNYRR----...-......
gi|294101861|ref|YP_003553719.1|  AHEM......................G..GQLRVTT.GP--.-ALEKAGDIAAI...-......
gi|294102400|ref|YP_003554258.1|  AQYGgve...................R..KEPILIF.SLEM.SAEQLVQRMLGS...E......
gi|294102043|ref|YP_003553901.1|  KEQLqqkk..................K..EPVL---.----.-----------W...T......
gi|294101077|ref|YP_003552935.1|  MGLLrpqkgdiiv.............K..-------.----.------------...-......
gi|294102348|ref|YP_003554206.1|  MGL-......................-..-------.----.------------...-......
gi|294102040|ref|YP_003553898.1|  AEQFhrq...................G..KKVILGA.A-DT.FRAAAIDQLKIW...-......
gi|294101613|ref|YP_003553471.1|  RWV-......................-..-------.----.------------...-......
gi|294101367|ref|YP_003553225.1|  F---......................-..-------.----.------------...-......
gi|294101893|ref|YP_003553751.1|  ARAL......................G..RRFVNFS.LG--.------------...-......
gi|294101841|ref|YP_003553699.1|  SNARpkia..................G..YPFTTLS.P---.------------...-......
gi|294102070|ref|YP_003553928.1|  ----......................-..-------.----.------------...-......
gi|294102221|ref|YP_003554079.1|  AYALsrl...................G..IKTLVVS.T--D.PAHSLADAFNRP...I......
gi|294101356|ref|YP_003553214.1|  MGLVepr...................E..--GNVYF.PK--.------------...-......
gi|294101345|ref|YP_003553203.1|  AGTQnpl...................G..GEIRVLE.SS--.------------...-......
gi|294102145|ref|YP_003554003.1|  T---......................-..-------.----.------------...-......
gi|294101756|ref|YP_003553614.1|  ----......................-..-------.-R--.------------...-......
gi|294102549|ref|YP_003554407.1|  ----......................-..-------.----.------------...-......
gi|294101372|ref|YP_003553230.1|  LKES......................R..AIVTAIP.GT--.-TRDLIEEVL--...-......
gi|294101016|ref|YP_003552874.1|  GHYVlnknn.................S..LKVTYVS.S-EK.FINEFIQSIKNN...-......
gi|294101780|ref|YP_003553638.1|  LYAE......................G..QRRYV--.----.------------...-......
gi|294101686|ref|YP_003553544.1|  CGAMaar...................G..ERVLYIS.GE-E.SASQVALRARRL...L......
gi|294102507|ref|YP_003554365.1|  RGIV......................-..---PPLS.HE-E.LLESLQIHSSAR...P......
gi|294101471|ref|YP_003553329.1|  LGLIvpdr..................G..KVLWKGQ.DIRT.LSKTKKKNLRPY...-......
gi|294101845|ref|YP_003553703.1|  EFASgkraqselirageeea......E..-------.----.------------...-......
gi|294101553|ref|YP_003553411.1|  AKRIqnah..................N..PLVVACD.LRRP.AAIEQLKVLAQQ...S......
gi|294101853|ref|YP_003553711.1|  IAGLcycrkpe...............E..LRLLMID.PK--.------------...-......
gi|294101780|ref|YP_003553638.1|  LYK-......................-..-------.----.------------...-......
gi|294102079|ref|YP_003553937.1|  AELL......................G..LDYL---.----.------------...-......
gi|294101472|ref|YP_003553330.1|  AGTLakrlsvc...............G..KVFLKKQ.----.------------...-......
gi|294102235|ref|YP_003554093.1|  ----......................-..-------.----.------------...-......
gi|294102390|ref|YP_003554248.1|  ----......................-..-------.----.-VTERYEYLKKL...F......
gi|294101443|ref|YP_003553301.1|  AMVT......................E..RSLLEIN.AVSA.KVSELRDLVEEA...-......
gi|294101748|ref|YP_003553606.1|  LQELnr....................G..GQVFFVS.NRIN.RLKGKYEELKIM...F......
gi|294101649|ref|YP_003553507.1|  KTKY......................K..-------.----.------------...-......
gi|294101715|ref|YP_003553573.1|  ----......................-..-------.----.------------...-......
gi|294101925|ref|YP_003553783.1|  LRAIlndyd.................G..SRVILID.PHGE.YA----------...-......
gi|294101367|ref|YP_003553225.1|  ----......................-..-------.----.------------...-......
gi|294101751|ref|YP_003553609.1|  GVAMlkag..................A..ISRIVLV.RPAV.EAGESLGYLPGD...L......
gi|294101046|ref|YP_003552904.1|  AGLLttegkaqmpe............Gi.SRIIFTA.PIKA.LSNERYMDLRRM...-......
gi|294101779|ref|YP_003553637.1|  LAQF......................D..RPVLVLA.HNKT.LAAQLYTEFKTF...F......
gi|294101226|ref|YP_003553084.1|  ----......................-..----YTL.DPTN.EAEQVARRMVDE...-......
gi|294101892|ref|YP_003553750.1|  ----......................-..-------.----.------------...-......
gi|294102315|ref|YP_003554173.1|  LEEAlmd...................N..IPVIAID.P---.------------...-......
gi|294102188|ref|YP_003554046.1|  ----......................-..-------.----.------------...-......
gi|294102320|ref|YP_003554178.1|  ----......................-..-------.----.------------...-......
gi|294102169|ref|YP_003554027.1|  KKAA......................S..FRFAVIE.G-DI.ATSRDAERLSKL...-......
gi|294101254|ref|YP_003553112.1|  ----......................-..-------.----.--R---------...-......
gi|294102077|ref|YP_003553935.1|  SHGR......................N..---LYV-.----.------------...-......
gi|294102510|ref|YP_003554368.1|  ----......................-..-------.----.------------...-......
gi|294101748|ref|YP_003553606.1|  ----......................-..-------.----.------------...-......
gi|294101141|ref|YP_003552999.1|  GSGVasrh..................Pi.SRFIFLY.PTRA.TATEGFRDYVSW...A......
gi|294101018|ref|YP_003552876.1|  HILSgwgpfrss..............R..KSFLVNW.DTEE.KQAYLRGYFSGE...T......
gi|294101692|ref|YP_003553550.1|  ALKWalpq..................E..KRILFLT.AGIT.LQEQLIRKDLPR...L......
gi|294101032|ref|YP_003552890.1|  ALSLskgtaidldvdepdl.......G..-------.----.------------...-......
gi|294101031|ref|YP_003552889.1|  CSSFsgkavfcdvdvda.........P..NLQLLLN.PQDE.QAFSFTGRKIPE...I......
gi|294101431|ref|YP_003553289.1|  KIQLqvc...................G..-----LN.PTVI.SL----------...-......
gi|294102167|ref|YP_003554025.1|  ----......................-..-------.----.------------...-......
gi|294101458|ref|YP_003553316.1|  AGKLvideele...............N..PTIVVIT.DRND.LDDQLFSTFLKS...Eellrnt
gi|294102320|ref|YP_003554178.1|  AGQL......................D..GRTLVIA.PPVL.LEKTNPGSWPNV...F......
gi|294101940|ref|YP_003553798.1|  AVNFlqgnp.................E..RRVLFFS.L---.------------...-......
gi|294102120|ref|YP_003553978.1|  IQELta....................K..GKSAVFV.PVVE.ILDEIRAGFDEG...-......
gi|294101791|ref|YP_003553649.1|  GDGL......................-..-------.----.------------...-......
gi|294102136|ref|YP_003553994.1|  SNSFqevn..................K..---GCPW.VTDA.SCLTAIKKVNKL...I......
gi|294101830|ref|YP_003553688.1|  ----......................-..-------.----.------------...-......
gi|294102042|ref|YP_003553900.1|  ----......................S..CRLVVIQ.SADT.LLLPA-------...-......
gi|294102015|ref|YP_003553873.1|  AETL......................K..AEVISVD.SRQV.YRYMNVGTDKVT...F......
gi|294102787|ref|YP_003554645.1|  RYSL......................-..-------.----.------------...-......
gi|294102032|ref|YP_003553890.1|  LHESakekpapd..............DwiYAYNFSD.PSRP.LAINLPAGKGKE...-......
gi|294102010|ref|YP_003553868.1|  ALALlea...................G..EKV----.----.------------...-......
gi|294101586|ref|YP_003553444.1|  LKYLkea...................G..IHVGYIK.HSHE.KVLSPMDTDT--...-......
gi|294101458|ref|YP_003553316.1|  ----......................-..-------.----.------------...-......
gi|294102625|ref|YP_003554483.1|  ----......................-..-------.----.------------...-......
gi|294102478|ref|YP_003554336.1|  ----......................-..-------.----.------------...-......
gi|294101874|ref|YP_003553732.1|  ATDNnvdyiiddglvia.........R..-GRIMTG.KSAK.SEKNLVRAIRRA...L......
gi|294102071|ref|YP_003553929.1|  ----......................P..GPAILLF.PERA.LAEFFYSFLETEgv.E......


                                         60          70                                             
                                          |           |                                             
d1a1va1                             ...G.VDPNIRTGVRT..ITTG................................SP........
gi|294102520|ref|YP_003554378.1|  ...-.-----------..----................................--........
gi|294102529|ref|YP_003554387.1|  ...-.-----------..----................................--........
gi|294102437|ref|YP_003554295.1|  ...-.-----------..----................................--........
gi|294102168|ref|YP_003554026.1|  ...G.AKASAMQVSTF..HSFG................................LHflfrnsdq
gi|294101779|ref|YP_003553637.1|  ...PhNAVHYFVSYYD..YYQPeayips..........................SDtyiekdas
gi|294102457|ref|YP_003554315.1|  ...-.-----------..----................................--........
gi|294101625|ref|YP_003553483.1|  ...G.ITISSA-----..----................................--........
gi|294101185|ref|YP_003553043.1|  ...K.AVLNEIKTSE-..----................................--........
gi|294102626|ref|YP_003554484.1|  ...L.QLAMELPSQKV..FFQK................................AAdridegyi
gi|294101765|ref|YP_003553623.1|  ...D.ERAGRTFEVVL..R---................................--........
gi|294102479|ref|YP_003554337.1|  ...P.QDPVLMKGSLA..FNIS................................YGfpqateed
gi|294101904|ref|YP_003553762.1|  ...-.-----------..----................................--........
gi|294102557|ref|YP_003554415.1|  ...-.-----------..----................................--........
gi|294101807|ref|YP_003553665.1|  ...-.-----------..----................................--........
gi|294101806|ref|YP_003553664.1|  ...-.-----------..----................................--........
gi|294102649|ref|YP_003554507.1|  ...G.MIFQHFNLLTS..RT--................................-Vfqnvafpl
gi|294101185|ref|YP_003553043.1|  ...-.-----------..--SV................................SR........
gi|294102868|ref|YP_003554726.1|  ...H.MTVLQNVIYGL..KFKK................................--........
gi|294102500|ref|YP_003554358.1|  ...-.-----------..----................................--........
gi|294102409|ref|YP_003554267.1|  ...G.LSVKCIYAYMD..QKERkeayl...........................SD........
gi|294102354|ref|YP_003554212.1|  ...-.-----------..----................................--........
gi|294101565|ref|YP_003553423.1|  ...G.KLIGAPPGYVG..YDEG................................G-........
gi|294101424|ref|YP_003553282.1|  ...N.LFPHLSVLDNI..TL--................................--........
gi|294101976|ref|YP_003553834.1|  ...-.-----------..----................................--........
gi|294101061|ref|YP_003552919.1|  ...-.-----------..----................................--........
gi|294101048|ref|YP_003552906.1|  ...-.-----------..----................................--........
gi|294101977|ref|YP_003553835.1|  ...-.-----------..----................................--........
gi|294101084|ref|YP_003552942.1|  ...-.-----------..----................................--........
gi|294101565|ref|YP_003553423.1|  ...-.-----------..----................................--........
gi|294101786|ref|YP_003553644.1|  ...-.-----------..----................................--........
gi|294101493|ref|YP_003553351.1|  ...-.-----------..----................................--........
gi|294101884|ref|YP_003553742.1|  ...-.-----------..----................................--........
gi|294101894|ref|YP_003553752.1|  ...-.-----------..----................................--........
gi|294101778|ref|YP_003553636.1|  ...-.-----------..----................................--........
gi|294102313|ref|YP_003554171.1|  ...-.-----------..----................................--........
gi|294102640|ref|YP_003554498.1|  ...-.-----------..----................................--........
gi|294101376|ref|YP_003553234.1|  ...-.-----------..----................................--........
gi|294102641|ref|YP_003554499.1|  ...-.-----------..----................................--........
gi|294101359|ref|YP_003553217.1|  ...N.VSAASLVGGMD..MSQQirslrdg.........................SA........
gi|294102459|ref|YP_003554317.1|  ...-.-----------..----................................--........
gi|294101785|ref|YP_003553643.1|  ...-.-----------..----................................--........
gi|294101376|ref|YP_003553234.1|  ...-.-----------..----................................--........
gi|294102074|ref|YP_003553932.1|  ...-.-----------..----................................--........
gi|294102442|ref|YP_003554300.1|  ...G.VVFQDFKL---..----................................--........
gi|294101577|ref|YP_003553435.1|  ...-.-----------..----................................--........
gi|294101171|ref|YP_003553029.1|  ...-.-----------..----................................--........
gi|294102413|ref|YP_003554271.1|  ...-.-----------..----................................--........
gi|294102187|ref|YP_003554045.1|  ...-.-----------..---S................................RP........
gi|294102332|ref|YP_003554190.1|  ...-.-----------..----................................--........
gi|294102831|ref|YP_003554689.1|  ...-.-----------..----................................--........
gi|294101321|ref|YP_003553179.1|  ...-.-----------..----................................--........
gi|294101626|ref|YP_003553484.1|  ...-.-----------..----................................--........
gi|294101069|ref|YP_003552927.1|  ...-.-----------..----................................--........
gi|294102759|ref|YP_003554617.1|  ...-.-----------..----................................--........
gi|294101055|ref|YP_003552913.1|  ...-.-----------..----................................--........
gi|294101254|ref|YP_003553112.1|  ...M.LIPSQTVWENM..ILGLeglpqllpkkeihqqiidisrqyglevdpd..AK........
gi|294102760|ref|YP_003554618.1|  ...G.YVPQDPYG---..----................................--........
gi|294101659|ref|YP_003553517.1|  ...N.QIVGTVVEDDT..AFGPeniglspleirqrvdwalsvtglshkm.....QN........
gi|294101172|ref|YP_003553030.1|  ...-.-----------..----................................--........
gi|294102017|ref|YP_003553875.1|  ...E.LSRGNSTFMVE..MIE-................................--........
gi|294101748|ref|YP_003553606.1|  ...P.IRVEVLSRFVS..TSRQ................................KR........
gi|294102409|ref|YP_003554267.1|  ...-.-----------..----................................--........
gi|294102070|ref|YP_003553928.1|  ...-.-----------..----................................--........
gi|294102390|ref|YP_003554248.1|  ...G.VSVVLLIGSLK..NRAReltlqkistge.....................AH........
gi|294101403|ref|YP_003553261.1|  ...G.VDVQSLYVAQP..DSGE................................Q-........
gi|294101730|ref|YP_003553588.1|  ...-.-----------..----................................--........
gi|294102602|ref|YP_003554460.1|  ...-.-----------..----................................--........
gi|294102663|ref|YP_003554521.1|  ...-.-----------..----................................--........
gi|294101436|ref|YP_003553294.1|  ...-.-----------..----................................--........
gi|294102150|ref|YP_003554008.1|  ...I.KLVPVRMSYKS..KDGNey..............................IL........
gi|294101607|ref|YP_003553465.1|  ...-.-----------..----................................--........
gi|294102035|ref|YP_003553893.1|  ...P.EIQLVQTGRPD..FVKKgsplq...........................FD........
gi|294102412|ref|YP_003554270.1|  ...T.VEENLLLGAYI..RDDKegiekdmdhvyslfprlre.............R-........
gi|294101660|ref|YP_003553518.1|  ...-.-----------..----................................--........
gi|294102549|ref|YP_003554407.1|  ...M.LVPSLPVYKNV..VLGDepttrglifnhhgaieavrhlsaqyglnidplAP........
gi|294102841|ref|YP_003554699.1|  ...-.-----------..----................................--........
gi|294101272|ref|YP_003553130.1|  ...-.-----------..----................................--........
gi|294101433|ref|YP_003553291.1|  ...D.SPYGSPQGIIP..PASSi...............................FD........
gi|294101963|ref|YP_003553821.1|  ...-.-----------..----................................--........
gi|294101356|ref|YP_003553214.1|  gtdT.-----------..---Ekrgllgaflfsgddiykl..............IS........
gi|294102542|ref|YP_003554400.1|  ...-.-----------..----................................--........
gi|294101861|ref|YP_003553719.1|  ...-.-----------..----................................--........
gi|294102400|ref|YP_003554258.1|  ...A.KVNIHDIRNGS..FAEKdwekladaagrlsqaplfid............DS........
gi|294102043|ref|YP_003553901.1|  ...R.EPGGWVHGDFV..RT--................................--........
gi|294101077|ref|YP_003552935.1|  ...-.-----------..----................................--........
gi|294102348|ref|YP_003554206.1|  ...-.-----------..----................................--........
gi|294102040|ref|YP_003553898.1|  ...G.ERTGSRVIAQQ..QGSD................................S-........
gi|294101613|ref|YP_003553471.1|  ...-.-----------..----................................--........
gi|294101367|ref|YP_003553225.1|  ...-.-----------..----................................--........
gi|294101893|ref|YP_003553751.1|  ...-.---GVRDEAEI..RGHR................................RT........
gi|294101841|ref|YP_003553699.1|  ...-.-----------..----................................--........
gi|294102070|ref|YP_003553928.1|  ...-.-----------..----................................--........
gi|294102221|ref|YP_003554079.1|  ...G.LDVIPVAENLWgiEIDAeeeakkymkaiqdkmlhivsaviveeikrq..IE........
gi|294101356|ref|YP_003553214.1|  ...G.IRIGYLSQDLV..EIED................................TVllhylkkq
gi|294101345|ref|YP_003553203.1|  ...-.-----------..----................................--........
gi|294102145|ref|YP_003554003.1|  ...-.-----------..----................................--........
gi|294101756|ref|YP_003553614.1|  ...-.-----------..----................................--........
gi|294102549|ref|YP_003554407.1|  ...-.----------I..----................................--........
gi|294101372|ref|YP_003553230.1|  ...-.-----------..----................................--........
gi|294101016|ref|YP_003552874.1|  ...-.-----------..----................................--........
gi|294101780|ref|YP_003553638.1|  ...-.-----------..----................................--........
gi|294101686|ref|YP_003553544.1|  ...A.LHNNLDLFCDT..DLDG................................A-........
gi|294102507|ref|YP_003554365.1|  ...D.YKPSLEPPFHI..VHPTa...............................ST........
gi|294101471|ref|YP_003553329.1|  ...-.-----------..----................................--........
gi|294101845|ref|YP_003553703.1|  ...-.-----------..----................................--........
gi|294101553|ref|YP_003553411.1|  ...K.VAFYGPSGGTQ..DVI-................................--........
gi|294101853|ref|YP_003553711.1|  ...-.-----------..----................................--........
gi|294101780|ref|YP_003553638.1|  ...-.-----------..----................................--........
gi|294102079|ref|YP_003553937.1|  ...-.-----------..----................................--........
gi|294101472|ref|YP_003553330.1|  ...-.-----------..----................................--........
gi|294102235|ref|YP_003554093.1|  ...-.-----------..----................................--........
gi|294102390|ref|YP_003554248.1|  ...PdLNVGLLHGQLP..SSEK................................ET........
gi|294101443|ref|YP_003553301.1|  ...-.-----------..----................................--........
gi|294101748|ref|YP_003553606.1|  ...P.EARISMAHGQM..AEKDlertmldfyngn....................LD........
gi|294101649|ref|YP_003553507.1|  ...-.-----------..----................................--........
gi|294101715|ref|YP_003553573.1|  ...-.-----------..----................................--........
gi|294101925|ref|YP_003553783.1|  ...-.-----------..----................................--........
gi|294101367|ref|YP_003553225.1|  ...-.-------G---..----................................--........
gi|294101751|ref|YP_003553609.1|  ...R.EKVEPYVRPLY..---D................................AF........
gi|294101046|ref|YP_003552904.1|  ...G.FDVGIETGDFK..RNEE................................AP........
gi|294101779|ref|YP_003553637.1|  ...PhNAVHYFVSYYD..YYQPeayips..........................S-........
gi|294101226|ref|YP_003553084.1|  ...G.ADLAIIVLDAT..ALER................................--........
gi|294101892|ref|YP_003553750.1|  ...D.-----------..----................................--........
gi|294102315|ref|YP_003554173.1|  ...-.-----------..----................................--........
gi|294102188|ref|YP_003554046.1|  ...-.-----------..----................................--........
gi|294102320|ref|YP_003554178.1|  ...-.-----------..----................................--........
gi|294102169|ref|YP_003554027.1|  ...G.VP---------..----................................--........
gi|294101254|ref|YP_003553112.1|  ...-.-----------..----................................--........
gi|294102077|ref|YP_003553935.1|  ...-.-----------..----................................--........
gi|294102510|ref|YP_003554368.1|  ...-.-----------..----................................--........
gi|294101748|ref|YP_003553606.1|  ...-.-----------..----................................--........
gi|294101141|ref|YP_003552999.1|  ...P.ETDGTLLHGTS..NYELqgmfdnpdprsekefltndrlfavglwq....KR........
gi|294101018|ref|YP_003552876.1|  ...N.LDIVATVGEKN..IIQ-................................CD........
gi|294101692|ref|YP_003553550.1|  ...K.ELLGYDVSFGL..LKGR................................GNyvcvrral
gi|294101032|ref|YP_003552890.1|  ...-.-----------..----................................--........
gi|294101031|ref|YP_003552889.1|  ...D.TERCTVCGGCV..GFCR................................--........
gi|294101431|ref|YP_003553289.1|  ...-.-----------..----................................--........
gi|294102167|ref|YP_003554025.1|  ...-.-----------..----................................--........
gi|294101458|ref|YP_003553316.1|  ...P.VQAQDRVHLRE..LLNNrts.............................GG........
gi|294102320|ref|YP_003554178.1|  ...S.DFR--------..----................................VP........
gi|294101940|ref|YP_003553798.1|  ...-.-----------..----................................--........
gi|294102120|ref|YP_003553978.1|  ...-.-----------..----................................--........
gi|294101791|ref|YP_003553649.1|  ...-.-----------..----................................--........
gi|294102136|ref|YP_003553994.1|  ...N.PKIETLTKGDK..TYNDp...............................ANqvkgtlft
gi|294101830|ref|YP_003553688.1|  ...-.-----------..----................................--........
gi|294102042|ref|YP_003553900.1|  ...-.-----------..----................................--........
gi|294102015|ref|YP_003553873.1|  ...Q.TRQHILHH---..----................................--........
gi|294102787|ref|YP_003554645.1|  ...-.-----------..----................................--........
gi|294102032|ref|YP_003553890.1|  ...-.-----------..----................................--........
gi|294102010|ref|YP_003553868.1|  ...-.-----------..----................................--........
gi|294101586|ref|YP_003553444.1|  ...-.-----------..----................................--........
gi|294101458|ref|YP_003553316.1|  ...-.-----------..----................................--........
gi|294102625|ref|YP_003554483.1|  ...-.--------K--..----................................--........
gi|294102478|ref|YP_003554336.1|  ...-.-----------..----................................--........
gi|294101874|ref|YP_003553732.1|  ...-.-----------..----................................--........
gi|294102071|ref|YP_003553929.1|  ...N.IFLWPSVGGKK..LWEAwnrtrsge........................HK........


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  leflglrkgfaifdrndsrslvkkimedlkldpkqidptnvldhiskaktegnhktlepvgleg
gi|294101779|ref|YP_003553637.1|  indrieklrlaatkal................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  stihsfsmrvlkecglateldpesgtiappqeslfwkeaeealdrwdgnwfakssshlwaqria
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ivkaaqiagihtfitslpegydtevgerg...................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  eiekwetdaiskrvtevldlvdlsdkaqsyp.................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  agialvekelrateediaraakneeeyhsllkrhdhlshryeqlggyefaamaqkvmkglgfsd
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  elehegflsfgdsgaasiylsewlkktqtgdlselklpsdfpifprvaaqvrgclghrcpyrdr
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  veyydhpslefrkhnskannryaikpyygknrgdtlpfcpviylglgrlfpfgefqndeairgv
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  iehevyrkyhdelrrqnavdfdd.........................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  klfsdplfmdsvntfgpnatvelaksslalfasqgqtpkdlwqwgsdlfsrdqdavdtarltlf
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  gdgqr...........................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  cfiqkalkkaqnwd..................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  kgelpstyqdeiktfyedftgisiessspqqmgdfktradfisdvegidsntisagednlfill
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  rrwedewhrflqpesgifynlnelggtgklcgnvrnlitrwqqqpskenlphfiqslieglkga
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  sgklaneiafhlkepvsqyrnrlikeepwitvftqgfdekeqayrscllgfsailwqlwdefrr
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                              80                          90                        
                                               |                           |                        
d1a1va1                             .......ITYSTYGKFLADG..................GCSGGA....................
gi|294102520|ref|YP_003554378.1|  .......-------------..................------....................
gi|294102529|ref|YP_003554387.1|  .......-------------..................------....................
gi|294102437|ref|YP_003554295.1|  .......-------------..................------....................
gi|294102168|ref|YP_003554026.1|  .......LLILPLHLLMVDEklr...............EQEQSR....................
gi|294101779|ref|YP_003553637.1|  .......V------------..................------....................
gi|294102457|ref|YP_003554315.1|  .......-------------..................------....................
gi|294101625|ref|YP_003553483.1|  .......-------------..................------....................
gi|294101185|ref|YP_003553043.1|  .......-------------..................-----G....................
gi|294102626|ref|YP_003554484.1|  rknrlsfDDMIRYAMEALEHs.................PSYAER....................
gi|294101765|ref|YP_003553623.1|  .......-------------..................SLLRQD....................
gi|294102479|ref|YP_003554337.1|  .......VTLSGGQRQRVAIa.................RAIIRN....................
gi|294101904|ref|YP_003553762.1|  .......-------------..................------....................
gi|294102557|ref|YP_003554415.1|  .......-------------..................------....................
gi|294101807|ref|YP_003553665.1|  .......-------------..................------....................
gi|294101806|ref|YP_003553664.1|  .......-------------..................------....................
gi|294102649|ref|YP_003554507.1|  .......SQLSG-------Gqkqrvgia..........RALANN....................
gi|294101185|ref|YP_003553043.1|  .......LIGAPPGYVGYEEggqlte............AVRRRP....................
gi|294102868|ref|YP_003554726.1|  .......-------------..................------....................
gi|294102500|ref|YP_003554358.1|  .......-------------..................------....................
gi|294102409|ref|YP_003554267.1|  .......VTYGTNSEFGFDYlrdnmavakd........QLVQRG....................
gi|294102354|ref|YP_003554212.1|  .......-------------..................------....................
gi|294101565|ref|YP_003553423.1|  .......------------Klte...............AIRRRP....................
gi|294101424|ref|YP_003553282.1|  .......-------------..................------....................
gi|294101976|ref|YP_003553834.1|  .......-------------..................------....................
gi|294101061|ref|YP_003552919.1|  .......-------------..................------....................
gi|294101048|ref|YP_003552906.1|  .......-------------..................------....................
gi|294101977|ref|YP_003553835.1|  .......-------------..................------....................
gi|294101084|ref|YP_003552942.1|  .......-------------..................------....................
gi|294101565|ref|YP_003553423.1|  .......--------MRKLLk.................ELRETG....................
gi|294101786|ref|YP_003553644.1|  .......-------------..................------....................
gi|294101493|ref|YP_003553351.1|  .......-------------..................------....................
gi|294101884|ref|YP_003553742.1|  .......-------------..................------....................
gi|294101894|ref|YP_003553752.1|  .......-------ILVRLLqaady.............DIQAAE....................
gi|294101778|ref|YP_003553636.1|  .......---------VRDLfe................QARKYQ....................
gi|294102313|ref|YP_003554171.1|  .......-------------..................------....................
gi|294102640|ref|YP_003554498.1|  .......-------------..................------....................
gi|294101376|ref|YP_003553234.1|  .......--------LRNVFd.................EAQAHA....................
gi|294102641|ref|YP_003554499.1|  .......-------------..................------....................
gi|294101359|ref|YP_003553217.1|  .......VVTGTPGRVLDHIrrg...............TLDTSG....................
gi|294102459|ref|YP_003554317.1|  .......-------------..................------....................
gi|294101785|ref|YP_003553643.1|  .......-------------..................------....................
gi|294101376|ref|YP_003553234.1|  .......---------IREVfk................KAKQAS....................
gi|294102074|ref|YP_003553932.1|  .......-------------..................------....................
gi|294102442|ref|YP_003554300.1|  .......-------------..................------....................
gi|294101577|ref|YP_003553435.1|  .......-------------..................------....................
gi|294101171|ref|YP_003553029.1|  .......-------------..................------....................
gi|294102413|ref|YP_003554271.1|  .......-------------..................------....................
gi|294102187|ref|YP_003554045.1|  .......VNIEGTGAITIRMlvr...............NSLRMR....................
gi|294102332|ref|YP_003554190.1|  .......-------------..................------....................
gi|294102831|ref|YP_003554689.1|  .......-------------..................------....................
gi|294101321|ref|YP_003553179.1|  .......-------------..................------....................
gi|294101626|ref|YP_003553484.1|  .......-------------..................------....................
gi|294101069|ref|YP_003552927.1|  .......-------------..................------....................
gi|294102759|ref|YP_003554617.1|  .......-------------..................------....................
gi|294101055|ref|YP_003552913.1|  .......-------------..................------....................
gi|294101254|ref|YP_003553112.1|  .......IWQLSIGEQQRVAil................QMLYRK....................
gi|294102760|ref|YP_003554618.1|  .......-------------..................------....................
gi|294101659|ref|YP_003553517.1|  .......PTYSLSGGEKQRLava...............GALALD....................
gi|294101172|ref|YP_003553030.1|  .......-------------..................------....................
gi|294102017|ref|YP_003553875.1|  .......---------TANI..................LHNVTD....................
gi|294101748|ref|YP_003553606.1|  .......ILEDTKKGLVDILigtqrllqk.........DIEFKD....................
gi|294102409|ref|YP_003554267.1|  .......-------------..................------....................
gi|294102070|ref|YP_003553928.1|  .......-------------..................------....................
gi|294102390|ref|YP_003554248.1|  .......VVVGTHALFSD--..................PVTFSN....................
gi|294101403|ref|YP_003553261.1|  .......--------ALYVLdt................LVRSGA....................
gi|294101730|ref|YP_003553588.1|  .......--------AH--Vsl................SAFSSL....................
gi|294102602|ref|YP_003554460.1|  .......-------------..................------....................
gi|294102663|ref|YP_003554521.1|  .......-------------..................------....................
gi|294101436|ref|YP_003553294.1|  .......-------------..................------....................
gi|294102150|ref|YP_003554008.1|  .......NLIDTPGHVDFTYevsr..............SIASCE....................
gi|294101607|ref|YP_003553465.1|  .......-------------..................------....................
gi|294102035|ref|YP_003553893.1|  .......IEEAQRGLELAKK..................WIEKGL....................
gi|294102412|ref|YP_003554270.1|  .......------------AwqkggtlsggeqqmlavgRALMSR....................
gi|294101660|ref|YP_003553518.1|  .......-------------..................------....................
gi|294102549|ref|YP_003554407.1|  .......VHSLPVGIQQRVEil................KLLYRK....................
gi|294102841|ref|YP_003554699.1|  .......-------------..................------....................
gi|294101272|ref|YP_003553130.1|  .......-------------..................------....................
gi|294101433|ref|YP_003553291.1|  .......IKVMSVNLLLDD-..................------....................
gi|294101963|ref|YP_003553821.1|  .......-------------..................------....................
gi|294101356|ref|YP_003553214.1|  .......VLSGGEKSRV--All................KLLLEE....................
gi|294102542|ref|YP_003554400.1|  .......-------------..................------....................
gi|294101861|ref|YP_003553719.1|  .......-------------..................LSNLEP....................
gi|294102400|ref|YP_003554258.1|  .......SMLSTLEFRARARrf................KSRFEN....................
gi|294102043|ref|YP_003553901.1|  .......--------LLLEKdl................RHELSE....................
gi|294101077|ref|YP_003552935.1|  .......-------------..................------....................
gi|294102348|ref|YP_003554206.1|  .......-------------..................------....................
gi|294102040|ref|YP_003553898.1|  .......-----AAVA---Ydalq..............AARASG....................
gi|294101613|ref|YP_003553471.1|  .......-------------..................------....................
gi|294101367|ref|YP_003553225.1|  .......-------------..................------....................
gi|294101893|ref|YP_003553751.1|  .......YVGAQPGRIIQKM..................RQAGTK....................
gi|294101841|ref|YP_003553699.1|  .......-------------..................------....................
gi|294102070|ref|YP_003553928.1|  .......YIVDTGG------..................------....................
gi|294102221|ref|YP_003554079.1|  .......IAYMSPGAEEAAIfdkfielm..........ESIGNP....................
gi|294101356|ref|YP_003553214.1|  .......Y------------..................------....................
gi|294101345|ref|YP_003553203.1|  .......-------------..................------....................
gi|294102145|ref|YP_003554003.1|  .......-------------..................------....................
gi|294101756|ref|YP_003553614.1|  .......-------------..................------....................
gi|294102549|ref|YP_003554407.1|  .......-------------..................------....................
gi|294101372|ref|YP_003553230.1|  .......-------------..................------....................
gi|294101016|ref|YP_003552874.1|  .......--------RTQEF..................KSKYRS....................
gi|294101780|ref|YP_003553638.1|  .......-------------..................------....................
gi|294101686|ref|YP_003553544.1|  .......-------------..................LSHVEG....................
gi|294102507|ref|YP_003554365.1|  .......VAICGGGASLR-Pg.................EISLAH....................
gi|294101471|ref|YP_003553329.1|  .......-------------..................------....................
gi|294101845|ref|YP_003553703.1|  .......-------------..................------....................
gi|294101553|ref|YP_003553411.1|  .......--KVAKE-----Ala................YAEDHL....................
gi|294101853|ref|YP_003553711.1|  .......-------------..................------....................
gi|294101780|ref|YP_003553638.1|  .......-------------..................------....................
gi|294102079|ref|YP_003553937.1|  .......-------------..................------....................
gi|294101472|ref|YP_003553330.1|  .......-------------..................------....................
gi|294102235|ref|YP_003554093.1|  .......-------------..................------....................
gi|294102390|ref|YP_003554248.1|  .......IM-----------..................------....................
gi|294101443|ref|YP_003553301.1|  .......----------KNL..................KILSGS....................
gi|294101748|ref|YP_003553606.1|  .......ILVCT-------Tives..............GLDIPR....................
gi|294101649|ref|YP_003553507.1|  .......-------------..................------....................
gi|294101715|ref|YP_003553573.1|  .......-------------..................------....................
gi|294101925|ref|YP_003553783.1|  .......-------------..................------....................
gi|294101367|ref|YP_003553225.1|  .......-------------..................------....................
gi|294101751|ref|YP_003553609.1|  .......YDLFSPERFLRYIdknvieiaplaym.....RGRTLN....................
gi|294101046|ref|YP_003552904.1|  .......IICCTQEIYTLKY..................--TKEP....................
gi|294101779|ref|YP_003553637.1|  .......-------------..................------....................
gi|294101226|ref|YP_003553084.1|  .......-------------..................------....................
gi|294101892|ref|YP_003553750.1|  .......-------------..................------....................
gi|294102315|ref|YP_003554173.1|  .......-------------..................------....................
gi|294102188|ref|YP_003554046.1|  .......----KSGMGDRLI..................ESLSDR....................
gi|294102320|ref|YP_003554178.1|  .......-------------..................-----K....................
gi|294102169|ref|YP_003554027.1|  .......-------------..................------....................
gi|294101254|ref|YP_003553112.1|  .......-------------..................------....................
gi|294102077|ref|YP_003553935.1|  .......-------------..................------....................
gi|294102510|ref|YP_003554368.1|  .......-------------..................------....................
gi|294101748|ref|YP_003553606.1|  .......-----------G-..................------....................
gi|294101141|ref|YP_003552999.1|  .......LFSATVDQFLGFMrhdyrssc..........LLPLLA....................
gi|294101018|ref|YP_003552876.1|  .......GKRITHGNVRSLIp.................ALAFLP....................
gi|294101692|ref|YP_003553550.1|  .......VIVSNYHMYFAYVmngk..............GTFPVD....................
gi|294101032|ref|YP_003552890.1|  .......-------------..................------....................
gi|294101031|ref|YP_003552889.1|  .......-------------..................------....................
gi|294101431|ref|YP_003553289.1|  .......-------------..................------....................
gi|294102167|ref|YP_003554025.1|  .......-------------..................------....................
gi|294101458|ref|YP_003553316.1|  .......IIFTTIQKFAPFTnetngevi..........D----Fnrwgrvaensspytantmlt
gi|294102320|ref|YP_003554178.1|  .......ADYESIGRLDNLI..................ERGTEK....................
gi|294101940|ref|YP_003553798.1|  .......-------------..................------....................
gi|294102120|ref|YP_003553978.1|  .......--------TAYKI..................QQAVKD....................
gi|294101791|ref|YP_003553649.1|  .......-------------..................------....................
gi|294102136|ref|YP_003553994.1|  .......T---AIISLKYYYeat...............ALSHEV....................
gi|294101830|ref|YP_003553688.1|  .......-------------..................------....................
gi|294102042|ref|YP_003553900.1|  .......-------------..................------....................
gi|294102015|ref|YP_003553873.1|  .......-------------..................------....................
gi|294102787|ref|YP_003554645.1|  .......-------------..................------....................
gi|294102032|ref|YP_003553890.1|  .......-------------..................------....................
gi|294102010|ref|YP_003553868.1|  .......-------------..................------....................
gi|294101586|ref|YP_003553444.1|  .......-------------..................------....................
gi|294101458|ref|YP_003553316.1|  .......-------------..................------....................
gi|294102625|ref|YP_003554483.1|  .......-------------..................------....................
gi|294102478|ref|YP_003554336.1|  .......-------------..................RRLGRD....................
gi|294101874|ref|YP_003553732.1|  .......-------------..................------....................
gi|294102071|ref|YP_003553929.1|  .......IIIGGPGAI----..................FAPLPD....................


                                          100                  110       120       130              
                                            |                    |         |         |              
d1a1va1                             ...YDIIICDECHST...........DATSILGIGTVLDQAETAGARLVVLATATP........
gi|294102520|ref|YP_003554378.1|  ...------------...........------------------------------sialreps
gi|294102529|ref|YP_003554387.1|  ...------------...........------------------------------glaklgkr
gi|294102437|ref|YP_003554295.1|  ...------------...........--------------------L---------knllltkv
gi|294102168|ref|YP_003554026.1|  ...LDWILVDEYQDV...........NKPQYFLLRRL-------------------igtkgnim
gi|294101779|ref|YP_003553637.1|  ...------------...........------------------------------errdvivv
gi|294102457|ref|YP_003554315.1|  ...------------...........------------------------------nvlychvt
gi|294101625|ref|YP_003553483.1|  ...------------...........------------------------------attciwrd
gi|294101185|ref|YP_003553043.1|  ...RIILFIDELHTI...........------------------------------vgagaaeg
gi|294102626|ref|YP_003554484.1|  ...FKEILVDEFQDT...........NPLQDRLIQAVRSHSQ--------------rlfivgdl
gi|294101765|ref|YP_003553623.1|  ...PDIILVGEIRDS...........ETAHLVMRA---------------------altghlvl
gi|294102479|ref|YP_003554337.1|  ...PRILILDEA---...........------------------------------tssldvav
gi|294101904|ref|YP_003553762.1|  ...------------...........------------------------------gqvliggr
gi|294102557|ref|YP_003554415.1|  ...------------...........------------------------------apnhrnat
gi|294101807|ref|YP_003553665.1|  ...------------...........------------------------------eylafeqd
gi|294101806|ref|YP_003553664.1|  ...------------...........------------------------------tdvllefp
gi|294102649|ref|YP_003554507.1|  ...PSLLLCDEATSAl..........DPKTTQSILALLDEINRKLGITIVLV----themgvir
gi|294101185|ref|YP_003553043.1|  ...YSVILFDEIEKA...........HHDVFNVLLQILDD----------------grvtdsqg
gi|294102868|ref|YP_003554726.1|  ...------------...........------------------------------idrkkamq
gi|294102500|ref|YP_003554358.1|  ...------------...........------------------------------kftevgyv
gi|294102409|ref|YP_003554267.1|  ...HHFCIVDEVDSI...........LID---------------------------eartplii
gi|294102354|ref|YP_003554212.1|  ...------------...........------------------------------gdinrmgn
gi|294101565|ref|YP_003553423.1|  ...YSVVLFDEIEKA...........HEDVFNILLQILED----------------grltdgqg
gi|294101424|ref|YP_003553282.1|  ...------------...........------------------------------cpiqakgm
gi|294101976|ref|YP_003553834.1|  ...------------...........------------------------------eevpgrrg
gi|294101061|ref|YP_003552919.1|  ...------------...........------------------------------qiwlhgee
gi|294101048|ref|YP_003552906.1|  ...------------...........------------------------------gqevsslp
gi|294101977|ref|YP_003553835.1|  ...------------...........------------------------------fpelsdpf
gi|294101084|ref|YP_003552942.1|  ...------------...........------------------------------vtvsrtgk
gi|294101565|ref|YP_003553423.1|  ...DVIIFIDEIHSI...........I-----------------------------gaggaega
gi|294101786|ref|YP_003553644.1|  ...------------...........------------------------------edvlkfnk
gi|294101493|ref|YP_003553351.1|  ...------------...........------------------------------gcldtpte
gi|294101884|ref|YP_003553742.1|  ...------------...........------------------------------ktvgiiav
gi|294101894|ref|YP_003553752.1|  ...RGIIYIDELDKI...........TRKS--------------------------esasitrd
gi|294101778|ref|YP_003553636.1|  ...PCIIFIDEMDAV...........GRHRGAGLG---------------------gghdereq
gi|294102313|ref|YP_003554171.1|  ...------------...........------------------------------vidrnven
gi|294102640|ref|YP_003554498.1|  ...------------...........------------------------------kgqdalkf
gi|294101376|ref|YP_003553234.1|  ...PAIIFIDEIDAI...........APKR--------------------------eemggekq
gi|294102641|ref|YP_003554499.1|  ...------------...........------------------------------qsppgeit
gi|294101359|ref|YP_003553217.1|  ...IKIVVLDEGDHMl..........DLGFKEELEAILDS--LPNCQRVWLFSATMpaeiknla
gi|294102459|ref|YP_003554317.1|  ...------------...........------------------------------diilmvll
gi|294101785|ref|YP_003553643.1|  ...------------...........------------------------------gtilyknk
gi|294101376|ref|YP_003553234.1|  ...PSILYFDEIESL...........------------------------------vpirgrds
gi|294102074|ref|YP_003553932.1|  ...------------...........------------------------------iscttrqp
gi|294102442|ref|YP_003554300.1|  ...------------...........------------------------------lphltawe
gi|294101577|ref|YP_003553435.1|  ...------------...........------------------------------vmidskdi
gi|294101171|ref|YP_003553029.1|  ...------------...........------------------------------fdgeditp
gi|294102413|ref|YP_003554271.1|  ...------------...........------------------------------gniffned
gi|294102187|ref|YP_003554045.1|  ...PDRIIVGECR--...........------------------------------geeafdml
gi|294102332|ref|YP_003554190.1|  ...------------...........------------------------------vieptagq
gi|294102831|ref|YP_003554689.1|  ...------------...........------------------------------avdmdpqg
gi|294101321|ref|YP_003553179.1|  ...------------...........------------------------------dmidkape
gi|294101626|ref|YP_003553484.1|  ...------------...........------------------------------dmidkape
gi|294101069|ref|YP_003552927.1|  ...------------...........------------------------------ginrpqkg
gi|294102759|ref|YP_003554617.1|  ...------------...........------------------------------avifdnln
gi|294101055|ref|YP_003552913.1|  ...------------...........------------------------------edergvtl
gi|294101254|ref|YP_003553112.1|  ...AQVLILDEPTAV...........------------------------------ltpqealr
gi|294102760|ref|YP_003554618.1|  ...------------...........------------------------------slpptltv
gi|294101659|ref|YP_003553517.1|  ...PPCLVLDEPTAM...........------------------------------ldpqgrrd
gi|294101172|ref|YP_003553030.1|  ...------------...........------------------------------islvpegr
gi|294102017|ref|YP_003553875.1|  ...RSIVVLDEIGRG...........TSTYDGMSIA--------------------wavleyld
gi|294101748|ref|YP_003553606.1|  ...LGLLIIDEEHRF...........GVMH------KEKLKDTREGLDVLTLSATPiprtlsls
gi|294102409|ref|YP_003554267.1|  ...------------...........------------------------------magrgtdi
gi|294102070|ref|YP_003553928.1|  ...------------...........------------------------------vsdipgtt
gi|294102390|ref|YP_003554248.1|  ...LGFAVIDEQHRF...........GVLQKNALR--AKGANEGQAPHILVMTATPiprtltls
gi|294101403|ref|YP_003553261.1|  ...VDLVVVDSVAAL...........TP----------------------------qaeidgki
gi|294101730|ref|YP_003553588.1|  ...YKVYIIDEVHML...........SLSAFNALLKTLE-----------------eppshvvf
gi|294102602|ref|YP_003554460.1|  ...------------...........------------------------------qifrkgah
gi|294102663|ref|YP_003554521.1|  ...------------...........------------------------------mndfipnv
gi|294101436|ref|YP_003553294.1|  ...------------...........------------------------------dpnramvs
gi|294102150|ref|YP_003554008.1|  ...GALLVVDA----...........------------------------------sqgveaqt
gi|294101607|ref|YP_003553465.1|  ...------------...........------------------------------dadiglrn
gi|294102035|ref|YP_003553893.1|  ...FDIVILDEINVA...........LDYELVELDQVIDILKKRPPFVEVVLTG--rnppvall
gi|294102412|ref|YP_003554270.1|  ...PDLVMMDE----...........------------------------------pslglapm
gi|294101660|ref|YP_003553518.1|  ...------------...........------------------------------gevivegf
gi|294102549|ref|YP_003554407.1|  ...AEILIFDEPT--...........------------------------------avlsprei
gi|294102841|ref|YP_003554699.1|  ...------------...........------------------------------vgyvpqeg
gi|294101272|ref|YP_003553130.1|  ...------------...........------------------------------iereygtm
gi|294101433|ref|YP_003553291.1|  ...------------...........------------------------------ptkpvvwr
gi|294101963|ref|YP_003553821.1|  ...------------...........------------------------------tnitarea
gi|294101356|ref|YP_003553214.1|  ...TNLLILDEP---...........------------------------------tnhldmrt
gi|294102542|ref|YP_003554400.1|  ...------------...........------------------------------svtlllqn
gi|294101861|ref|YP_003553719.1|  ...FDVLFIDEIHRL...........PANVEEIL----------------------ypsmedfs
gi|294102400|ref|YP_003554258.1|  ...LGLIVVDYLQLM...........------------------------------sfarrids
gi|294102043|ref|YP_003553901.1|  ...LFLFVIDRCEHV...........SQV---------------------------ispalscg
gi|294101077|ref|YP_003552935.1|  ...------------...........------------------------------gkviknqk
gi|294102348|ref|YP_003554206.1|  ...------------...........------------------------------pdyipvkg
gi|294102040|ref|YP_003553898.1|  ...ADVLIIDTAGRL...........HSKHN-------------------------lmeeltki
gi|294101613|ref|YP_003553471.1|  ...------------...........------------------------------lgegspnc
gi|294101367|ref|YP_003553225.1|  ...------------...........------------------------------gmpviqet
gi|294101893|ref|YP_003553751.1|  ...NPIMLMDEIDKI...........------------------------------gqdfrgdp
gi|294101841|ref|YP_003553699.1|  ...------------...........------------------------------nlgilavd
gi|294102070|ref|YP_003553928.1|  ...------------...........------------------------------llvrdehp
gi|294102221|ref|YP_003554079.1|  ...YDVIVFDTAP--...........------------------------------tghtlrli
gi|294101356|ref|YP_003553214.1|  ...------------...........------------------------------tstfsggw
gi|294101345|ref|YP_003553203.1|  ...------------...........------------------------------laelshkk
gi|294102145|ref|YP_003554003.1|  ...------------...........------------------------------gvscdrln
gi|294101756|ref|YP_003553614.1|  ...------------...........------------------------------hklgealv
gi|294102549|ref|YP_003554407.1|  ...------------...........------------------------------maaseniq
gi|294101372|ref|YP_003553230.1|  ...------------...........------------------------------tyrgipir
gi|294101016|ref|YP_003552874.1|  ...VDILLIDDIQFL...........GNKGSSQEEFFHTFNQL-------------hvskkqiv
gi|294101780|ref|YP_003553638.1|  ...------------...........------------------------------eslsayar
gi|294101686|ref|YP_003553544.1|  ...HGFVVLDSVQAM...........------------------------------rssledgw
gi|294102507|ref|YP_003554365.1|  ...RGILFLDEFTEF...........RRDLLEAL----------------------rqpledgs
gi|294101471|ref|YP_003553329.1|  ...------------...........------------------------------fqkihqdp
gi|294101845|ref|YP_003553703.1|  ...------------...........------------------------------vialffcp
gi|294101553|ref|YP_003553411.1|  ...NDVIIFDTAGRL...........HVDEDLM-----------------------eelsrlkd
gi|294101853|ref|YP_003553711.1|  ...------------...........------------------------------rvelsiye
gi|294101780|ref|YP_003553638.1|  ...------------...........------------------------------gmkrildk
gi|294102079|ref|YP_003553937.1|  ...------------...........------------------------------dtgaiyra
gi|294101472|ref|YP_003553330.1|  ...------------...........------------------------------nllsvkek
gi|294102235|ref|YP_003554093.1|  ...------------...........------------------------------tgsrqhvg
gi|294102390|ref|YP_003554248.1|  ...------------...........------------------------------rsfarghl
gi|294101443|ref|YP_003553301.1|  ...AAIAFVDEIYHF...........------------------------------nksqqnal
gi|294101748|ref|YP_003553606.1|  ...ANTLIVDDAQEL...........GLAQMYQL----------------------rgrvgrre
gi|294101649|ref|YP_003553507.1|  ...------------...........------------------------------vahistgd
gi|294101715|ref|YP_003553573.1|  ...------------...........------------------------------vgmgiila
gi|294101925|ref|YP_003553783.1|  ...------------...........------------------------------safpsakv
gi|294101367|ref|YP_003553225.1|  ...------------...........------------------------------dyqrvqel
gi|294101751|ref|YP_003553609.1|  ...DSFIILDEAQNT...........TPEQMKMFLT--------------------rlgfgska
gi|294101046|ref|YP_003552904.1|  ...HQKLIIDEFHYI...........FEDPDRARTYIDGIRGTAPTTSILVMSAT-fsqpgvig
gi|294101779|ref|YP_003553637.1|  ...------------...........------------------------------dtyiekda
gi|294101226|ref|YP_003553084.1|  ...------------...........------------------------------nlylafqa
gi|294101892|ref|YP_003553750.1|  ...------------...........------------------------------fflvdlpg
gi|294102315|ref|YP_003554173.1|  ...------------...........------------------------------kgditnll
gi|294102188|ref|YP_003554046.1|  ...FDYIVVD-----...........------------------------------lhrnfgdi
gi|294102320|ref|YP_003554178.1|  ...YTNIIIDEAHRF...........RTETTITYEKLAEIC---RGKRVILVTATPynnspkdi
gi|294102169|ref|YP_003554027.1|  ...------------...........------------------------------aiqinthg
gi|294101254|ref|YP_003553112.1|  ...------------...........------------------------------gpmidwka
gi|294102077|ref|YP_003553935.1|  ...------------...........------------------------------adqlfstl
gi|294102510|ref|YP_003554368.1|  ...------------...........------------------------------llvgkkra
gi|294101748|ref|YP_003553606.1|  ...------------...........------------------------------fivdiydp
gi|294101141|ref|YP_003552999.1|  ...DSAVVFDEIHSF...........DQTLFSALLGFLRE----FNVPALCMTASLpinrldql
gi|294101018|ref|YP_003552876.1|  ...GDLAIVDGAPSV...........RRQFLDRLCA--------------------llfplyvr
gi|294101692|ref|YP_003553550.1|  ...FDVLICDEAHRM...........VDAA--------------------------rsissvrv
gi|294101032|ref|YP_003552890.1|  ...------------...........------------------------------lvlqiknp
gi|294101031|ref|YP_003552889.1|  ...------------...........------------------------------fnalekan
gi|294101431|ref|YP_003553289.1|  ...------------...........------------------------------dnyfvdre
gi|294102167|ref|YP_003554025.1|  ...------------...........------------------------------kslgatii
gi|294101458|ref|YP_003553316.1|  drrNVVVIADEAHRSqygfgaeivmgKTEADVKYGYAKYMRDSLPNASYIGFTGTPveltdknt
gi|294102320|ref|YP_003554178.1|  ...YTNIIIDEAHRF...........RTETTITYEKLAEIC---RGKRVILVTATPynnspkdi
gi|294101940|ref|YP_003553798.1|  ...------------...........------------------------------dmskeett
gi|294102120|ref|YP_003553978.1|  ...ADCVAIDDLGAQ...........------------------------------rkdkswvd
gi|294101791|ref|YP_003553649.1|  ...------------...........------------------------------gargvrsp
gi|294102136|ref|YP_003553994.1|  ...TSILLVDEIDATl..........HPSILYKLLKLFEDYSNRYKIQIICTS---hslslief
gi|294101830|ref|YP_003553688.1|  ...------------...........------------------------------edqglfav
gi|294102042|ref|YP_003553900.1|  ...------------...........------------------------------ansmlkiv
gi|294102015|ref|YP_003553873.1|  ...------------...........------------------------------mldvvdpd
gi|294102787|ref|YP_003554645.1|  ...------------...........------------------------------fgcpdgrs
gi|294102032|ref|YP_003553890.1|  ...------------...........------------------------------mgsafeel
gi|294102010|ref|YP_003553868.1|  ...------------...........------------------------------tiadidii
gi|294101586|ref|YP_003553444.1|  ...------------...........------------------------------gkvlsqgi
gi|294101458|ref|YP_003553316.1|  ...--VVIADEAHRSqygfgaeivmgKTEADVKYGYAKYMRDSLPNASYIGFTGTPveltdknt
gi|294102625|ref|YP_003554483.1|  ...------------...........------------------------------tikkggtp
gi|294102478|ref|YP_003554336.1|  ...VDIVLVDAC---...........------------------------------cpfgngrl
gi|294101874|ref|YP_003553732.1|  ...------------...........------------------------------fefpehre
gi|294102071|ref|YP_003553929.1|  ...PQLILVDEESSP...........AYRM--------------------------qaapllhi


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  lgpsfgvkggaagggysqvvpmedinlhftgdlhaittahnllaalldnhlhqgnplnidprrv
gi|294102529|ref|YP_003554387.1|  vcialrepslgpsfgvkggaagggysqvvpmedinlhftgdlhaitsahnllsalidnhlhqgn
gi|294102437|ref|YP_003554295.1|  ynaepvafddiyaqarawgkalepyvadvslalreamlegkgilfegaqgtlldvdhgtypfvt
gi|294102168|ref|YP_003554026.1|  vvgdpdqsiygwrgadmtmilnfekdfpaakvvvldqnyrstgnilkaanaviisnerrrkknl
gi|294101779|ref|YP_003553637.1|  asvsciyglgkkemyeevifpfavgekwdrrgfmerlidnyyarndmlleagkfrargdvleiy
gi|294102457|ref|YP_003554315.1|  lvpyleaarelktkptqhsvqelrrigilpdiiicrshypicdemkekialfcnvpkeavieal
gi|294101625|ref|YP_003553483.1|  cfvniidtpghvdftveversmrvldgavavfcavggvepqsetvwrqadkyhvpriafvnkmd
gi|294101185|ref|YP_003553043.1|  aidagnmlkpmlargelhcigattideyrkriekdaalarrfqpvlveqpdvedtisilrglke
gi|294102626|ref|YP_003554484.1|  kqsiyrfrhadlslfgsyikkakyghgdyilldtsfrskeilvhevndlfssvwkdglgqelpl
gi|294101765|ref|YP_003553623.1|  stlhtddaanaplrliemgvppflivsslkavvsqrlirllcplckkpdsnspvgcsycggrgf
gi|294102479|ref|YP_003554337.1|  esqiqeamekamegrtsfviahrlstvrsadrilvlskghivesgthdellekggiyrhlyelq
gi|294101904|ref|YP_003553762.1|  dithlavnkrdigfvfqnyalfphmsifdnvayglkvrglsrkeaelkvkevlnlvgligvder
gi|294102557|ref|YP_003554415.1|  mvfqsyaifphlnvyeniafglrlkkmeeskirekmegvidlvgltglesrqpsqlsggqqqrv
gi|294101807|ref|YP_003553665.1|  mhvvviltdltnycealreisaarkevpgrrgypgylytdlatmyeragrlkgkkgsitqipil
gi|294101806|ref|YP_003553664.1|  eledprsgeplmkrtvliantsnmpvaareasiytaitmaeyyrdmgysvalmadstsrwaeal
gi|294102649|ref|YP_003554507.1|  qichrvavlehgqvvelgavkdvfmkpqsktaref.............................
gi|294101185|ref|YP_003553043.1|  hvvdfkntviimtsnigaplllegitgdgqikedareavmkelrqafrpeflnrvddvvlfkpl
gi|294102868|ref|YP_003554726.1|  mgdemlakvglpdsasksidqlsggeqqrvalarslvtepkvllldeplsnldaklrirmrrei
gi|294102500|ref|YP_003554358.1|  grdvdsmirdlvetavamvkrvkieevqgpaeeraewrlvdallprperktsmpdfmkifsgke
gi|294102409|ref|YP_003554267.1|  sgpsednvemyttadqiarqlkegrdfekdekernvaftedgiarcenllkmpglfsdaansdl
gi|294102354|ref|YP_003554212.1|  vvdgntvadfgaeeqkrqisintalvtlerngkrlylldtpgfadfigemrsamrvsdsalavv
gi|294101565|ref|YP_003553423.1|  htvdfrnaviimtsnigakdwvkgtslgfsisgeadgyfdwdktksdildavqktfrpefinrv
gi|294101424|ref|YP_003553282.1|  kkkeaedlairllervglgdkvyakpsqlsggqqqrvaiaralamqpkimlfdeptsaldpelv
gi|294101976|ref|YP_003553834.1|  ypgymysdlaeiyeragcvencqgsitqipiitmpdddmthpvvdlsgyitegqivldrgihdr
gi|294101061|ref|YP_003552919.1|  vthskksinvlrqkmgmvfqnfylfdhltalrnveiallkvkgmdkkharekamlelervgmaa
gi|294101048|ref|YP_003552906.1|  kkdltefrrkqiamvfqhygllphktiidnvefglklqgisekerrersnvalervglkgweny
gi|294101977|ref|YP_003553835.1|  hnaplmermvliantsnmpvaareasvylgmtlaeyfrdmgyntaimadstsrwaealreiggr
gi|294101084|ref|YP_003552942.1|  ekeldksfleachhmrqevgmvfqsfnlfphrtvlenvmlapmvvkkaseeeaheialrllekv
gi|294101565|ref|YP_003553423.1|  vdaanilkpslsrgefqvigattldeyrkyiekdaalerrfqpvmveepsvddtisileglrdr
gi|294101786|ref|YP_003553644.1|  akmkkmrsqmqiifqdpyaslnprmtvsqsiaapliiqgvykssekdkiqkkvdqtmdlvglak
gi|294101493|ref|YP_003553351.1|  ghyyldgtdvstidenqladirkntigfvfqgfnllprmtalenvelpmlysgisarkrheral
gi|294101884|ref|YP_003553742.1|  dpsspfsggailadrirmqrhandpdvyirsmgtrgslggvsrstreavkildacgkdvviiet
gi|294101894|ref|YP_003553752.1|  vsgegvqqallkilegtlsnvppkggrkhpyqdfiqmdtsnilficggafagieevigrrvnkk
gi|294101778|ref|YP_003553636.1|  tlnqllveldgfdestgiiliaatnrpdildpallrpgrfdrhivvdrpdvkgreeilavhvrn
gi|294102313|ref|YP_003554171.1|  lshkesaqlrnhhigfifqtynlfpvynvyeniefpllllkipqkerkekifdalewlgltdki
gi|294102640|ref|YP_003554498.1|  nnaqkrefhkqaqivfqdpfsslnprmsvsqliaepllinkacgsrkevdnkvkelmdtvglae
gi|294101376|ref|YP_003553234.1|  verrvvaqllalmdglesrgqvivigatnipntldpalrrpgrfdreisipipdrngrfeilqi
gi|294102641|ref|YP_003554499.1|  ngeiffdgqdvmkmteaekrdirgskiamifqdpmtslnpimtveeqimemislhsdfkgeavr
gi|294101359|ref|YP_003553217.1|  krylktpvfislteegeahedithevylvptrhkeeglinvllwekpsraivfchtraetvelt
gi|294102459|ref|YP_003554317.1|  iderpeevtdmarsvdgeiiastfdrpaeehlrvanlalekakrlvetgkdvvllldsitrlar
gi|294101785|ref|YP_003553643.1|  dilgmtsseirkvrgeqvsmifqdpmtslnpimivgdqiaeaikthmhvssakatkkasemmel
gi|294101376|ref|YP_003553234.1|  gagasftervisqflaemsgieelkgvtvlattnridlidpallssgrfdvvlelpmpdakarl
gi|294102074|ref|YP_003553932.1|  rdgerdgvdyrflseeefkklveekkflewavvhehlygtlksdvekvleagvdvvleidvqga
gi|294102442|ref|YP_003554300.1|  nvafvlesmgmprrmvqkrtnevvdqvglwrrrflyppqlsggeqqrvaiaramanspaifiad
gi|294101577|ref|YP_003553435.1|  tpfpmfrrarigvgylpqeasifrnltvkenieivlqelgkpqkeietmvshileelgltslas
gi|294101171|ref|YP_003553029.1|  lktyevirkgiartfqnlrlfprssvlenvmtaaqqheaysfveavthfgkwrmketsirdrsm
gi|294102413|ref|YP_003554271.1|  nitgfppnkvcesgiartfqnirlfsnetvlqnvmigchvrqkskwwmapfpvpsmiqeekeir
gi|294102187|ref|YP_003554045.1|  qamntghdgslttlhansprdvlsrlesmvlmagmelpvraireqissgidlivhqerlkdgtr
gi|294102332|ref|YP_003554190.1|  mmlgddviyhdgwkvkdlralrrdhigfvfqapylipfldvtdnvallpmlagkpnaearqqai
gi|294102831|ref|YP_003554689.1|  nctsglgiearaievslydvllggasaqdalmatswqgvsllpatidlagaevelasvisretc
gi|294101321|ref|YP_003553179.1|  erergitinishveyqtenrhyahidcpghadyiknmitgaaqmdgailvvsaadgpmpqtreh
gi|294101626|ref|YP_003553484.1|  erergitinishveyqtenrhyahidcpghadyiknmitgaaqmdgailvvsaadgpmpqtreh
gi|294101069|ref|YP_003552927.1|  titledknmrrmsgreiarrigyvpqssekvrltafdaillgrrpyvgwrlaesdikkvdaiih
gi|294102759|ref|YP_003554617.1|  lislrpemlnairwkdialipqgamnsftpvltigkhieevlaihlglsgearrhrcrslleea
gi|294101055|ref|YP_003552913.1|  sgqirldgedtftlspeevrrrigmvfqsptpfpfsiydnmayplryygygskkksknldviir
gi|294101254|ref|YP_003553112.1|  lfstiqqmtaeghgivfishkldevlslsdrisilrkgekt.......................
gi|294102760|ref|YP_003554618.1|  ldavaepwiivngrksrleayskarrllktlgieeerillsrvrsglsggqrqrvsiarslile
gi|294101659|ref|YP_003553517.1|  lldvlktlhaqgrtiiyithrleetvhcdralvlksgkvqwdgtiselfrhte...........
gi|294101172|ref|YP_003553030.1|  rvfapltvyenlmmgafprkepekvkqdlqwvfslfprleerrdqyagtlsggeqqmlaigral
gi|294102017|ref|YP_003553875.1|  hgcgskpkvlfathyhelvaledhlnglknlsmavhegergisflykvvdgpadrsygievarl
gi|294101748|ref|YP_003553606.1|  lrglrsfsiistpp..................................................
gi|294102409|ref|YP_003554267.1|  vlggnpdflaketlrkegnvedldpskyqqlleeyrqicakerdevldkgglkiigterhesrr
gi|294102070|ref|YP_003553928.1|  rdatdtviemkegkfrfidtaglrkksridsdieyysfvrtlqavdrsdvallvmdasepttdq
gi|294102390|ref|YP_003554248.1|  vygdlsvsvidempp.................................................
gi|294101403|ref|YP_003553261.1|  gdsqlglqarlmsyalrrltsaisrsncvvvfinqlrakistgyssgpqetttggralkfyssv
gi|294101730|ref|YP_003553588.1|  ilattephkvpvtirsrcqhipfrkidvqnivkslsmvahnenrnaeeealweiarqadgamrd
gi|294102602|ref|YP_003554460.1|  ieervmdsnelerergitirakhctvewngyliniidtpghadfsgevervlstvdsvlllvda
gi|294102663|ref|YP_003554521.1|  kvegdiylegkniysgatdvialrrqvgmvfqkpnpfpmaiydnvaygprlqgiksrekldeiv
gi|294101436|ref|YP_003553294.1|  vpdprfehlvtifepkkqtpatvefvdlaglsrdaskgaglgnaflsfvaesdalvhvvrtfdn
gi|294102150|ref|YP_003554008.1|  vanaymavdqgleiipvinkidlpsahpesvqkeieevvgidadgailasakegigiqdileri
gi|294101607|ref|YP_003553465.1|  ldvvmglenrvvynfidviegtcrlpqalirdkrvdnlfllpaaqtrtkdavspdqmvelceml
gi|294102035|ref|YP_003553893.1|  eyadlitemkeirhpfqkgitgrrgiey....................................
gi|294102412|ref|YP_003554270.1|  lvkevfdiireinaqgktvllveqnafaalkvahhayilevgsivlsgpgedllknprvkeayl
gi|294101660|ref|YP_003553518.1|  vsrpksqdlrkirrlvglvfqypeqqlfaetvfdevafaprnwgvseedlekvvnetllevgip
gi|294102549|ref|YP_003554407.1|  eglfsiirefrkagktiifiahnlnevlavsdvitvmrkgkhiatlprseat............
gi|294102841|ref|YP_003554699.1|  vrdkifpvsvfdvvlmgrlgigrrkifteedkkiamdvlehmglagrrndpmgdlsqgqrqrvl
gi|294101272|ref|YP_003553130.1|  ewigeavphlgqiaaymqqkdlllpwlslmqnamlpqvfskekhlrknkkakglferfglngfe
gi|294101433|ref|YP_003553291.1|  gpiiasvikqfwedvawdktdfiivdlppgtadapltvmqtidldgflvvtspqelsvmvveka
gi|294101963|ref|YP_003553821.1|  ggitqhigastvtyegknivfldtpgheaftamrargaqatdiailvvaaddglmpqtkeainh
gi|294101356|ref|YP_003553214.1|  rdifqqalteyhgtiiivshdryfldklvsrvieiregkileypgnysyfiq............
gi|294102542|ref|YP_003554400.1|  tyllkravwenvafglkvrgvrgkelmksmeealyfvglapsqfarrkwyelsggeaqrvalas
gi|294101861|ref|YP_003553719.1|  lhiivgkgplannicltlppftlvgattrlglltsplrarfgiveqlalynvdetseivqrgak
gi|294102400|ref|YP_003554258.1|  kqqevaeisralkgvareldvpvialsqlsraveqrnekmpqlsdlrdsgaieqdadlvmllyr
gi|294102043|ref|YP_003553901.1|  qivlcerytdstrayqiwgrglpeekvedlfawcsfpepdltlwidtplpvainrikttrghfd
gi|294101077|ref|YP_003552935.1|  dlrylrqtigflfqdpddqlfcptllddvlfgplngginkeeayeqainvlktlnidnlahtpp
gi|294102348|ref|YP_003554206.1|  sisflgeditswsitdrakagltlawqmparyegisirdylrigpqnssernleeamdfvqmsp
gi|294102040|ref|YP_003553898.1|  vrvierevgrdsmenllvldavmgqngfaqaesfhkalslngvilskydntakggvilaiahrl
gi|294101613|ref|YP_003553471.1|  lritrqsdllfqgsislptatetevslciredpkictikrefspetgtslfvdgmrirlqdldd
gi|294101367|ref|YP_003553225.1|  ggyegkffingqeaqfkspfdaldagigmvhqefslipgftaaenivlnrestqynflvesfgd
gi|294101893|ref|YP_003553751.1|  asallevldpaqnsnftdhyiesafdlsnvifittanvthtipaplldrmevirlpgyvaeeki
gi|294101841|ref|YP_003553699.1|  ddrivvadvpgliegahenkglgiyflrhiertrvlihvldlsvgtpedvlyqwevicsefkay
gi|294102070|ref|YP_003553928.1|  lvegirkqatlaieeshvilfvidgfngpnwmdedvahilrrsgkpvivvanklddgihedrvy
gi|294102221|ref|YP_003554079.1|  tlpeilgiwiehliekranamelmkvaakydkdlqekikedpiidtlqarrdkfalarkiltdk
gi|294101356|ref|YP_003553214.1|  kmrislaamllsspdillldeptnhldtesmewledwllnfngtliaishdrhfldkictstae
gi|294101345|ref|YP_003553203.1|  raqllsfvisgrpaiqgfsvfelvalgrhpytnwkgeledrdikavekalvevnawhlsgrdfa
gi|294102145|ref|YP_003554003.1|  eekkrgitielgfaplklhdgrvvsivdvpghekfirqmvagasgidavmlvvaadegvmpqtr
gi|294101756|ref|YP_003553614.1|  kaavrslenadlilyvvevddisispeddriieilqevstpiflvvnkidqvqqserrlmavas
gi|294102549|ref|YP_003554407.1|  agtlsggnmqrlvmareleqqpdfllvsqptrgvdiggisfihdrllslrragkailmisadld
gi|294101372|ref|YP_003553230.1|  lvdtagigapgdeieamgiaraekammeadvriwvidgsepltpadlalvqkisatnhivtink
gi|294101016|ref|YP_003552874.1|  icsdrppkeiqniedrlvsrfewglvtdiqmpdletriailqkkaqirnyevpedvisflaqnv
gi|294101780|ref|YP_003553638.1|  qflgiqkkpdvddisglspaisieqkgtshnprstvgtvteiydylrllygrlgvpycpscgka
gi|294101686|ref|YP_003553544.1|  pgtpsqvravaqqcidsakktgipfvvvghitkegriagpmllehmvdavllfsgedtsayrmi
gi|294102507|ref|YP_003554365.1|  ivvsraagrvefpcrvlllaacnpcpcgwagdpvescscsayekeryskrlsgpildridlhvs
gi|294101471|ref|YP_003553329.1|  gssfpqnrlirtifedffrwgyhpalssekewwnalgegmekaslserllhrypcqlsggelqr
gi|294101845|ref|YP_003553703.1|  rtlqlpeeisseegnlflkrvftrngrgktfiqgklfplslfnevaapllriqsqfaqlellds
gi|294101553|ref|YP_003553411.1|  lvnpheillvvdamtgqeavkvatsfheklsltgvvlskldgdarggaalairattqvpikfag
gi|294101853|ref|YP_003553711.1|  hlphmlakpvtspkkaiqalawavremeqrydifakarvrnlagynekaipkdrlphiviivde
gi|294101780|ref|YP_003553638.1|  dfreragkhlsidgaeqfrnvvlvdqspigrtprsnpatytglftlirelfaelpeskirgyap
gi|294102079|ref|YP_003553937.1|  lafylnamgfepvespylteilskikvslsdgcvyingadvtehirsprvdsivssyaalptvr
gi|294101472|ref|YP_003553330.1|  elkklwgrylflmpqepstalnpllsvfrqvrevfqhlrgmdrhtartatqnlfsalgitqeas
gi|294102235|ref|YP_003554093.1|  nwpgvtverkeghfsyegmnftlvdlpgiyslgaasideqvaseflikekpelaitvvdasnle
gi|294102390|ref|YP_003554248.1|  dlivsttvievgvdvpqatvmviedadrfglsqlhqlrgrvgrggnqsycvllsnpttregver
gi|294101443|ref|YP_003553301.1|  lpsvekgdiilvgtttenpwfeinktllsrlvvfqlkplaeedlvqilykalkdeekglgalkl
gi|294101748|ref|YP_003553606.1|  egayayflypetmplqketmerfeaisafsdigsgyslalqdlqirgsgdiigvsqhgqdervg
gi|294101649|ref|YP_003553507.1|  ilrqnvkektklgcqaqefmnggklvpdeiivgmmgerlkekdcekgflldgfprtvpqaeald
gi|294101715|ref|YP_003553573.1|  wcgfplpakegtvvgnldnvfadigdeqsieqnlstfsahlkniihilseatrsslvlldelga
gi|294101925|ref|YP_003553783.1|  frinapsnplyipfwlmnfdelafflvgakptddqrveyrllrelittfkkencklksgdvtqe
gi|294101367|ref|YP_003553225.1|  sggnqqkvclakafalhpkllfvseptrgidvgakrvvldtlreynqkrgttivmisseleelr
gi|294101751|ref|YP_003553609.1|  vvtgditqidlpsgkksgliqvreilegikg.................................
gi|294101046|ref|YP_003552904.1|  ryletitersftvyesqervtdlvyvpkkpaqlfsvhdalvfvfsqrgtmdlaytiartrrrlp
gi|294101779|ref|YP_003553637.1|  sindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavgekwdrrgfmerli
gi|294101226|ref|YP_003553084.1|  mergihtivalnmvdearhrgisidveklekllgvpvvptvalsgqginriiqripearkghip
gi|294101892|ref|YP_003553750.1|  ygyaargfkekekwaklieqyitqretlqllvhlvdfrhgllkndqelqewisqigipslvvft
gi|294102315|ref|YP_003554173.1|  lsfpeqrsedflpwinienataegfppseyaareaekwkkglagwgidgdrikkmresvsfsiy
gi|294102188|ref|YP_003554046.1|  tielaegcqriwlvtdcsctgvknlhlvtglldqlriswiergvivnkaeredrsivekiqrey
gi|294102320|ref|YP_003554178.1|  lsllklfqkgqkstipnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylm
gi|294102169|ref|YP_003554027.1|  gchleanlvskafkelpledldvifienvgnlvcpaefdigedmkvavssvpegadkplkyphl
gi|294101254|ref|YP_003553112.1|  vfshainlvkkysvstpsietpvknlsggnlqklmlgrelcdapkaliavhptwgldvaatqfv
gi|294102077|ref|YP_003553935.1|  dtyvrkvelsdghdvlvsdtvgfirdlppaliaafrttleeisvsslillvldgsmpdvmetld
gi|294102510|ref|YP_003554368.1|  pvggvpgitrgvswykgqdilavdspgildprshnevhrrl.......................
gi|294101748|ref|YP_003553606.1|  ayalpirieffdeivesirsfhpqsqmsaatldeieihsitaarekkleemipdschtvlfeps
gi|294101141|ref|YP_003552999.1|  reaglkifpesiasfpdlkekasamryrvkqckkeealeealkaykngekvlwvvntvkrcqei
gi|294101018|ref|YP_003552876.1|  kmsdcrralrhrvillrerkdpsltskvlaplvswiwstraaavdllkigiqefrillpsdivl
gi|294101692|ref|YP_003553550.1|  swedlvrllrskgaataesflsnreeeqgvlrdelssvqeegrklfellevsiadgvlipvrne
gi|294101032|ref|YP_003552890.1|  kkenvykvvpqieaarckgcgvcadncafgalnqfgthapvvnmqlchgcgvcelvcpqkaikd
gi|294101031|ref|YP_003552889.1|  ngitllpwkcegcggcalvcphqaismhsyeqgqywrgtttygplwharlhageensgmlvarl
gi|294101431|ref|YP_003553289.1|  ktpldeqgnydfevleaidldllesqlakllkgeevrvpefdfikgkkfpgatlrlnkhdvlii
gi|294102167|ref|YP_003554025.1|  dadalaheawkdttvlrraserwgtqvllgnghinpsvvasivfsdmteyewvcdmihpfvrie
gi|294101458|ref|YP_003553316.1|  rvvfgdyidiydmtravedgttvkifyesriakldlpeemkp......................
gi|294102320|ref|YP_003554178.1|  lsllklfqkgqkstipnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylm
gi|294101940|ref|YP_003553798.1|  qrlfmrelevstnalhglikvnsprirearegmkkhlnrlevvgeesgqrwtidrlekhvalri
gi|294102120|ref|YP_003553978.1|  erlfslidaryrsgkqtiittnacsmsqlkemlgehgtrivsrltema................
gi|294101791|ref|YP_003553649.1|  sftlineyegrlplahvdlyrlergdeyelglceyaddgfvlviewpdrlaeqpt.........
gi|294102136|ref|YP_003553994.1|  alarkynviylldn..................................................
gi|294101830|ref|YP_003553688.1|  dnippallpqllellsqhraavqeglaavvdvrggrllndlfsvvdslkgtiplvqvlfldssd
gi|294102042|ref|YP_003553900.1|  eeppehgvilfllendkflptlksrcwnlal.................................
gi|294102015|ref|YP_003553873.1|  evfsaadfvdksmaaierimnrgkiplfvggtpfyyhalfegvltkdlprdrkltdelekfask
gi|294102787|ref|YP_003554645.1|  srnlyapphggkqkgsliieslkgerfslvmngrnstfsgarngtsledllgyvdremyerifs
gi|294102032|ref|YP_003553890.1|  lselkiaiskafeksqyedakaqlvknfqeqvnglmeevrawagekgfalkrtpqgfvnipmie
gi|294102010|ref|YP_003553868.1|  npyfcirqvsdvlekkglsvitmpeqakwldmslvtpkvdwalhdestrllmdiggdaegalal
gi|294101586|ref|YP_003553444.1|  palywgvdgcryekpgeisiydiqnrigsnfdillleggksfpchkiw................
gi|294101458|ref|YP_003553316.1|  rvvfgdyidiydmtravedgttvkifyesriakldlpeemkpqidseyeeiteyqeysqkerlk
gi|294102625|ref|YP_003554483.1|  veilsalyslaaenpswgkelslwamdhpefdesirrlqaalretehkveslgelqdrigpagq
gi|294102478|ref|YP_003554336.1|  vpagilreppkaiqrahivvitkadqvs....................................
gi|294101874|ref|YP_003553732.1|  evvsflekqapctvmiiatstamalkivrilnlpqperfi........................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  vfrrvidlneralryvnvglggktngvpresgfditvasevmailclsesikelkerlaqivva
gi|294102529|ref|YP_003554387.1|  plnidprrvvfrrvvdlneralrhvivglggkadgvpresgfditvasevmailclsanikelk
gi|294102437|ref|YP_003554295.1|  ssspiaaggcvglgvgpsdvdrvigvvkayctrvgegpfptedlgdhgqtlrdrggeygattgr
gi|294102168|ref|YP_003554026.1|  wtardmgekiyvllapneyqeadfilsemhrlhnfcgyrygdmavlyrinamsriyeqkciekg
gi|294101779|ref|YP_003553637.1|  psysetalrvaffddeierideidpvsghtlkqlpkasifpaqhyvtsrdaidkamgqiqqeld
gi|294102457|ref|YP_003554315.1|  deptiyqvplslqaqefdrlvmrllsf.....................................
gi|294101625|ref|YP_003553483.1|  rvgadfyqvvngirtrlgarsvplqlpigsedrfsgivdliqmkavffqddlgtapvvgeipge
gi|294101185|ref|YP_003553043.1|  rlevhhgvrirdnalvgaavlsnryitdrflpdkaidlvdeacamirteidslpaeldaasrkv
gi|294102626|ref|YP_003554484.1|  pfeslevphylsthelrqqctvdpfltyleggkegekirearlrqirrlallfsqyyeekrtvw
gi|294101765|ref|YP_003553623.1|  hgrvgvfeylpitervqelllhkapvqkirtqarkegmrtlvengmlkverglttyeeil....
gi|294102479|ref|YP_003554337.1|  f...............................................................
gi|294101904|ref|YP_003553762.1|  fphqlsggeqqrvalarvlvidprvllmdeplsnldaklriymraeirkiqkklgitcihvthd
gi|294102557|ref|YP_003554415.1|  alaraiimepalllfdeplsnldaklreqmrieirhlqkrlgitsvyvthdqaeamsisdrvvv
gi|294101807|ref|YP_003553665.1|  tmpeddkthpipdltgyitegqiilsrglhrkgiyppvdvmpslsrlkdk..............
gi|294101806|ref|YP_003553664.1|  remsgrleempgeegypaylgtrlasfyeragraiclgsdgregsvtaigavsppggdlsepvs
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  qrheirqivkllaqelqkrlkdhridlelseeavdyiadagydpvfgarplkrfivkqletrma
gi|294102868|ref|YP_003554726.1|  rqlqkgigitaiyvthdqeealalsdrivvmekgeiiqidtprniyfhaqnsfvadfigrsnii
gi|294102500|ref|YP_003554358.1|  aeetppqeedtirestrnkvyallkagklderevelevaesasmgipilggagmdsmgmninem
gi|294102409|ref|YP_003554267.1|  ahrivqavkahvlfqkdvhyvvkdgeiiivdeftgrlmfgrrysdglhqaieakekvrvgresq
gi|294102354|ref|YP_003554212.1|  sglhgvevqtgkayeyaedfsipvafvvskldrensdyartlddikkqlsdkavpfflpigkea
gi|294101565|ref|YP_003553423.1|  demvvfrplskkemlvivdimlsdvrerlryqdidikvseeakafilekgynprygarplrrki
gi|294101424|ref|YP_003553282.1|  gevleviaqlaetgmtmviithemlfakdvsdriifmadgniveqgspqdimvkpahprtqaf.
gi|294101976|ref|YP_003553834.1|  gayppinvlpslsrlmnk..............................................
gi|294101061|ref|YP_003552919.1|  fadhyptqlsggqaqrvsiaralamdpdvmlfdeptsaldpeligevlevmrnlakggmtmlvv
gi|294101048|ref|YP_003552906.1|  ypsslsggmrqrvgiaralvmdtpillmdepfsgldplirremqdelirlqkelkktiffvthd
gi|294101977|ref|YP_003553835.1|  leempgeegypaylgtrlaqyyeragrakllglperegsvtvinavspaggdfsepvtqaslrl
gi|294101084|ref|YP_003552942.1|  glsehahkypatlsggqtqrgaiaralamnpkvmlydeptsaldpelvgevlqvmkdldnegmt
gi|294101565|ref|YP_003553423.1|  yeshhrvkisddalvaaarlssryiterflpdkaidlideaaararlktmeipanlkdiehdle
gi|294101786|ref|YP_003553644.1|  rfansypheldggrrqrigiaraltlnpkfivcdepvsaldvsiqaqilnliqdlqvqfgltyl
gi|294101493|ref|YP_003553351.1|  halqivdledranhqpqqlsggqqqrvaiaralandapliladeptgnldsktgidvmklfvrl
gi|294101884|ref|YP_003553742.1|  vgvgqseidivkladtvclvlvpgmgddiqimkagimeiadifvvnkadrpgaekietevklml
gi|294101894|ref|YP_003553752.1|  migfggdilsvkehrnyelmrqvqpedlmafgfipeligrlpvvvpleeldddalarilvepkn
gi|294101778|ref|YP_003553636.1|  kkiaddvdlgvvarrtpgfvgadlanlvneaallaaragkslitmaefeegidr..........
gi|294102313|ref|YP_003554171.1|  dsrpsqlsggecqrvavaravvkrpeliladeptanldsensynilemmvrlnkelettfifat
gi|294102640|ref|YP_003554498.1|  rlttsfpheldggrrqrigvaralaldpefivldepvsaldvciqaqilnllgdlkkergytyl
gi|294101376|ref|YP_003553234.1|  htrgmplaedvdlmrlsdithgfvgadlealakeaamsslrellpcidyeqavipyekllsmnv
gi|294102641|ref|YP_003554499.1|  krahemlalvgirpergkeyphqfsggmrqrvgiaialaceptlliadepttaldvtiqaqvld
gi|294101359|ref|YP_003553217.1|  rrlhdenfqamclhgemsqrernmalsqfrsgrtpllvatnvaargldvegvshviqmglpdnr
gi|294102459|ref|YP_003554317.1|  asnlvvppsgrtlsggmdpaalyfpkrffgaarnieeggsltvigtalvdtgsrmddviyeefk
gi|294101785|ref|YP_003553643.1|  vgidpvrmsdyphqfsggmkqrvviamalacnpkvliadepttaldvtiqaqvlemmnelkkkf
gi|294101376|ref|YP_003553234.1|  eifqihlqkkplaedvhleelvrsteghsggdihficrkasalairdflkigekgapciekhhf
gi|294102074|ref|YP_003553932.1|  lqvknafddsvlifimppskeelerrlrnrgteeedtvqlrlsnalkemekmhmydyvvvndsv
gi|294102442|ref|YP_003554300.1|  eptgnldihtaedvmrllvalnaagatvimathdqylvdayrqrvvelqegrivrdeekg....
gi|294101577|ref|YP_003553435.1|  ipgyalsggerrrveiarclsimpdfllldepfsgidpiavydiqqiilslrakgygilltdhn
gi|294101171|ref|YP_003553029.1|  ellnrvgladralqpagtlpygyqrrleiaralaldprlllldepaagmnpeevmalneliksi
gi|294102413|ref|YP_003554271.1|  eksmkllqsvslaqdanvlssslpygaqrrleiaralatdpsfllldepaagmnpletvdlmsf
gi|294102187|ref|YP_003554045.1|  r...............................................................
gi|294102332|ref|YP_003554190.1|  ellkaldvehrakampsqlsggeqqrvaiarglvnrppviladeptapldseralavirilndm
gi|294102831|ref|YP_003554689.1|  lrrhmanlnqfdvaiidcppslglltinalvaahklvvpiqceyyalegvgqlahtiglvrdcl
gi|294101321|ref|YP_003553179.1|  vllarqvnvpavvvfmnktdqvdddelldlvemeirellskydfpgddvpiirgsalkvleegt
gi|294101626|ref|YP_003553484.1|  vllarqvnvpavvvfmnktdqvdddelldlvemeirellskydfpgddvpiirgsalkvleegt
gi|294101069|ref|YP_003552927.1|  tlgldelalryldemsggelqkvtiaralvqeprillldepissldvknqieimetmkhiikgh
gi|294102759|ref|YP_003554617.1|  dlewslanryphelsggqkqraaiatalacdpdflladepttaldvitqkeiiltlerlargrn
gi|294101055|ref|YP_003552913.1|  nkledvglfeevkdslsmnatllsggqqqrlciaralavepeillldepcssldvkntqniemm
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  palllcdeptsmqdastrseiihvlnervkegmamvfvthdlylargaakrgivllegecceen
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  msrprlllldepslglapiiirdifkelrrinsegvtillveqnarqalllshrgyvlqtgsii
gi|294102017|ref|YP_003553875.1|  agippavlkrafhlletfe.............................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  idnqlrgrsgrqgdpgssrfylsleddllrlfgseriqgimeklgmeegeai............
gi|294102070|ref|YP_003553928.1|  dkkmaaqviekgkglillinkwdtleaadklgdemrkrvrdempflshapllfvsaltkrglnk
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  rvevkrgksinkgedaighelwmkvvknkqappfrtahasliygkgv.................
gi|294101730|ref|YP_003553588.1|  alslleqvma......................................................
gi|294102602|ref|YP_003554460.1|  negpmpqtryvlmralamglrpivfinkvdrphanpmsalnqtfdlfielgaaeeqldfpvlyg
gi|294102663|ref|YP_003554521.1|  krsligaalwsevkdnlkssglglsggqqqrlciaraiatepevllmdeptsaldpmatariee
gi|294101436|ref|YP_003553294.1|  pevphpednidpardwnivemeliyrdlgvidnrlsrlaakkrllpeeeeekkllercqaflme
gi|294102150|ref|YP_003554008.1|  vaqvpapegdteaplqalifdsvynnyrg...................................
gi|294101607|ref|YP_003553465.1|  kkegfdfilldspagieggfknaaagatealvvttpeipsvrdadriigllesmekkpirlvin
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ldfldrnpfqlsggekrrialasvlaaepaylvldeptagldatgrkdlikllskqkkkgrgii
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  iaralasrprillmdeplasidpeargvlyedlasfagnvtiilvshdlsviangatavacv..
gi|294101272|ref|YP_003553130.1|  dylpgavsggmkqrcalirtlmfereivlldeplsaldaitrrslqslllslqkdfkktvlmit
gi|294101433|ref|YP_003553291.1|  lnmtkmmevpllgavenmsyvtcpdcgkaievfgpshvkeieekfslpvlgkfpldlelshlgd
gi|294101963|ref|YP_003553821.1|  araagvpivvavnkidkpaarpdrvrqqlsdvglvpeewggdsimvdvsaktgegiphllemvl
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  rlaikpevllldeptasvdrvsaelikqgvrmcrekwgttlvlvshdvlwvkslsdrhlilteg
gi|294101861|ref|YP_003553719.1|  vlgieieeeaayeiarrsrgtprvairllkrvrdvaevrqspsintavasvalnm.........
gi|294102400|ref|YP_003554258.1|  pgyydtaaspeeednratiriakhrngptgdvnlvfl...........................
gi|294102043|ref|YP_003553901.1|  riesetdgflnrvcegykelskrfphrivridgsqpteevsaqiwkvvevhls...........
gi|294101077|ref|YP_003552935.1|  yalsggqkrlgalaavlamkpdlllldepssglderawqnlvdvlnqldmaliiashdipfleh
gi|294102348|ref|YP_003554206.1|  lfldraidkslsggerkrielasiylmkprlaildepdsgvdllalrevlgllrlladqgsgvm
gi|294102040|ref|YP_003553898.1|  alpiryiglgesvddlrlfepqefvralle..................................
gi|294101613|ref|YP_003553471.1|  vkrqwhmegeqfafigqgevaeaihhrpqqrrsilealfgidqyrkkredanqklkfaseelar
gi|294101367|ref|YP_003553225.1|  rlrtlnteemrqrgenaieklnvvispdtlvsempvghkqfteiareidkkktqllvldeptav
gi|294101893|ref|YP_003553751.1|  hiakkhllpklfkehgltdkmisitsktvektirdytreagvrnlqrslatlcrkv........
gi|294101841|ref|YP_003553699.1|  kesllerpymvvgnkidierghenapaiesfmkarnipyyntsaitgegiaefmgnivalcreh
gi|294102070|ref|YP_003553928.1|  dayslgfehvvgisalhkryiddlmdmavsllpsdeee..........................
gi|294102221|ref|YP_003554079.1|  kntafyfvlnaeklpiietkraieilqkhdigiggvivnkvipeeagpffekrrvdqeqylkqi
gi|294101356|ref|YP_003553214.1|  lsqgaislykg.....................................................
gi|294101345|ref|YP_003553203.1|  klsdgesqrvliaralaqdtpillldeptafldlprkvellsllrqyawkmnkgvlmsvhdidl
gi|294102145|ref|YP_003554003.1|  ehlailnllgvhdgviviskadlvdeellelaiadvtdfvqgtflegkvvvpvssvtnknipll
gi|294101756|ref|YP_003553614.1|  lfkeklpivgalgvsakkgynidklvqilkdklpagfpwydeeiltdrperflageiirekvll
gi|294102549|ref|YP_003554407.1|  eilslsdriavmnrgeivavlprkeasr....................................
gi|294101372|ref|YP_003553230.1|  adlplviseemingllpqspvfvisaekregiealkdai.........................
gi|294101016|ref|YP_003552874.1|  psnirelegalnri..................................................
gi|294101780|ref|YP_003553638.1|  virysldeivdvifrnypdqrleilspqvrgkkgefknlfaqnrekgfmrvrvdgtiywleeei
gi|294101686|ref|YP_003553544.1|  rgtknrygntdelgifemtekgl.........................................
gi|294102507|ref|YP_003554365.1|  vprllpkelisfedqsgedsetvrqrvcearekqrlrwrkygfhcnaelperiikrelnlgtdv
gi|294101471|ref|YP_003553329.1|  fallrallfsplflvadeptsrldpsvqakvahmlveeahvksiavlfishdevllnalcsrii
gi|294101845|ref|YP_003553703.1|  drqrdildsyggeeiiclknelrsvfsnallkekelrsvekkqkevidryenansilqsfksis
gi|294101553|ref|YP_003553411.1|  vgegidaielfdakrmaqriigmgdvmglaekvqqvtsqedvakitkslkkdkltmedlllqfe
gi|294101853|ref|YP_003553711.1|  ladlmftaqkdvedyicrlaqmaratgihlllatqrpsvnvvtglikaniparvaftlpsqads
gi|294101780|ref|YP_003553638.1|  grfsfnvrggrceacsgagsvkvsmlflpdvyvdcevcggtrynretlevrykgrniadvlnmt
gi|294102079|ref|YP_003553937.1|  rcllsiqreqaeegglvadgrdmgtvvfpdatikiyltasdsvrakrrhlqllergekvsfdev
gi|294101472|ref|YP_003553330.1|  rerpgklsggmaqrallamalaspaefilldeptkgldssrkedatalvkgiinagktllcith
gi|294102235|ref|YP_003554093.1|  rslylvvqmleagqpliialnmadvaenkgirihreklekalgvpvvptvarerkgledlvkrv
gi|294102390|ref|YP_003554248.1|  lkvmcattdgfkiaeadlrlrgpgevcgvrqhgitdfrvadllkd...................
gi|294101443|ref|YP_003553301.1|  avsedvitvlakmaggdarqaltrlellassvaasgaaeltmah....................
gi|294101748|ref|YP_003553606.1|  yrfyykmleeeiar..................................................
gi|294101649|ref|YP_003553507.1|  qllatmnlsldavilldvddevvvkrlcgrrmcrqcgeiyhvtfkpssqgmrcekcggelfqrd
gi|294101715|ref|YP_003553573.1|  gtdpqegaalgialidtlrekksitlatthhnpiksyalttphvetasmefnvetlaptyhllm
gi|294101925|ref|YP_003553783.1|  fitadspipfsarklwyemnwwlnasfestkkdeqkretkyeinkgdyenligaeftshlttan
gi|294101367|ref|YP_003553225.1|  sicdriaivnegkiagt...............................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  reqrsrlyelatildvpkvqmpllcgigiyhgsmlpkekllvesafrerildvvvgtnalalgv
gi|294101779|ref|YP_003553637.1|  dnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidpvsghtlkqlpkas
gi|294101226|ref|YP_003553084.1|  pl..............................................................
gi|294101892|ref|YP_003553750.1|  kadkiskgrhkgmlhsyirkglksievpfivsaqdksgvgefrqfltqyl..............
gi|294102315|ref|YP_003554173.1|  tpgsnsgikvnvlgsfrcpsekiindhdlflekvqnttstllsllniesdplsgrehlliskif
gi|294102188|ref|YP_003554046.1|  gvkgllpfdeklekgwlkgeplilsqprspyskvireiaselvgke..................
gi|294102320|ref|YP_003554178.1|  vrrtraeieeyfsrdikeqglkfpkvakpvplfyelnekedfifnrtiehianqfkyarympml
gi|294102169|ref|YP_003554027.1|  fseakavlltkmdlapyvpfdmdlykndlqhlnprvecieiealngkgidrwvslvetwlke..
gi|294101254|ref|YP_003553112.1|  reqlllerdrgaavflvsedleellslsdrlavifkgeimgildhpe.................
gi|294102077|ref|YP_003553935.1|  vveetlsdigagaiprlivlnkidkidlslipflqtrlqgrskakvlpicalsgvgvtellqev
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  qienkaesy.......................................................
gi|294101141|ref|YP_003552999.1|  amelqesfaenllcyhsrfrlkdrqkwhkkliekfrdpepmiaittqvcemsldlsasllisef
gi|294101018|ref|YP_003552876.1|  tferggaldlqdpmqdywesvrkwrekehitgvpqvgpqrddmiittkgqsvsivmsrgqrrrt
gi|294101692|ref|YP_003553550.1|  elyrcgllvsshietalkmlrsieelcnekpydvddgplalalawieevrlfshslqwclavgh
gi|294101032|ref|YP_003552890.1|  skasigimniknqesfwflegildigepnpvplihavlkkadslpfpqivdgppgnacpmvaav
gi|294101031|ref|YP_003552889.1|  kkesrkealkegvpfividgppgiscpaisaltgatlavavtepslsglhdllrlsklcasldv
gi|294101431|ref|YP_003553289.1|  egihglnekvtavvpeemkfgifvspltginldehnrtsttdnrllrrmirdyrtrghsaertl
gi|294102167|ref|YP_003554025.1|  merkvaslqgwviaeipllfenripwwvdlsvyvtapldlrlarnevrgwnkeeierrerflrn
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  vrrtraeie.......................................................
gi|294101940|ref|YP_003553798.1|  pslvvidyltllkrpgqsdleaveevmprlktltqrlkirtlilsqlgraskldqrkgatggha
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  eslvrrfettrrrhplgdhipvlegiqkerallapvreyadvvldtsglsirglkdrliae...
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  hgnqalhdqlsaidpkrasqlhvndvr.....................................
gi|294102787|ref|YP_003554645.1|  vgledmqkirplndrgiqsrffsagaglgtaslptflaslsnqekalyriqggarssaeinvfl
gi|294102032|ref|YP_003553890.1|  ettesgdvskrelqqeefeslseekqkelqgkseeisqrtldtlrkirdlekalkeeigkleae
gi|294102010|ref|YP_003553868.1|  kqfepiikkvgyrlilvvnafrpqtasvtriqkmmkkmesicglevgalisnshlmh.......
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  skwarleaivgteqrikqiakdivehfekrdlaqeneggkgmivamsrriaidlykeivalrpd
gi|294102625|ref|YP_003554483.1|  vrfsgseavsflhhwtsmatiwlppaikgalslfigtppvleknslwimpnitasiwpgkmses
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ytydgtavtagdlnaqgsmavvlkdalkpnlvqtlehvpafvhggpfaniahgcnsiqatkygl
gi|294102529|ref|YP_003554387.1|  erlskivvgytyngtvvtagdlnahgsmaallkdalkpnlvqtlehvpafvhggpfaniahgcn
gi|294102437|ref|YP_003554295.1|  prrcgwldmvalkyavrvngmssialtkldvltgfekikicthyevngekhenyltntsllaka
gi|294102168|ref|YP_003554026.1|  vpyrvvrgtafydrkeikdvlsfmrlavnpldgaslgrianvptrgigkksqeklmeglgaipe
gi|294101779|ref|YP_003553637.1|  eqlhllkkqgklleaqrlemrtrydmemlaevgycsgienysryldgrnpgeppgtlldffpdd
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  lmadvkkardllienladfdesvmesylegqdvpeetlrrairentiqqrivpvlcgsafknkg
gi|294101185|ref|YP_003553043.1|  mqleieeaalkkekdaaslerlsvlqkelqeareeadalraqyesekeviskvrkmreeidavk
gi|294102626|ref|YP_003554484.1|  dkqkeclrpvqwkdmailvpsrtswfpllekiffeefqlpiyfegstsyfsrseiqdliallnf
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  qkealtiadrivvlnkgkieqvaapfelyanpatlfvadfigqanifkg...............
gi|294102557|ref|YP_003554415.1|  mnkgrieqvgtpielyarpsnsfvaafigkvnfmpak...........................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  qntlrvtkvfwgldaslayqrhfpainwllsyslytdt..........................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  rslvagevregskvyvtvkdkalaf.......................................
gi|294102868|ref|YP_003554726.1|  t...............................................................
gi|294102500|ref|YP_003554358.1|  lsgllpkktkkrrmkvsdgkkllqaeeaeklidmesvarealdkaqeegiifideidkvvargt
gi|294102409|ref|YP_003554267.1|  tlatitlqnyfrmyrklagmtgtavteseefkeiygldvivvptn...................
gi|294102354|ref|YP_003554212.1|  sfkgvvdilnqkayeyvtdgsgsfkeisipaemvdevsaaresliesvveaddevmmmylegde
gi|294101565|ref|YP_003553423.1|  qqliedrmadmllegkikkgslvsidedk...................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  themgfacsvaneimfmeegrilesgspdkllntpqyertrqf.....................
gi|294101048|ref|YP_003552906.1|  ldeamrmgdrmavmkngtivqmgapaqilanpadeyvarfvqdk....................
gi|294101977|ref|YP_003553835.1|  sgafwaldkrlaqqrhfpainwqqsytlyegs................................
gi|294101084|ref|YP_003552942.1|  qiivthqmrfarnasdyivfmdggeivemadgdvlfetpqnkrtkaf.................
gi|294101565|ref|YP_003553423.1|  evrkekeaavtsqefekaarlrdterkiseeleekkkdwqsrryqekplvsfddiativsewtn
gi|294101786|ref|YP_003553644.1|  fithdlsvvkhlstnimvmylgqvveladskklfknpvhpytktl...................
gi|294101493|ref|YP_003553351.1|  nvesgktiiqvtherdmalfgsriitvkdgtivhderv..........................
gi|294101884|ref|YP_003553742.1|  dligktdwfppihmtvaekgdgvaelvegiekhgaflkqsihgikkqkrklaeeikdilsrdia
gi|294101894|ref|YP_003553752.1|  alirqyqktfeiegvklffeqdaikaiakearkkntgarglrsimeylmldlmyeipsrsneve
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  hdekvmkylrrkihlfdgrvaqde........................................
gi|294102640|ref|YP_003554498.1|  fishnlsvvryvsdevavmylgqvvekagntilfkdplhpytqal...................
gi|294101376|ref|YP_003553234.1|  tmenfldalkevepsa................................................
gi|294102641|ref|YP_003554499.1|  liknlqkivntslllithdlgivaeicdevaimyagrlveysdirqlyskpmhpytqg......
gi|294101359|ref|YP_003553217.1|  etfvhrsgrtgraghegrnllvlspkea....................................
gi|294102459|ref|YP_003554317.1|  gtgnmelhlsrklaeqrifpavditksgtrreell.............................
gi|294101785|ref|YP_003553643.1|  nmatilithdlgivaqtcekaaviyageiveygtvheifknmrhpyti................
gi|294101376|ref|YP_003553234.1|  eials...........................................................
gi|294102074|ref|YP_003553932.1|  lraaleikriiasynl................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  vrdtlaitdrtylihqgeiviegspdevaqsevarkfy..........................
gi|294101171|ref|YP_003553029.1|  hmefqlailviehhmdlvmeicpriicmnfgakiaegspeeiqansevlkaylge.........
gi|294102413|ref|YP_003554271.1|  irrirdefnltilliehdmkvvmgiceyiwvldygkliaegnpdeiqsnprvieaylge.....
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  aqrfetavivvthdekiiptfkriyhirdgvtyeeegq..........................
gi|294102831|ref|YP_003554689.1|  npdlavdgvlltmydsrtrlandvveevrrqfgeivfstivprnvklseapshampiayyeptc
gi|294101321|ref|YP_003553179.1|  geendpvskciwelmaacdsyipapqretdkpflmpiedvftitgrgt................
gi|294101626|ref|YP_003553484.1|  geendpvskciwelmaacdsyipapqretdkpflmpiedvftitgrgt................
gi|294101069|ref|YP_003552927.1|  glsavmslhdltmalrygdrfvfmkkgeiryilardeis.........................
gi|294102759|ref|YP_003554617.1|  mglllvthdlplavqicdaiavmhegeiveegapadivtkprhrhttq................
gi|294101055|ref|YP_003552913.1|  lralcqqysiiivthnlfqarrishrtffildgeiieagptkdlfenp................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  steallsapkhaytralv..............................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  magtsedllnsadirnaylg............................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ltqtiknvqenrsrrigttelnrlirdvlafqtlptsrkgrvlkiyyctqtsiepptfvffvnd
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  sgldgwavrdlnkyahegmkhlfetiaeyvpapkvnlhap........................
gi|294102663|ref|YP_003554521.1|  lvrtlkerytviivthnmqqaarisdytafflmgelieygktpklftspg..............
gi|294101436|ref|YP_003553294.1|  ekplrelglsedeqrklsgfafltlkpemivlnldetqteghvpgldaimsiakerglglvqvf
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  rvkpsmvkegemldvqdvldvlaieligivpdddsvvksanrgepltsgdtslasmafsniadr
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  fvthdletalmssdsilvleggrevvqgapgkiieels..........................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  hdidealyladtvlvltqapmkirdritlpsekprnldsseyiaik..................
gi|294101433|ref|YP_003553291.1|  qgr.............................................................
gi|294101963|ref|YP_003553821.1|  lvaemeelradp....................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  elstss..........................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  vtrrgyelssg.....................................................
gi|294102348|ref|YP_003554206.1|  vithredvaagcdrsylmcdgriilegsaaavkry.............................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  letlvseltsrrdeiaamvtiaekarrlldeldekrrgyyfsrraflerelysfqsrihalerr
gi|294101367|ref|YP_003553225.1|  lteseaeillasmrklaalgiaivfishrlhevidvcdkivvlrdgqvvhettpak........
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  trphsei.........................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  demfggfgvariplldsdikgieql.......................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  alrfadriwvmspshsftvgipedl.......................................
gi|294102145|ref|YP_003554003.1|  meelaklidrvqprtrrgpffmpidrafpisgfgt.............................
gi|294101756|ref|YP_003553614.1|  lth.............................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  aldknkrhtievvidrlkvlddrkgriseaveaalslsggyvllvteggkeqlltenyacpdcg
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  rpflirmadnlrlsgrgisrvlkvartiadldnssrvrvphisealay................
gi|294101471|ref|YP_003553329.1|  rl..............................................................
gi|294101845|ref|YP_003553703.1|  pesnseaiwegrlerisksidehtkleqilarltggktgegiadsienlcleltqiispdtekg
gi|294101553|ref|YP_003553411.1|  qieklgpldkvidml.................................................
gi|294101853|ref|YP_003553711.1|  rtiidvsgaekllgkgdmlfvsprfpkpvrlqspyiedgksle.....................
gi|294101780|ref|YP_003553638.1|  vddafeffkeipriasklaliqeaglgyirlgqsaltlsggeaqrvklakelskrftgptlyll
gi|294102079|ref|YP_003553937.1|  lrqiqnrdqfdsnreiaplcqasdaifvdtssmtedevvdylvrlvke................
gi|294101472|ref|YP_003553330.1|  dfslpkqiggqtgvlfsgllvesgdsqivlqhpshpytqgl.......................
gi|294102235|ref|YP_003554093.1|  kdrfengvsl......................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ddketvirsrlkvyhdqtaplisyydekgllrkvnagtssssvmaeiealv.............
gi|294101715|ref|YP_003553573.1|  gipgrsnaiyiaerygmpsevlqkaratlkeq................................
gi|294101925|ref|YP_003553783.1|  nqpphvsqhkdfysyekkllarlkdsrfnfmfhpgdykdassskdlhnllnewigsenklaild
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  nlpaesvifaqlvqfhdnapiskneflqmagragrkglfdtgyvtwl.................
gi|294101779|ref|YP_003553637.1|  ifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtrydmemlaevgycsgi
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  eqswrngkdvdlpmiingiqtppfaqigvmptdtfyppserfklalalnqilaspafnqwmtgv
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  yyknelnqlerqsqrnmgrfmkillvkrlessffafrntgqrflnsynmflkelddgfiyvskk
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ey..............................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  apvtsliqrmgrcnryleiceggrilly....................................
gi|294101018|ref|YP_003552876.1|  avalmlaagwaverklrrkpllildeiaaelddrgrnilidalvesswqvfaata.........
gi|294101692|ref|YP_003553550.1|  fpewaywregdalvseptlcsdkvsegilsqkaekiiaisatmtvegsfdfwkretgiiptdty
gi|294101032|ref|YP_003552890.1|  eqsnfvilvteptpfglsdlalatetvrelhipagvvinrsdlgnieeaeifcknlalpilarl
gi|294101031|ref|YP_003552889.1|  plaivlnksdlseakgeeikneakkenwhflgsipfrpnvveaiskkeiplea...........
gi|294101431|ref|YP_003553289.1|  dlwpsvikgareyifpyqssavamfnsslpyelavlrgyaqpllqtvpesssmhgearrllsml
gi|294102167|ref|YP_003554025.1|  aeekraeadlvirndssidtleqslsr.....................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  kgggiveelvhseieiqkdgldkngqprliatitkarhgtkgsfeleyig..............
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  kkiqetkeqikllqqqkdeylqkkeelektghqiesarknleairydlslmewvekarspwvem
gi|294102032|ref|YP_003553890.1|  icrsaitpylqdvkekygtteilckwidalaediisnfnifvaaakdesteidfsrytinvfva
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  whsddlmsgkikvvitgsssdpsdwqafigskadretlakrmkdrndelklvivrdmwltgfdv
gi|294102625|ref|YP_003554483.1|  sllpdrhklalhdltgterghlpllkekrdqrealfrrlvacgedllilsspstdalgkplpps
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  klsdyfiteagfgadlgaekffdikcregnlhpsavvivatvralkmhggvakseltgenleal
gi|294102529|ref|YP_003554387.1|  slqatkyglkladyfiteagfgadlgaekffdikcrignltpsavvivatvralkmhggvakne
gi|294102437|ref|YP_003554295.1|  spvyttldgwkedisgcrdfeklpeaarryveyieketgvpvqligvgpgrsqtilr.......
gi|294102168|ref|YP_003554026.1|  meaeqlwravadgkdlgltgkakigamelgrhmfniikrsgsfhdvllyildsieyedqlkkdd
gi|294101779|ref|YP_003553637.1|  fimvideshitlpqvrgmyngdrarkttlvengfrlpscldnrplnwrefkkylrqvifisatp
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  iqllldavvdylps..................................................
gi|294101185|ref|YP_003553043.1|  reiekaereydlnkaaelkhgrlpelqqqlkkeegahaagqegdqllreevtedeiaeivsrwt
gi|294102626|ref|YP_003554484.1|  lddpgkelylmsflssplsslsleevrdlaldapkgyrlqafqekwphlarqiddwrlmahflg
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ssgpdvsregvqrdllpivegstvqtkygtvktdhilfiaagafssvkpsdlvpelqgrfpirv
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  isheeivkvarkairerqifpvlpasgtanigvhqvldflgdmfps..................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ipvtqlteeetqrllrm...............................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  knv.............................................................
gi|294101894|ref|YP_003553752.1|  kiiitkevvek.....................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  tgakaymnfsmevaerwl..............................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  peivsqsfnkhienkiremdtfdgtplrlywr................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  grmememadlsedeqrefmadlgikeagrerliqeaysllglisffttgkdevkawtlkkdata
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  llgkev..........................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  knraaewetiwkeglsfyqslfnsyeqqkkvheerteslgfqretlrrqcfataltvksarerl
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  islpeieprlfsfnnpygacpdcsglgshehfseehaidpvrsveegallpwkkkhymlrklyt
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  skyqelgnnalvflqklsqsltvllseqslsdlyaeqeeienklgtlrklkrlagvrtleeltn
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  depttglfytdvkkllhilhrivdqgntvvtiehnldvllssdyiidlgpeggmeggs......
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  lsgvpfevldiaiglitrfvydsmywgkyesytgknrplllayeeahtylnkndnnsysknave
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  enysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdrarkttlvengfrlps
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  pleigsflhspegkprasiftvshlsdnermffismvlneivgwmrtqtgtpslrailyidevf
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ysnkifellesdddealqklidegkaeryssedfkdelrtdlehdrailmeikrlweqidrdpk
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  vlespfdlekqmkilvvdlglkviekgydervcrvverlcndnggsslvllssmrlvkkvgnwl
gi|294101032|ref|YP_003552890.1|  pfskevarayakgiapilidkqwqeaasdilnhvkevl..........................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  kfvpplpsenvpsnsilrefigggc.......................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  teaqrkleeigevlffpdegllrfkkiheeegarereleelvfqcrnldkqlqafhipsiqkvl
gi|294102032|ref|YP_003553890.1|  ndpengvpviwetnptyynltgkveyesrqgylytdfhkivsgafqkanggylvldaekvllnf
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  psmhsmyvdkpmsghnlmqaiarvnrvfkekqgglvvdyi........................
gi|294102625|ref|YP_003554483.1|  pflg............................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  skgipnlekhienmqgfgvpvvvainrfptdteaelklvhercaafgvpvalseiwakggeggi
gi|294102529|ref|YP_003554387.1|  ltgenlealskgipnlekhienmkrfgipvvvainrfptdteaelelvkehcvalgvqqvlsev
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  pegweervenirelgslvtsggdlaevlaevalftdlettdmddleavnfltlhaakglefpvv
gi|294101779|ref|YP_003553637.1|  gdwerevstcvaeqiirp..............................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  g...............................................................
gi|294102626|ref|YP_003554484.1|  psavlasfleksdsflrafpawkrrgvaanmrkaidmarefeeaigtslpgcasylreamerqe
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  elqplgreelarilvepenslikqyqallsterievrfsedaieeiaamaekmnaemenigarr
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  iaqkeekrhveevlskvdeeatlargtsysltqnlhkkkeevsalwqklsnlrsslraerqrrq
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  fsqskewdltqpygtlpknvqnfilygsderlpmffsdrgerhqymgryegllpwlegrwnete
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  yckeaemnltwlnesyrrseqsgaeakklrreasrlalelrkkrertarsleeavnhslrdmam
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  rifkegrkfgvgalvisqrpseisetilaqvgtlialrltnsgdqsivkssspdnlnslidllp
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  cldnrplnwrefkkylrqvifisatpgdwerevstcvaeqiirptgvvdpevvvspatgqvddl
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  gymppvkeppskkplitllkqarafgigvvlatqnpvdldykglsnigtwfigrlqtqrdkdrv
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  llkfkkelstnatlqknhliiftesketanylfeeinkeypkkvllftgdskeavrdkvianfd
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  kgsqhpytvyvqnelprtellerfrsdlssvligsvsfregvdvpgegltqviidripfphpkd
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  eqkgairalaqnrnriekeeeiiqnlsldilsmkqrldrevreihqswtiddlesldlsfgvsq
gi|294102032|ref|YP_003553890.1|  mswealkralrtgeatienlgeqygaipisslrpqpipinvkvvmvgtpylyallqyydpeflk
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  elaerileavekpnsfhplydvaqspkekiekiakeiygakgvtytaqaekdleeihrlgkdnl
gi|294102529|ref|YP_003554387.1|  wakggeggielaervleavekpntfhklydaslspkekiekiakeiygaksvaymaqaekdlee
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  flvgleeaifphfkclevqesleeerrlcyvgmtraeeklymsgarsrrlfgtvfrnglsrflw
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  kfaepdvsnekenvirvmtvhgskglefpvlavlglertssagekgslmpspkmgvalsripge
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  lhtmveqlleeisftaperqgevvdinaqfvkerlsplmedt......................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  eygneyarvegecvkilsrlqarsealdknekeleeaknkvfvaeketetykkefeythlsykk
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  senvleelagyrvedicqtchgyrlrpealmvqlnhhtidelvempvdrllpvlkemefteneq
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  editfsitlsdlgkikstgadeisflmasgmmppgpvmkiasggelsrlllalqlalpdsqlpg
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  slrigeavivgesikipsrirvklnnprp...................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  vdrlrgitargeralvttltkkssedlaeyladlqfkvkyihselnaferaelirdlrsgevsi
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  leglerlenasgydrqfldkaitglkkrefllnnvhenspsif.....................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ararskkgdyrilistevlsegvnlhrsnvvvnydipwnptrmmqrvgrinrvdtpfdvihtfn
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  pvvqsrnelegrkafvtvilpqakmflrqalgrlirsksdqgrvvil.................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  kagdlekqkedfrnqhvirnetceqarkardearsllktrkehvekmernvsplsvqtlrekcg
gi|294102032|ref|YP_003553890.1|  mfkikaefdrdmprtfeseqqmaqficgfvrnegkipftvkavaeviewagrlaehqnrvttef
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  vicmaktqasisdnpaligrpegfeltvrevrlsagagfiiaitgsimtmpglpkvpaamkidv
gi|294102529|ref|YP_003554387.1|  ihrlgkdnllvcmgktqasisdnpaligrpegfeltvrevrlsagagfivpitgsimtmpglpk
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  eipd............................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  rnsgqaplawslsrlfeeqeeyeewqrlfyvactrardslilcghlpwrrdg............
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  iierhgeiyvqcqrlatslsqlkknvdvlenqletvlenteqrlypepvrvilaaqklgklpiq
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  kimgqvmielekrlsflvdvgvgylslmrradtlsggesqrirlatqigsklsgvlyvldepti
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  tlvfdeveaglggkaavlagyklkqlaekcrvilitheatiaalaeqhfvvarqenksfikeie
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  lvginllregmdlpevslvaildadregflrshrsliqimgraarntrgqvvlyadvetesirt
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ffpttqsndqiklkeaaegkinafltllggdaellt............................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  slrqfftrwhqiqnqikenemnldlfrqkkelqwggaaagtlglaflgagyrtgdifflktgit
gi|294102032|ref|YP_003553890.1|  nkiieviveatawalsenatlvedrhvykaieekrfrsnliqeriqraye..............
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  dndgnitg........................................................
gi|294102529|ref|YP_003554387.1|  vpaamkidvdddgnitg...............................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  iklaaeafkceeklaapleaylggrqfwlfvksleeaqlgielvkqkragritflpleqchprn
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  glhsrdtdrllrtlrsirdlgntvvvvehdretmlaadaivemgpgageqgg............
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  k...............................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  svqetrrrreiqmlfnekhgiipqtis.....................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  aiaaslgfiivdffqkrkffnekeellcrlrknlveteeelshtveglaiecpkdylelekaem
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  pdygfplpcqgtvgwatdliaseqlwspavnhllgdlliveeydvgmnlaragasfpivtlqgd
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  yiddcidgireydqalqsqrdaeeelgrrqrkledcesslnsikklldqtdaewksfveekgfs
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  vftvggsvsggkfrktggaierrlqiedleknlkdkrgslervvsllqeaeelecviakerafw
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  aslkvehwtefeslvkqlrgrlaqirdmekqlsssqeyisakeeeihslfrslslgpwsklslv
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  kekeqeaekkllshsirferqreeivrlekersfflndvedsgkllkrtqhslkeleeaiasfg
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  spidiltsrleeaeeqwnqitmiqrekkrneeiyerahkawnesrtlkkelfeqakvhdepsfl
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  dfpdetelerelasakgeeavlcekvksgevlinrieseaaqlterlrslsgelentelsldeg
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  elgerwqrcndlkkiienhrlsllaiaggnenltkvleelpkrtpaesqiligeskeqeqllsq
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ldrlrelgvqsyelwenikeidserarlsaeteslvertsllrercaeahervqieeekvkdsq
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  qleelneerghlktridelekdkelsalflerekleeelrlalkewlavvacrcvleqtrqkhe
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  rqvdsarlelnqiislwedayhypgtenisleeyeeeslahvrrlekkvrelgdydlgvlsene
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  qerqpevfkkagdflelmtegryslistaseeggfsveleeksgflrkkedvwssgladqvyls
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  slknrlafltvqiedvhggigelqsliqstdervgllfgealkntderfnslfqrlfgggeahl
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  irlalaelygkrmeplplilddvfvrfderrqigaarvvldvasrgqillfscrrd........
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1a1va1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  eleeglslweagvdifarppgkrlqnlaqlsggeqsltaiallfatmevaevplaildevdasl
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                    
                                                                                    
d1a1va1                             ................................................
gi|294102520|ref|YP_003554378.1|  ................................................
gi|294102529|ref|YP_003554387.1|  ................................................
gi|294102437|ref|YP_003554295.1|  ................................................
gi|294102168|ref|YP_003554026.1|  ................................................
gi|294101779|ref|YP_003553637.1|  ................................................
gi|294102457|ref|YP_003554315.1|  ................................................
gi|294101625|ref|YP_003553483.1|  ................................................
gi|294101185|ref|YP_003553043.1|  ................................................
gi|294102626|ref|YP_003554484.1|  ................................................
gi|294101765|ref|YP_003553623.1|  ................................................
gi|294102479|ref|YP_003554337.1|  ................................................
gi|294101904|ref|YP_003553762.1|  ................................................
gi|294102557|ref|YP_003554415.1|  ................................................
gi|294101807|ref|YP_003553665.1|  ................................................
gi|294101806|ref|YP_003553664.1|  ................................................
gi|294102649|ref|YP_003554507.1|  ................................................
gi|294101185|ref|YP_003553043.1|  ................................................
gi|294102868|ref|YP_003554726.1|  ................................................
gi|294102500|ref|YP_003554358.1|  ................................................
gi|294102409|ref|YP_003554267.1|  ................................................
gi|294102354|ref|YP_003554212.1|  ................................................
gi|294101565|ref|YP_003553423.1|  ................................................
gi|294101424|ref|YP_003553282.1|  ................................................
gi|294101976|ref|YP_003553834.1|  ................................................
gi|294101061|ref|YP_003552919.1|  ................................................
gi|294101048|ref|YP_003552906.1|  ................................................
gi|294101977|ref|YP_003553835.1|  ................................................
gi|294101084|ref|YP_003552942.1|  ................................................
gi|294101565|ref|YP_003553423.1|  ................................................
gi|294101786|ref|YP_003553644.1|  ................................................
gi|294101493|ref|YP_003553351.1|  ................................................
gi|294101884|ref|YP_003553742.1|  ................................................
gi|294101894|ref|YP_003553752.1|  ................................................
gi|294101778|ref|YP_003553636.1|  ................................................
gi|294102313|ref|YP_003554171.1|  ................................................
gi|294102640|ref|YP_003554498.1|  ................................................
gi|294101376|ref|YP_003553234.1|  ................................................
gi|294102641|ref|YP_003554499.1|  ................................................
gi|294101359|ref|YP_003553217.1|  ................................................
gi|294102459|ref|YP_003554317.1|  ................................................
gi|294101785|ref|YP_003553643.1|  ................................................
gi|294101376|ref|YP_003553234.1|  ................................................
gi|294102074|ref|YP_003553932.1|  ................................................
gi|294102442|ref|YP_003554300.1|  ................................................
gi|294101577|ref|YP_003553435.1|  ................................................
gi|294101171|ref|YP_003553029.1|  ................................................
gi|294102413|ref|YP_003554271.1|  ................................................
gi|294102187|ref|YP_003554045.1|  ................................................
gi|294102332|ref|YP_003554190.1|  ................................................
gi|294102831|ref|YP_003554689.1|  ................................................
gi|294101321|ref|YP_003553179.1|  ................................................
gi|294101626|ref|YP_003553484.1|  ................................................
gi|294101069|ref|YP_003552927.1|  ................................................
gi|294102759|ref|YP_003554617.1|  ................................................
gi|294101055|ref|YP_003552913.1|  ................................................
gi|294101254|ref|YP_003553112.1|  ................................................
gi|294102760|ref|YP_003554618.1|  ................................................
gi|294101659|ref|YP_003553517.1|  ................................................
gi|294101172|ref|YP_003553030.1|  ................................................
gi|294102017|ref|YP_003553875.1|  ................................................
gi|294101748|ref|YP_003553606.1|  ................................................
gi|294102409|ref|YP_003554267.1|  ................................................
gi|294102070|ref|YP_003553928.1|  ................................................
gi|294102390|ref|YP_003554248.1|  ................................................
gi|294101403|ref|YP_003553261.1|  ................................................
gi|294101730|ref|YP_003553588.1|  ................................................
gi|294102602|ref|YP_003554460.1|  ................................................
gi|294102663|ref|YP_003554521.1|  ................................................
gi|294101436|ref|YP_003553294.1|  ................................................
gi|294102150|ref|YP_003554008.1|  ................................................
gi|294101607|ref|YP_003553465.1|  ................................................
gi|294102035|ref|YP_003553893.1|  ................................................
gi|294102412|ref|YP_003554270.1|  ................................................
gi|294101660|ref|YP_003553518.1|  ................................................
gi|294102549|ref|YP_003554407.1|  ................................................
gi|294102841|ref|YP_003554699.1|  ................................................
gi|294101272|ref|YP_003553130.1|  ................................................
gi|294101433|ref|YP_003553291.1|  ................................................
gi|294101963|ref|YP_003553821.1|  ................................................
gi|294101356|ref|YP_003553214.1|  ................................................
gi|294102542|ref|YP_003554400.1|  ................................................
gi|294101861|ref|YP_003553719.1|  ................................................
gi|294102400|ref|YP_003554258.1|  ................................................
gi|294102043|ref|YP_003553901.1|  ................................................
gi|294101077|ref|YP_003552935.1|  ................................................
gi|294102348|ref|YP_003554206.1|  ................................................
gi|294102040|ref|YP_003553898.1|  ................................................
gi|294101613|ref|YP_003553471.1|  deynllrfidlvsdyamhmqilamthrrstmeradvlygvtmdepgls
gi|294101367|ref|YP_003553225.1|  ................................................
gi|294101893|ref|YP_003553751.1|  ................................................
gi|294101841|ref|YP_003553699.1|  ................................................
gi|294102070|ref|YP_003553928.1|  ................................................
gi|294102221|ref|YP_003554079.1|  ................................................
gi|294101356|ref|YP_003553214.1|  ................................................
gi|294101345|ref|YP_003553203.1|  ................................................
gi|294102145|ref|YP_003554003.1|  ................................................
gi|294101756|ref|YP_003553614.1|  ................................................
gi|294102549|ref|YP_003554407.1|  ................................................
gi|294101372|ref|YP_003553230.1|  ................................................
gi|294101016|ref|YP_003552874.1|  ................................................
gi|294101780|ref|YP_003553638.1|  ................................................
gi|294101686|ref|YP_003553544.1|  ................................................
gi|294102507|ref|YP_003554365.1|  ................................................
gi|294101471|ref|YP_003553329.1|  ................................................
gi|294101845|ref|YP_003553703.1|  ................................................
gi|294101553|ref|YP_003553411.1|  ................................................
gi|294101853|ref|YP_003553711.1|  ................................................
gi|294101780|ref|YP_003553638.1|  ................................................
gi|294102079|ref|YP_003553937.1|  ................................................
gi|294101472|ref|YP_003553330.1|  ................................................
gi|294102235|ref|YP_003554093.1|  ................................................
gi|294102390|ref|YP_003554248.1|  ................................................
gi|294101443|ref|YP_003553301.1|  ................................................
gi|294101748|ref|YP_003553606.1|  ................................................
gi|294101649|ref|YP_003553507.1|  ................................................
gi|294101715|ref|YP_003553573.1|  ................................................
gi|294101925|ref|YP_003553783.1|  ................................................
gi|294101367|ref|YP_003553225.1|  ................................................
gi|294101751|ref|YP_003553609.1|  ................................................
gi|294101046|ref|YP_003552904.1|  ................................................
gi|294101779|ref|YP_003553637.1|  ................................................
gi|294101226|ref|YP_003553084.1|  ................................................
gi|294101892|ref|YP_003553750.1|  ................................................
gi|294102315|ref|YP_003554173.1|  ................................................