SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

P-loop containing nucleoside triphosphate hydrolases alignments in Aminobacterium colombiense DSM 12261

These alignments are sequences aligned to the 0037958 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1g6ha_                             tme.............................................................
gi|294102520|ref|YP_003554378.1|  dieiarsakmkpivevaaqlgideeelelygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102529|ref|YP_003554387.1|  dieiaqnaelkpivevaaqlginedeleyygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102437|ref|YP_003554295.1|  veiiigaqwgdegkgrvvdalgnrvevfaryqgganaghtvivedekyvfhllpsgmlypcklc
gi|294102168|ref|YP_003554026.1|  dsildklnprqqeavrycdgpllvlagagsgktrvlahkiayliekgyaspkgilavtftnkaa
gi|294101779|ref|YP_003553637.1|  adwgpsgdqpeaieklveslkngtr.......................................
gi|294102457|ref|YP_003554315.1|  tkfifvtggvvsslgkgitaaslgvllkkrgfrvsiikldpylnvdagtmnpfqhgevfvtddg
gi|294101625|ref|YP_003553483.1|  emkkirnigiaahid.................................................
gi|294101185|ref|YP_003553043.1|  tyealdkygrdlvkmarlgkldpvigrdeevrrvirilsrktknnp..................
gi|294102626|ref|YP_003554484.1|  tqpgqfkaitadaplvavsagagtgktwtlawrfiwilvtgradtneiltltftekaalemaer
gi|294101765|ref|YP_003553623.1|  ydaafpakdivdfvdriineaakngasdihieglsawsrvrfridgycravysfsldfhpaiis
gi|294102479|ref|YP_003554337.1|  hpvplgviqg......................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  yikkivkdfgsyddps................................................
gi|294101807|ref|YP_003553665.1|  tlpvsrdmlgrifngrgepidggapilpdakldingmpmnpfsrdypsefiqtgistidgmnpm
gi|294101806|ref|YP_003553664.1|  vietiaviknesgeeknvvmlqrwpvrkprpvarrlppiiplttgqrvvdaf............
gi|294102649|ref|YP_003554507.1|  m...............................................................
gi|294101185|ref|YP_003553043.1|  ipvtrlmegerekllkldeilhqrvigqdeavelvadavirarsgikdprrpvgs.........
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ltprmivecldryivgqekakravaialrnrmrrrnlprdlanevapk................
gi|294102409|ref|YP_003554267.1|  pneralkryrqiaddinglepeysaksdedlrslvadfkrranegesldnllvevfalvrevsr
gi|294102354|ref|YP_003554212.1|  kpedirs.........................................................
gi|294101565|ref|YP_003553423.1|  ipvtqlteeetqrllrmeeeihcrligqeeavsavarairrarsgmkdprrpvgs.........
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  kmpvglslvgqvlngrgrsidgtplsfidkdlpitgmpinpvrrtspnayvetgissidmmntl
gi|294101061|ref|YP_003552919.1|  i...............................................................
gi|294101048|ref|YP_003552906.1|  dkse............................................................
gi|294101977|ref|YP_003553835.1|  engveltmkqrwevrrprpvlsrlsfdaplltgqrildtlfpia....................
gi|294101084|ref|YP_003552942.1|  l...............................................................
gi|294101565|ref|YP_003553423.1|  ptldqlgidlseksrkdeldpvigrdkeiqrviqilarrtknnp....................
gi|294101786|ref|YP_003553644.1|  l...............................................................
gi|294101493|ref|YP_003553351.1|  l...............................................................
gi|294101884|ref|YP_003553742.1|  aekalhgdiralariislveneapeseeimkylyphtgkal.......................
gi|294101894|ref|YP_003553752.1|  dtpkpaevkkfldqyvigqedakkilsvavynhfkristmseenddielqk.............
gi|294101778|ref|YP_003553636.1|  dnrpkvtfddvagcdeskeelseviqflrdpgkfralgakvpkg....................
gi|294102313|ref|YP_003554171.1|  i...............................................................
gi|294102640|ref|YP_003554498.1|  l...............................................................
gi|294101376|ref|YP_003553234.1|  isyedigglgpqiqrvremielplrfpqvfdrl...............................
gi|294102641|ref|YP_003554499.1|  l...............................................................
gi|294101359|ref|YP_003553217.1|  skvlilsptrelsqqiwkeakwfgnyinvsaaslvggmdmsqqirslrdgsavvtgtpgrvldh
gi|294102459|ref|YP_003554317.1|  lrngdviwgmvrppkdqehyeallrvemvnfadpeaarkrphfgtltpifpdsrltletdpdei
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  pdvtwsdiggleaikeelieavqwplkynsvyek..............................
gi|294102074|ref|YP_003553932.1|  m...............................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  l...............................................................
gi|294102413|ref|YP_003554271.1|  v...............................................................
gi|294102187|ref|YP_003554045.1|  einrlhddllnevfgygpiqplldddtvteimvngceqvfverwgkieptdvffnndnhirrii
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  mlsiavtnqkg.....................................................
gi|294101321|ref|YP_003553179.1|  akphlnvgt.......................................................
gi|294101626|ref|YP_003553484.1|  akphlnvgt.......................................................
gi|294101069|ref|YP_003552927.1|  i...............................................................
gi|294102759|ref|YP_003554617.1|  m...............................................................
gi|294101055|ref|YP_003552913.1|  i...............................................................
gi|294101254|ref|YP_003553112.1|  p...............................................................
gi|294102760|ref|YP_003554618.1|  tdk.............................................................
gi|294101659|ref|YP_003553517.1|  t...............................................................
gi|294101172|ref|YP_003553030.1|  ni..............................................................
gi|294102017|ref|YP_003553875.1|  yirpqinnglnlkieggrhpvieatfldlpfvp...............................
gi|294101748|ref|YP_003553606.1|  vldslrgtrwkkavektrervreevknlvrlyarrellkgyafpvaseiyrhfveafpyvetpd
gi|294102409|ref|YP_003554267.1|  pmvrsdfpdviyrtslekfhavaeeveetysngqpvlvgttsienseriskllkarkiphqvln
gi|294102070|ref|YP_003553928.1|  fehvvgisalhkryiddlmdmavsllpsdeeeerdpeei.........................
gi|294102390|ref|YP_003554248.1|  dplpdflrlkhafpplydsilemhypqgreswkkardrlayqelfvlqtgmalrrgersrlaek
gi|294101403|ref|YP_003553261.1|  redilelaiddirskfgegsimrlgdpfkvqvevistgilpldvalgigg..............
gi|294101730|ref|YP_003553588.1|  ekrvsha.........................................................
gi|294102602|ref|YP_003554460.1|  vqaekirnlaiiahid................................................
gi|294102663|ref|YP_003554521.1|  i...............................................................
gi|294101436|ref|YP_003553294.1|  lk..............................................................
gi|294102150|ref|YP_003554008.1|  slsrirnfciiahid.................................................
gi|294101607|ref|YP_003553465.1|  prvivvt.........................................................
gi|294102035|ref|YP_003553893.1|  rrfvqvymgdgkgkttaalglairaagwnmkvgiiqfmkgwpqygelaslarfpeiqlvqtgrp
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ms..............................................................
gi|294102549|ref|YP_003554407.1|  l...............................................................
gi|294102841|ref|YP_003554699.1|  pa..............................................................
gi|294101272|ref|YP_003553130.1|  m...............................................................
gi|294101433|ref|YP_003553291.1|  kkdvgkviavgs....................................................
gi|294101963|ref|YP_003553821.1|  khmeprp.........................................................
gi|294101356|ref|YP_003553214.1|  dssekavaihfpqcprsgqe............................................
gi|294102542|ref|YP_003554400.1|  r...............................................................
gi|294101861|ref|YP_003553719.1|  lrpsslqdfvgqqklkdklsiyvqaarqrkeald..............................
gi|294102400|ref|YP_003554258.1|  vtgfstgfyqfdrmtgglqpgslniiaarpsmgktalalniaqyggverkepilifslemsaeq
gi|294102043|ref|YP_003553901.1|  mf..............................................................
gi|294101077|ref|YP_003552935.1|  m...............................................................
gi|294102348|ref|YP_003554206.1|  l...............................................................
gi|294102040|ref|YP_003553898.1|  ksp.............................................................
gi|294101613|ref|YP_003553471.1|  mfierlrlkgfksfggsheltfs.........................................
gi|294101367|ref|YP_003553225.1|  e...............................................................
gi|294101893|ref|YP_003553751.1|  pwntyteenlditkaqrildedhyglvkvkerilef............................
gi|294101841|ref|YP_003553699.1|  d...............................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  mvhhvk..........................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  p...............................................................
gi|294102145|ref|YP_003554003.1|  eislvlgtaghid...................................................
gi|294101756|ref|YP_003553614.1|  p...............................................................
gi|294102549|ref|YP_003554407.1|  p...............................................................
gi|294101372|ref|YP_003553230.1|  ytgeemveisthggtlvaqkclesligkgarlaepgeftrraflngkidlsqaeavlgiirsks
gi|294101016|ref|YP_003552874.1|  lnpnyifnsfvvgksnrlahaaslavaetpgeaynp............................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  idesgcekprssdlmavniidvrppqrftsgipeldrvlgggwv....................
gi|294102507|ref|YP_003554365.1|  pnpdladikgqagakraleiaaagh.......................................
gi|294101471|ref|YP_003553329.1|  flrkgg..........................................................
gi|294101845|ref|YP_003553703.1|  mleelslrniggldsahlhf............................................
gi|294101553|ref|YP_003553411.1|  dvdykvvkslvdsirgrcigqevldsitpgqqvvaivyeelvslmgedvvpfiissk.......
gi|294101853|ref|YP_003553711.1|  lrveapipgkpyvgieipnpkrrgvllrrilesqafeqadynlplpmgvrvdsrpliigledlp
gi|294101780|ref|YP_003553638.1|  ah..............................................................
gi|294102079|ref|YP_003553937.1|  mknl............................................................
gi|294101472|ref|YP_003553330.1|  f...............................................................
gi|294102235|ref|YP_003554093.1|  it..............................................................
gi|294102390|ref|YP_003554248.1|  ppgrtpiqtrwlkkkeegrlwafirercsareriywvcplidesetlsvasvteryeylkklfp
gi|294101443|ref|YP_003553301.1|  qwerpladrmrpsslddfvgqnhllapgtplrqilqsgkvps......................
gi|294101748|ref|YP_003553606.1|  ppynrvpvltmvgprkknlihra.........................................
gi|294101649|ref|YP_003553507.1|  mr..............................................................
gi|294101715|ref|YP_003553573.1|  wtlpelskkpffvfydllhpllgekgipltiecgrsfhvlvvtgpntggktvalktvgmgiila
gi|294101925|ref|YP_003553783.1|  sieigkhsssdnlsvyvdihklilr.......................................
gi|294101367|ref|YP_003553225.1|  lagn............................................................
gi|294101751|ref|YP_003553609.1|  pvrpktggqklyieam................................................
gi|294101046|ref|YP_003552904.1|  navlsa..........................................................
gi|294101779|ref|YP_003553637.1|  t...............................................................
gi|294101226|ref|YP_003553084.1|  l...............................................................
gi|294101892|ref|YP_003553750.1|  ppqtlpe.........................................................
gi|294102315|ref|YP_003554173.1|  sdnlvlydskdltthg................................................
gi|294102188|ref|YP_003554046.1|  eriavlscrggaggssfsislalqlasmgkrtalidgdlymgdvafllntpyelnwtswanecl
gi|294102320|ref|YP_003554178.1|  ekytniiideahrfrtettityeklaeicrgkrvilvtatpynnspkdilsllklfqkgqksti
gi|294102169|ref|YP_003554027.1|  svmaadeefarrmrdeshhrgilv........................................
gi|294101254|ref|YP_003553112.1|  kkitvlgd........................................................
gi|294102077|ref|YP_003553935.1|  ryrrekagip......................................................
gi|294102510|ref|YP_003554368.1|  hmakgkrkleelvqkldlilevrdaraphltsspmsdqlsricpvyivlsradlaeegatkawl
gi|294101748|ref|YP_003553606.1|  qvhlpvdggarawilggasvpllvvfsdqrqaedfvsdfenlwegeivrllyelplsvegvrnk
gi|294101141|ref|YP_003552999.1|  drtcllapcgsgktlaawkwgsgvasrhpisrfiflyptratategfrdyvswapetdgtllhg
gi|294101018|ref|YP_003552876.1|  lewaagl.........................................................
gi|294101692|ref|YP_003553550.1|  iwdsfmqqrntvfvaeaptgigktfallapalkwalpqekrilfltagitlqeqlirkdlprlk
gi|294101032|ref|YP_003552890.1|  mfrltvas........................................................
gi|294101031|ref|YP_003552889.1|  p...............................................................
gi|294101431|ref|YP_003553289.1|  ek..............................................................
gi|294102167|ref|YP_003554025.1|  lv..............................................................
gi|294101458|ref|YP_003553316.1|  aplcipqlevlikgmflkdrfldiirhfvlfqsdgkeikkilagyhqyhavnkalqstqratme
gi|294102320|ref|YP_003554178.1|  fkrleyqeqavlnakkivleyggvfisd....................................
gi|294101940|ref|YP_003553798.1|  rlgirrldtafdg...................................................
gi|294102120|ref|YP_003553978.1|  rtakglamac......................................................
gi|294101791|ref|YP_003553649.1|  h...............................................................
gi|294102136|ref|YP_003553994.1|  mvkqidirkyrkmedlslvfsqginilsgtngtcktsllhivsnsfqevnkgcpwvtdasclta
gi|294101830|ref|YP_003553688.1|  r...............................................................
gi|294102042|ref|YP_003553900.1|  iaidiarlllcekknacgqclsccswhekthpdlvlsgslekaptisecreiavelslypvvas
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  mrfiefkirsfg....................................................
gi|294102032|ref|YP_003553890.1|  lekfigqeravqaisfglsves..........................................
gi|294102010|ref|YP_003553868.1|  tllaslirlyewp...................................................
gi|294101586|ref|YP_003553444.1|  y...............................................................
gi|294101458|ref|YP_003553316.1|  vviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltdkntrvvfg
gi|294102625|ref|YP_003554483.1|  ivagsprmemetlarelvlwknkkgylsgqeilpaetp..........................
gi|294102478|ref|YP_003554336.1|  ipvisvgnitlggtnktpfvemlsrhfynmgvrvgivsrgyggrtsepvvikgtssereivgde
gi|294101874|ref|YP_003553732.1|  h...............................................................
gi|294102071|ref|YP_003553929.1|  lqehpgpaillfperalaeffysfletegveniflwpsvggkklweawnrtrsgehkiiiggpg


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  gegkttttvglaqglaklgkkvsialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102529|ref|YP_003554387.1|  gegkttttvglgqglaklgkrvcialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102437|ref|YP_003554295.1|  vvgngvvvdpeq....................................................
gi|294102168|ref|YP_003554026.1|  remgervqalvgakasamqvstfhsfglhflfrnsdqleflglrkgfaifdrndsrslvkkime
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  aetdldlghyerfideslsadnnvttgkiystviskerhgcylggtvqviphitneiqdrilka
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  iknlllqlamelpsqkvffqkaadridegyistihsfsmrvlkecglateldpesgtiappqes
gi|294101765|ref|YP_003553623.1|  rikimasmdisdkrrpqdgqfniktgsqdfldvrvsslptvdgekialrlldsskipdniyqlg
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  vrgqklpifsgsglphnrmaaqiarqatvisghedfavvfaamgitfeeasffmedfrrtgaiq
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  rtlglrhfdvqlmggmalhegkitemktgegktlvatlavvlnalsgngvhvvtvndylakrda
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  vrgqklpifsgsglpaneiaaqivqqaavpgretdflvifaamgitrrearyfidtfestgain
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  irrgtldts.......................................................
gi|294102459|ref|YP_003554317.1|  strlidlfap......................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  dkivaplgrrideaspmvdarlpdgsrvnavippvsidgptltvrkfrrepftaqdlialgtls
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  qlraeqeilqdmesshpmdrl...........................................
gi|294102409|ref|YP_003554267.1|  akyhekeaqivaqagrfgavtvatnmagrgtdivlggnpdflaket..................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  apilpesgrlkerflkeifpyplteaqkkvsleisqdmalnipmhr..................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  dfvkkgsplqfdieeaqrglelakkwiekglf................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  lvqrmlgseakvnihdirngsfaekdweklada...............................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  eealraatrtlrgelssfakdiynemltisssievgldfpeedipfienegvesalytlkqgle
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  h...............................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  dlnvgllhgqlpsseketimrsfarghldl..................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  wcgfplpakegtvvgnldnvfadigdeqs...................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  sgtvdgerylalgpkdlmimptaknpvqaelvksgmgdrl........................
gi|294102320|ref|YP_003554178.1|  pnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylmvrrtraeieeyfsrd
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  qffssikqkawafnflegriqllrrdlaklrpahrel...........................
gi|294101748|ref|YP_003553606.1|  slllqrgetlskwkqek...............................................
gi|294101141|ref|YP_003552999.1|  tsnyelqgmfdnpdprsekefltndrlfavglwqkrlfsatvdqflgfmrhdyrsscllpllad
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ellgydvsfgllkgrgnyvcvrralelehegflsfgdsgaasiylsewlkktqtgdlselklps
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  qgdrrvgviwhtqgsgkslsmvfyagklvideelenptivvitdrndlddqlfstflkseellr
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ikkvnklinpkietltkgdktyndpanqvkgtlftveyydhpslefrkhnskannryaikpyyg
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  crl.............................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  dyidiydmtravedgttvkifyesriakldlpeemkpqidseyeeiteyqeysq..........
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  plllasrlphvpvavsrdrlkdveal......................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  aif.............................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  aittahnllaa.....................................................
gi|294102529|ref|YP_003554387.1|  aitsahnllsalidnhlhqgnplnidprrvvfrrvvdlneralrhvivglggkadgvpre....
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  dlkldpkqidptnvldhiskaktegnhktlepvglegiehevyrkyhdelrrqnavdfddllil
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  addndiviaeiggtvgdiegqpfleairqmatrvgrqnvlychv....................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  lfwkeaeealdrwdgnwfakssshlwaqriaklfsdplfmdsvntfgpnatvelaksslalfas
gi|294101765|ref|YP_003553623.1|  feqrdlellekllsqk................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  rtvmfvnladdpaierittprlal........................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ewmgpiyrflglsvkciyaymdqkerkeaylsdvtygtnsefgfdylrdnmavakdqlvqrghh
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ngiffmnlasdsaverlltprmaltaaeyfafekgydvlvimtdmlyyceslreisaareevpg
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  desvsflrvatearyn................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  dlldrc..........................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ikeqglkfpkvakpvplfyelnekedfifnrtiehianqfkyarympmlyyk............
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  savvfdeihsfdq...................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  dfpifprvaaqvrgclghrcpyrdrcfiqkalkkaqnwdvivsnyhmyfayvmngkgtfpv...
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ntpvqaqdrvhlrell................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  knrgdtlpfcpviylglgrlfpfgefqndeairgvkgelpstyqdeiktfyedftgisiesssp
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  plhllmvdeklreqeqsrldwilvdeyqdvnkpqyf............................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  qgqtpkdlwqwgsdlfsrdqdavdtarltlfrrwedewhrflqpesgifynlnelggtgklcgn
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  fcivdevdsilideartpliisgpsednvemyttadqiarqlkegrdfekdekernvaftedgi
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  rr..............................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  qqmgdfktradfisdvegidsntisagednlfilltaiislkyyyeatalshev..........
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  vrnlitrwqqqpskenlphfiqslieglkgasgklaneiafhlkepvsqyrnrlikeepwitvf
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  arcenllkmpglfsdaansdlahrivqavkahvlfq............................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             .........................................................---ILRT
gi|294102520|ref|YP_003554378.1|  .........................................................-------
gi|294102529|ref|YP_003554387.1|  .........................................................-------
gi|294102437|ref|YP_003554295.1|  .........................................................-------
gi|294102168|ref|YP_003554026.1|  .........................................................-------
gi|294101779|ref|YP_003553637.1|  .........................................................-------
gi|294102457|ref|YP_003554315.1|  .........................................................-------
gi|294101625|ref|YP_003553483.1|  .........................................................-------
gi|294101185|ref|YP_003553043.1|  .........................................................-------
gi|294102626|ref|YP_003554484.1|  tqgfdekeqayrscllgfsailwqlwdefrrrknrlsfddmiryamealehspsyae-------
gi|294101765|ref|YP_003553623.1|  .........................................................-------
gi|294102479|ref|YP_003554337.1|  .........................................................---AIKM
gi|294101904|ref|YP_003553762.1|  .........................................................----ISL
gi|294102557|ref|YP_003554415.1|  .........................................................-------
gi|294101807|ref|YP_003553665.1|  .........................................................-------
gi|294101806|ref|YP_003553664.1|  .........................................................-------
gi|294102649|ref|YP_003554507.1|  .........................................................----ISI
gi|294101185|ref|YP_003553043.1|  .........................................................-------
gi|294102868|ref|YP_003554726.1|  .........................................................----LQL
gi|294102500|ref|YP_003554358.1|  .........................................................-------
gi|294102409|ref|YP_003554267.1|  .........................................................-------
gi|294102354|ref|YP_003554212.1|  .........................................................-------
gi|294101565|ref|YP_003553423.1|  .........................................................-------
gi|294101424|ref|YP_003553282.1|  .........................................................----IEV
gi|294101976|ref|YP_003553834.1|  .........................................................-------
gi|294101061|ref|YP_003552919.1|  .........................................................----LRV
gi|294101048|ref|YP_003552906.1|  .........................................................-------
gi|294101977|ref|YP_003553835.1|  .........................................................-------
gi|294101084|ref|YP_003552942.1|  .........................................................----IHV
gi|294101565|ref|YP_003553423.1|  .........................................................-------
gi|294101786|ref|YP_003553644.1|  .........................................................----LKV
gi|294101493|ref|YP_003553351.1|  .........................................................----VRV
gi|294101884|ref|YP_003553742.1|  .........................................................-------
gi|294101894|ref|YP_003553752.1|  .........................................................-------
gi|294101778|ref|YP_003553636.1|  .........................................................-------
gi|294102313|ref|YP_003554171.1|  .........................................................----VNI
gi|294102640|ref|YP_003554498.1|  .........................................................----LDI
gi|294101376|ref|YP_003553234.1|  .........................................................-------
gi|294102641|ref|YP_003554499.1|  .........................................................----LDI
gi|294101359|ref|YP_003553217.1|  .........................................................-------
gi|294102459|ref|YP_003554317.1|  .........................................................-------
gi|294101785|ref|YP_003553643.1|  .........................................................---ILEI
gi|294101376|ref|YP_003553234.1|  .........................................................-------
gi|294102074|ref|YP_003553932.1|  .........................................................-------
gi|294102442|ref|YP_003554300.1|  .........................................................----IRL
gi|294101577|ref|YP_003553435.1|  .........................................................----LKA
gi|294101171|ref|YP_003553029.1|  .........................................................----LEL
gi|294102413|ref|YP_003554271.1|  .........................................................----LET
gi|294102187|ref|YP_003554045.1|  .........................................................-------
gi|294102332|ref|YP_003554190.1|  .........................................................----IRI
gi|294102831|ref|YP_003554689.1|  .........................................................-------
gi|294101321|ref|YP_003553179.1|  .........................................................-------
gi|294101626|ref|YP_003553484.1|  .........................................................-------
gi|294101069|ref|YP_003552927.1|  .........................................................----LSV
gi|294102759|ref|YP_003554617.1|  .........................................................----IEI
gi|294101055|ref|YP_003552913.1|  .........................................................----LEI
gi|294101254|ref|YP_003553112.1|  .........................................................---LVQM
gi|294102760|ref|YP_003554618.1|  .........................................................-------
gi|294101659|ref|YP_003553517.1|  .........................................................------L
gi|294101172|ref|YP_003553030.1|  .........................................................---LLDV
gi|294102017|ref|YP_003553875.1|  .........................................................-------
gi|294101748|ref|YP_003553606.1|  .........................................................-------
gi|294102409|ref|YP_003554267.1|  .........................................................-------
gi|294102070|ref|YP_003553928.1|  .........................................................-------
gi|294102390|ref|YP_003554248.1|  .........................................................-------
gi|294101403|ref|YP_003553261.1|  .........................................................-------
gi|294101730|ref|YP_003553588.1|  .........................................................-------
gi|294102602|ref|YP_003554460.1|  .........................................................-------
gi|294102663|ref|YP_003554521.1|  .........................................................------V
gi|294101436|ref|YP_003553294.1|  .........................................................-------
gi|294102150|ref|YP_003554008.1|  .........................................................-------
gi|294101607|ref|YP_003553465.1|  .........................................................-------
gi|294102035|ref|YP_003553893.1|  .........................................................-------
gi|294102412|ref|YP_003554270.1|  .........................................................----LKI
gi|294101660|ref|YP_003553518.1|  .........................................................----III
gi|294102549|ref|YP_003554407.1|  .........................................................-----WI
gi|294102841|ref|YP_003554699.1|  .........................................................----VVF
gi|294101272|ref|YP_003553130.1|  .........................................................----LRL
gi|294101433|ref|YP_003553291.1|  .........................................................-------
gi|294101963|ref|YP_003553821.1|  .........................................................-------
gi|294101356|ref|YP_003553214.1|  .........................................................---VISV
gi|294102542|ref|YP_003554400.1|  .........................................................------L
gi|294101861|ref|YP_003553719.1|  .........................................................-------
gi|294102400|ref|YP_003554258.1|  .........................................................-------
gi|294102043|ref|YP_003553901.1|  .........................................................-------
gi|294101077|ref|YP_003552935.1|  .........................................................--PLLRL
gi|294102348|ref|YP_003554206.1|  .........................................................----LKV
gi|294102040|ref|YP_003553898.1|  .........................................................-------
gi|294101613|ref|YP_003553471.1|  .........................................................-------
gi|294101367|ref|YP_003553225.1|  .........................................................--PLLKM
gi|294101893|ref|YP_003553751.1|  .........................................................-------
gi|294101841|ref|YP_003553699.1|  .........................................................-------
gi|294102070|ref|YP_003553928.1|  .........................................................-------
gi|294102221|ref|YP_003554079.1|  .........................................................-------
gi|294101356|ref|YP_003553214.1|  .........................................................----IQL
gi|294101345|ref|YP_003553203.1|  .........................................................---LLAT
gi|294102145|ref|YP_003554003.1|  .........................................................-------
gi|294101756|ref|YP_003553614.1|  .........................................................-------
gi|294102549|ref|YP_003554407.1|  .........................................................---FLEM
gi|294101372|ref|YP_003553230.1|  .........................................................-------
gi|294101016|ref|YP_003552874.1|  .........................................................-------
gi|294101780|ref|YP_003553638.1|  .........................................................-------
gi|294101686|ref|YP_003553544.1|  .........................................................-------
gi|294102507|ref|YP_003554365.1|  .........................................................-------
gi|294101471|ref|YP_003553329.1|  .........................................................-------
gi|294101845|ref|YP_003553703.1|  .........................................................-------
gi|294101553|ref|YP_003553411.1|  .........................................................-------
gi|294101853|ref|YP_003553711.1|  .........................................................-------
gi|294101780|ref|YP_003553638.1|  .........................................................-------
gi|294102079|ref|YP_003553937.1|  .........................................................-------
gi|294101472|ref|YP_003553330.1|  .........................................................----LSV
gi|294102235|ref|YP_003554093.1|  .........................................................-------
gi|294102390|ref|YP_003554248.1|  .........................................................-------
gi|294101443|ref|YP_003553301.1|  .........................................................-------
gi|294101748|ref|YP_003553606.1|  .........................................................-------
gi|294101649|ref|YP_003553507.1|  .........................................................-------
gi|294101715|ref|YP_003553573.1|  .........................................................-------
gi|294101925|ref|YP_003553783.1|  .........................................................-------
gi|294101367|ref|YP_003553225.1|  .........................................................---ILKV
gi|294101751|ref|YP_003553609.1|  .........................................................-------
gi|294101046|ref|YP_003552904.1|  .........................................................-------
gi|294101779|ref|YP_003553637.1|  .........................................................-------
gi|294101226|ref|YP_003553084.1|  .........................................................-------
gi|294101892|ref|YP_003553750.1|  .........................................................-------
gi|294102315|ref|YP_003554173.1|  .........................................................-------
gi|294102188|ref|YP_003554046.1|  .........................................................-------
gi|294102320|ref|YP_003554178.1|  .........................................................-------
gi|294102169|ref|YP_003554027.1|  .........................................................-------
gi|294101254|ref|YP_003553112.1|  .........................................................-------
gi|294102077|ref|YP_003553935.1|  .........................................................-------
gi|294102510|ref|YP_003554368.1|  .........................................................-------
gi|294101748|ref|YP_003553606.1|  .........................................................-------
gi|294101141|ref|YP_003552999.1|  .........................................................-------
gi|294101018|ref|YP_003552876.1|  .........................................................-------
gi|294101692|ref|YP_003553550.1|  .........................................................-------
gi|294101032|ref|YP_003552890.1|  .........................................................-------
gi|294101031|ref|YP_003552889.1|  .........................................................-------
gi|294101431|ref|YP_003553289.1|  .........................................................-------
gi|294102167|ref|YP_003554025.1|  .........................................................-------
gi|294101458|ref|YP_003553316.1|  .........................................................-------
gi|294102320|ref|YP_003554178.1|  .........................................................-------
gi|294101940|ref|YP_003553798.1|  .........................................................-------
gi|294102120|ref|YP_003553978.1|  .........................................................-------
gi|294101791|ref|YP_003553649.1|  .........................................................-------
gi|294102136|ref|YP_003553994.1|  .........................................................-------
gi|294101830|ref|YP_003553688.1|  .........................................................-------
gi|294102042|ref|YP_003553900.1|  .........................................................-------
gi|294102015|ref|YP_003553873.1|  .........................................................-------
gi|294102787|ref|YP_003554645.1|  .........................................................-------
gi|294102032|ref|YP_003553890.1|  .........................................................-------
gi|294102010|ref|YP_003553868.1|  .........................................................-------
gi|294101586|ref|YP_003553444.1|  .........................................................-------
gi|294101458|ref|YP_003553316.1|  .........................................................-------
gi|294102625|ref|YP_003554483.1|  .........................................................-------
gi|294102478|ref|YP_003554336.1|  .........................................................-------
gi|294101874|ref|YP_003553732.1|  .........................................................-------
gi|294102071|ref|YP_003553929.1|  .........................................................-------


                                     10                    20        30        40          50       
                                      |                     |         |         |           |       
d1g6ha_                             ENIVKYF.......GE.....FKALDGVSISVNKGDVTLIIGPNGSGKS.TLIN.VITGFLK..
gi|294102520|ref|YP_003554378.1|  -------.......--.....----------------------------.----.----L--..
gi|294102529|ref|YP_003554387.1|  -------.......--.....----------------------------.----.-------..
gi|294102437|ref|YP_003554295.1|  -------.......--.....----------------------------.----.-------..
gi|294102168|ref|YP_003554026.1|  -------.......--.....----------------------------.----.-L-----..
gi|294101779|ref|YP_003553637.1|  -------.......--.....---------------FQTLLGVTGSGKTfTVAN.VLAQFDR..
gi|294102457|ref|YP_003554315.1|  -------.......--.....----------------------------.----.-------..
gi|294101625|ref|YP_003553483.1|  -------.......--.....------------------------AGKT.TTTE.RILFY--..
gi|294101185|ref|YP_003553043.1|  -------.......--.....-----------------VLIGDPGVGKT.AIVE.GLAQRI-..
gi|294102626|ref|YP_003554484.1|  -------.......--.....----------------------------.----.-------..
gi|294101765|ref|YP_003553623.1|  -------.......--.....-------------EGLILVTGPTGSGKS.TTLH.ALIKQVN..
gi|294102479|ref|YP_003554337.1|  EDVWFAYk......DE.....QWVLKGVALEVCPGERVAVVGETGGGKS.TLMD.LIPRFYD..
gi|294101904|ref|YP_003553762.1|  THLTKIFtkgk...ES.....FKAVDDVHLDIDAGELITFLGPSGCGKT.TILR.MIAGFEK..
gi|294102557|ref|YP_003554415.1|  -------.......NR.....VRAVDRVDLHVKEGELITLLGPSGCGKT.TLLR.MIAGFED..
gi|294101807|ref|YP_003553665.1|  -------.......--.....----------------------------.----.-------..
gi|294101806|ref|YP_003553664.1|  -------.......--.....--------FPIAKGGTACVPGPFGSGKT.VIQH.QLAKW--..
gi|294102649|ref|YP_003554507.1|  QNLYKTYpceg...GD.....FEALRNVSINIQSGEIFGIIGLSGAGKS.TLLR.TLNRLEE..
gi|294101185|ref|YP_003553043.1|  -------.......--.....----------------FIFLGPTGVGKT.ELAK.TLAEALF..
gi|294102868|ref|YP_003554726.1|  KQLNKKF.......GH.....SYAVRDFSFDINEGELVSLLGPSGCGKT.TTLR.MIGGFLQ..
gi|294102500|ref|YP_003554358.1|  -------.......--.....---------------NILMVGPTGVGKT.EIAR.RLADLVL..
gi|294102409|ref|YP_003554267.1|  -------.......--.....----K-----------------------.----.-------..
gi|294102354|ref|YP_003554212.1|  -------.......--.....----------------VAIAAHGGAGKT.SLVE.AILF---..
gi|294101565|ref|YP_003553423.1|  -------.......--.....----------------FLFLGPTGVGKT.ELAR.RLADFLF..
gi|294101424|ref|YP_003553282.1|  KNLHKSF.......GN.....LHVLQGVSMTVGEGEVVSVIGPSGSGKS.TLAR.CICRLED..
gi|294101976|ref|YP_003553834.1|  -------.......--.....----------------------------.----.-------..
gi|294101061|ref|YP_003552919.1|  EDIHKSY.......GG.....VEVLRGISFTVRKGETKVFIGPSGTGKS.TLLR.CINQLTI..
gi|294101048|ref|YP_003552906.1|  -------.......DA.....VVAVRGVSLAARQGEVFVIMGLSGSGKS.TLIR.CVIRLIE..
gi|294101977|ref|YP_003553835.1|  -------.......--.....------------IGGAAVLPGGFGTGKT.VTQQ.SLAKW--..
gi|294101084|ref|YP_003552942.1|  ENLYKSF.......ED.....GEVLNGISIDIHEGDLVSIIGPSGCGKS.TFLR.CLNCLEY..
gi|294101565|ref|YP_003553423.1|  -------.......--.....-----------------VLLGDPGVGKT.AIVE.GLAQKIQ..
gi|294101786|ref|YP_003553644.1|  DHLKKHFytpy...GT.....LFAVDDVSFSIKEGETLGVVGESGCGKS.TLGR.AVLRLCE..
gi|294101493|ref|YP_003553351.1|  DNIYKTYsm.....GEvd...VTALQGVSFSVKKGEFLSIMGASGSGKS.TLMN.IIGCLDT..
gi|294101884|ref|YP_003553742.1|  -------.......--.....---------------VIGITGSPGAGKS.TLVD.KLILEFR..
gi|294101894|ref|YP_003553752.1|  -------.......--.....--------------SNVLLIGPTGSGKT.LLAQ.SLAKKLN..
gi|294101778|ref|YP_003553636.1|  -------.......--.....----------------VLLLGPPGTGKT.LLAR.AAAGEAD..
gi|294102313|ref|YP_003554171.1|  KELTKRYpmgd...HT.....FTALSSVDLEFKKGEFCGLIGPSGSGKT.TLLN.IIGALDA..
gi|294102640|ref|YP_003554498.1|  RNLKKYFnvsk...GL.....LHAVDDITLTITKGQTLGLVGESGCGKS.TLGR.VVIGLIE..
gi|294101376|ref|YP_003553234.1|  -------.......--.....---------GVQPPKGVLLYGPPGTGKT.VIAR.AVANETD..
gi|294102641|ref|YP_003554499.1|  RNLSVRF.......NTdsgi.VHAVNNLNLSLRRGKALGFVGETGAGKT.TTAL.AVLQLIQsp
gi|294101359|ref|YP_003553217.1|  -------.......--.....----------------------------.----.-------..
gi|294102459|ref|YP_003554317.1|  -------.......--.....----------IGKGQRALLVSPPKAGKT.TVLK.KIANAVT..
gi|294101785|ref|YP_003553643.1|  RNLRVSYeted...GT.....VEALNGIDLDLDEGVTLGIVGETGAGKT.TLAK.SIMRIIPtp
gi|294101376|ref|YP_003553234.1|  -------.......--.....--------FNITPPQGILLHGPSGTGKT.LLVR.ALAHE--..
gi|294102074|ref|YP_003553932.1|  -------.......--.....----------------FVISGPSGAGKG.TVRK.ALFEQMP..
gi|294102442|ref|YP_003554300.1|  AGVTKIFq......PD.....IVALEDVYLSIMQGEFVYLVGTTGSGKT.TLMR.LITRELI..
gi|294101577|ref|YP_003553435.1|  RKVCKAF.......KG.....RTVVSSVDLDVHMGEIVGLLGPNGAGKT.TTFY.MIVGLIK..
gi|294101171|ref|YP_003553029.1|  NGVDKFF.......GG.....VHAVQSMSFALNEKEIVGLIGPNGAGKT.TIFN.VVTGVYD..
gi|294102413|ref|YP_003554271.1|  KGLTMCF.......GG.....LTAVNSFNMAVPKGSIVGLIGPNGAGKT.TVFN.MITGFYK..
gi|294102187|ref|YP_003554045.1|  -------.......--.....----------------IIVTGGTGSGKT.TTLN.VLSSFIP..
gi|294102332|ref|YP_003554190.1|  SGLRKRY.......GSgdta.VDALKMVNMHVAPGEVVGLIGPSGSGKS.TLLK.CLGAVIE..
gi|294102831|ref|YP_003554689.1|  -------.......--.....-----------------------GVGKT.TTCV.NLSAELG..
gi|294101321|ref|YP_003553179.1|  -------.......--.....-------------------IGHIDHGKT.TLTA.AITKCLS..
gi|294101626|ref|YP_003553484.1|  -------.......--.....-------------------IGHIDHGKT.TLTA.AITKCLS..
gi|294101069|ref|YP_003552927.1|  DDLHFSY.......GE.....TPILKNISLSVKNQEMVMILGPNGSGKT.TLLR.CLNGINR..
gi|294102759|ref|YP_003554617.1|  VDLSITYktes...HD.....VSAVKNAFLSIPRGRITGLVGESGSGKS.SLLM.AIPGLLPsn
gi|294101055|ref|YP_003552913.1|  HQLAVAF.......NN.....KKILKNINANIYPHQITAIIGPSGCGKS.TFLK.SLNRLVEde
gi|294101254|ref|YP_003553112.1|  QEITKEF.......AG.....IVANHNIDFDVNRGEVHALLGENGAGKS.TLMN.ILYGLYN..
gi|294102760|ref|YP_003554618.1|  --VSVFYpsrdgknSG.....QWALRNISLSLQQGESLALIGESGSGKT.SLLR.VLLGLIS..
gi|294101659|ref|YP_003553517.1|  QGVGFSYpe.....AD.....SSALDQVSFQVREGEWLALLGSNGSGKS.TLAK.HLNALLL..
gi|294101172|ref|YP_003553030.1|  QNLQVSY.......GA.....IRALRGISLQVKEGEIVCVIGANGAGKS.TLMN.ALMSEVR..
gi|294102017|ref|YP_003553875.1|  -------.......--.....----NDIVLDGDEERIALITGPNMAGKS.TYLR.MAALLVI..
gi|294101748|ref|YP_003553606.1|  -------.......--.....------------------LVGDVGFGKT.EIA-.-------..
gi|294102409|ref|YP_003554267.1|  -------.......--.....----------------------------.----.-------..
gi|294102070|ref|YP_003553928.1|  -------.......--.....---------------RVSIVGRPNVGKS.SLVN.ALAGSDR..
gi|294102390|ref|YP_003554248.1|  -------.......--.....-----------------LLQGDVGSGKT.AV--.-------..
gi|294101403|ref|YP_003553261.1|  -------.......--.....----------LPKGRIVEIFGPEGSGKT.TVA-.-------..
gi|294101730|ref|YP_003553588.1|  -------.......--.....----------------YLFSGPRGCGKT.TLAR.LLAKSLN..
gi|294102602|ref|YP_003554460.1|  -------.......--.....------------------------HGKT.TLID.SIFKAAQ..
gi|294102663|ref|YP_003554521.1|  SNLNLFY.......GK.....NQVLHNINMDIFGKTVTALIGPSGCGKS.SFIR.CLNRMNDfi
gi|294101436|ref|YP_003553294.1|  -------.......--.....----------------CGIVGLPLCGKS.TVFN.VITRA--..
gi|294102150|ref|YP_003554008.1|  -------.......--.....------------------------HGKS.TLAD.RLIE---..
gi|294101607|ref|YP_003553465.1|  -------.......--.....-------------------SGKGGVGKT.TTTA.NVSFALA..
gi|294102035|ref|YP_003553893.1|  -------.......--.....----------------------------.----.-------..
gi|294102412|ref|YP_003554270.1|  EELHVYY.......GG.....IHAVKGISLHIPKGKIVTLIGANGAGKS.STIR.SIAGLVR..
gi|294101660|ref|YP_003553518.1|  KNLTHTY.......HPstpleTVALEGINLTTEKGQWLSIVGHTGSGKS.TLAQ.HLNALIV..
gi|294102549|ref|YP_003554407.1|  SRLTKTF.......GT.....LRAVDDFSLEIASGTVHSLVGENGAGKS.TVVK.CVYGLYS..
gi|294102841|ref|YP_003554699.1|  EDVSFGYe......NG.....TMVLDQASFQVPQGEFLVIIGPNGGGKT.TLLR.LILGLEK..
gi|294101272|ref|YP_003553130.1|  SHLGKKY.......NG.....LPVIDQFDLDIEKGSFSVLIGPSGCGKS.TLFD.LLTGTIE..
gi|294101433|ref|YP_003553291.1|  -------.......--.....--------------------GKGGVGKS.SISC.LLAVALA..
gi|294101963|ref|YP_003553821.1|  -------.......--.....--------------PIVTVMGHVDHGKT.TLLD.YIRQTNI..
gi|294101356|ref|YP_003553214.1|  KDVKKTY.......GD.....NLIFKDISFSVHRGEKIALVGVNGAGKS.TLSR.LISQSEV..
gi|294102542|ref|YP_003554400.1|  KNIKHFY.......SQ.....RCVLQIPSLEIGQGEILGLLGANGSGKS.TLLR.ILAFLET..
gi|294101861|ref|YP_003553719.1|  -------.......--.....---------------HILFYGPPGLGKT.TLAG.IIAHEMG..
gi|294102400|ref|YP_003554258.1|  -------.......--.....----------------------------.----.-------..
gi|294102043|ref|YP_003553901.1|  -------.......--.....----------------ITLEGIDGCGKS.TQAA.FLKEQLQ..
gi|294101077|ref|YP_003552935.1|  KSIAFAYp......RS.....SPLFTHLSFEIFEKEKIYIRGENGAGKT.TLFS.LIMGLLR..
gi|294102348|ref|YP_003554206.1|  DSITVRR.......DN.....ATILKDISLRVESGEVTGVLGRNGAGKS.SLAY.ALMGLPDyi
gi|294102040|ref|YP_003553898.1|  -------.......--.....--------------KVIVLVGVNGSGKT.TTAA.KLAEQFH..
gi|294101613|ref|YP_003553471.1|  -------.......--.....------------PG-FTAIVGPNGSGKS.NILD.GLRWVLG..
gi|294101367|ref|YP_003553225.1|  ENIGKAY.......FG.....NRVLKDVSFTLEKGQILGLVGENGAGKS.TLMN.ILFGMPViq
gi|294101893|ref|YP_003553751.1|  -------.......--.....-LAVRQLAGKEAKGQVLCFVGPPGVGKT.SLAQ.SIARALG..
gi|294101841|ref|YP_003553699.1|  -------.......--.....----------------VGLVGLPNAGKS.SLLA.AISNARP..
gi|294102070|ref|YP_003553928.1|  -------.......--.....----------------IAIVGRPNVGKS.SLFN.RILGRRE..
gi|294102221|ref|YP_003554079.1|  -------.......--.....-------------RQFVFFGGKGGTGKT.TCAA.AYA----..
gi|294101356|ref|YP_003553214.1|  VNITHFY.......GE.....QGLYNSLNWSITHGSKTGLIGSNGTGKT.TLFK.IIMGLVE..
gi|294101345|ref|YP_003553203.1|  QDLSIGYgpkk...GT.....TLVAGPIATSLYEGELVCLIGPNGVGKT.TLLK.TLAGTQN..
gi|294102145|ref|YP_003554003.1|  -------.......--.....------------------------HGKT.TLVK.ALTGV--..
gi|294101756|ref|YP_003553614.1|  -------.......--.....------------------IVGRPNVGKS.SLLN.NILAYK-..
gi|294102549|ref|YP_003554407.1|  TRLTVSGd......RG.....KDVVKNLTLTVHRGEIVGIAGITGNGQS.ELEE.AISGLRF..
gi|294101372|ref|YP_003553230.1|  -------.......--.....-----NTGFLLREGIRVALVGRPNVGKS.SLLN.ALLKESR..
gi|294101016|ref|YP_003552874.1|  -------.......--.....----------------LFIWGGVGLGKT.HLMH.AIGHYVL..
gi|294101780|ref|YP_003553638.1|  -------.......--.....-----------------VITGPSGSGKS.SLA-.-------..
gi|294101686|ref|YP_003553544.1|  -------.......--.....------------SGGVVLLGGQPGIGKS.TLLL.QVCGAMA..
gi|294102507|ref|YP_003554365.1|  -------.......--.....--------------HNLLFIGSPGSGKT.MLAR.AIRGIVP..
gi|294101471|ref|YP_003553329.1|  -------.......SQ.....IVLFSHLSVSFKKGEVVGLVGPSGKGKT.TLGD.ILLGLIV..
gi|294101845|ref|YP_003553703.1|  -------.......--.....------------KGRFIAITGESGAGKS.SIVR.ALEFASGkr
gi|294101553|ref|YP_003553411.1|  -------.......--.....------------PPTLCMMVGLQGSGKT.TSAV.KIAKRI-..
gi|294101853|ref|YP_003553711.1|  -------.......--.....----------------LLVAGTTGSGKS.VFVNsCIAGLCY..
gi|294101780|ref|YP_003553638.1|  -------.......--.....-HNLKEIDVAIPSRVFSCISGVSGSGKS.SLLY.DVL----..
gi|294102079|ref|YP_003553937.1|  -------.......--.....---------------VVAIDGPAGAGKS.SVAK.KVAELLGld
gi|294101472|ref|YP_003553330.1|  ENLSILDe......EN.....KPLVRNVSFSIPSESVFFLVGETGSGKT.PIAQ.AIAGTLAkr
gi|294102235|ref|YP_003554093.1|  -------.......--.....----------------LALAGNPNTGKT.SLFN.LLTGSRQhv
gi|294102390|ref|YP_003554248.1|  -------.......--.....----------------------------.----.-------..
gi|294101443|ref|YP_003553301.1|  -------.......--.....----------------CVLYGPPGVGKT.TLVR.LMAMVTE..
gi|294101748|ref|YP_003553606.1|  -------.......--.....----------------------------.----.-------..
gi|294101649|ref|YP_003553507.1|  -------.......--.....----------------VILLGPPGAGKG.TQAA.EIKTKYKva
gi|294101715|ref|YP_003553573.1|  -------.......--.....----------------------------.----.-------..
gi|294101925|ref|YP_003553783.1|  -------.......--.....---------------HCAILGSTGSGKS.NTTV.SILRAILn.
gi|294101367|ref|YP_003553225.1|  EHLWVDM.......PG.....E-TVRDVSFTVKEGEIFGIGGLAGQGKL.GIAN.GIMGMYP..
gi|294101751|ref|YP_003553609.1|  -------.......--.....-----------RAHDIVFAIGPAGTGKT.YLA-.-------..
gi|294101046|ref|YP_003552904.1|  -------.......--.....---------------------PTGAGKT.LVAY.LWAGLLT..
gi|294101779|ref|YP_003553637.1|  -------.......--.....------------------LLGVTGSGKTfTVAN.VLAQFDR..
gi|294101226|ref|YP_003553084.1|  -------.......--.....------------------LIGNPNVGKS.VIFS.RLTGVRA..
gi|294101892|ref|YP_003553750.1|  -------.......--.....----------------VAFVGRSNVGKS.MLLN.ALMERKL..
gi|294102315|ref|YP_003554173.1|  -------.......--.....-----------------MIIGMTGSGKT.GLGI.ALLE---..
gi|294102188|ref|YP_003554046.1|  -------.......--.....----------------------------.----.-------..
gi|294102320|ref|YP_003554178.1|  -------.......--.....----------------------------.----.-------..
gi|294102169|ref|YP_003554027.1|  -------.......--.....----------------INIIGSPGAGKT.TLLE.A------..
gi|294101254|ref|YP_003553112.1|  -------.......RG.....IPVVKDLSIDVREREILGLAGIAGNGQQ.ELCE.ALAGLRP..
gi|294102077|ref|YP_003553935.1|  -------.......--.....---------------TVALTGYTNSGKS.TLLQ.QLSHGRN..
gi|294102510|ref|YP_003554368.1|  -------.......--.....---------------RLAVVGIPNVGKS.LFLN.LLVGKKRap
gi|294101748|ref|YP_003553606.1|  -------.......--.....----------------------------.----.-------..
gi|294101141|ref|YP_003552999.1|  -------.......--.....----------------------------.TLFS.ALLGFLR..
gi|294101018|ref|YP_003552876.1|  -------.......--.....----------------NLLVGNNGSGKT.NALE.AIHILSGwg
gi|294101692|ref|YP_003553550.1|  -------.......--.....----------------------------.----.-------..
gi|294101032|ref|YP_003552890.1|  -------.......--.....--------------------GKGGTGKT.CIAA.SLAL---..
gi|294101031|ref|YP_003552889.1|  -------.......--.....-------------KEIVIISGKGGTGKT.CIMA.ALCSS--..
gi|294101431|ref|YP_003553289.1|  -------.......--.....-------------TKVIVIAGPSGSGKT.TTAK.RLKIQLQ..
gi|294102167|ref|YP_003554025.1|  -------.......--.....----------------LGVTGDVGAGKS.TVSQ.-------..
gi|294101458|ref|YP_003553316.1|  -------.......--.....----------------------------.----.-------..
gi|294102320|ref|YP_003554178.1|  -------.......--.....---------------------VVGLGKT.YISA.MLAGQLD..
gi|294101940|ref|YP_003553798.1|  -------.......--.....----------VYPGEMLNLAGAQGSLKT.SLA-.-------..
gi|294102120|ref|YP_003553978.1|  -------.......--.....----------VEDGSSLILGGGTGVGKT.HLAI.AMIQELT..
gi|294101791|ref|YP_003553649.1|  -------.......--.....----------VYSGLTILLYGDLGAGKT.VLVK.GLG----..
gi|294102136|ref|YP_003553994.1|  -------.......--.....----------------------------.----.-------..
gi|294101830|ref|YP_003553688.1|  -------.......--.....---------------CLIITGMSGAGKS.TVLN.ILE----..
gi|294102042|ref|YP_003553900.1|  -------.......--.....----------------------------.----.-------..
gi|294102015|ref|YP_003553873.1|  -------.......--.....---------------ILAIIGPTAVGKT.KLSL.EIAETLK..
gi|294102787|ref|YP_003554645.1|  -------.......--.....--LLENMEGHFPAG-LSLILGDNESGKT.TLMS.FLR----..
gi|294102032|ref|YP_003553890.1|  -------.......--.....------------KGYNIFVLGNPGSGRT.S---.-------..
gi|294102010|ref|YP_003553868.1|  -------.......--.....--------------KAVAVTGALGSGKT.EWVL.NMALALL..
gi|294101586|ref|YP_003553444.1|  -------.......--.....---------------IFAVSGMKNSGKT.KLCL.LLLKYLK..
gi|294101458|ref|YP_003553316.1|  -------.......--.....----------------------------.----.-------..
gi|294102625|ref|YP_003554483.1|  -------.......--.....----------------------------.----.-------..
gi|294102478|ref|YP_003554336.1|  -------.......--.....----------------------------.----.-------..
gi|294101874|ref|YP_003553732.1|  -------.......--.....---------------VIAFVGPAGTGKS.QRAQ.YVATDNNvd
gi|294102071|ref|YP_003553929.1|  -------.......--.....----------------------------.----.-------..


                                                60             70                   80             9
                                                 |              |                    |              
d1g6ha_                             .........ADEGRVYFEN.....KDITNKEPAEL...........YHYGIVRTFQTP.....Q
gi|294102520|ref|YP_003554378.1|  .........----------.....-----------...........------------.....-
gi|294102529|ref|YP_003554387.1|  .........--------S-.....-----------...........------------.....-
gi|294102437|ref|YP_003554295.1|  .........----------.....-----------...........------------.....-
gi|294102168|ref|YP_003554026.1|  .........----------.....-----------...........------------.....-
gi|294101779|ref|YP_003553637.1|  .........PV--------.....-----------...........------------.....-
gi|294102457|ref|YP_003554315.1|  .........----------.....-----------...........------------.....-
gi|294101625|ref|YP_003553483.1|  .........----------.....-----------...........------------.....-
gi|294101185|ref|YP_003553043.1|  .........----------.....-----------...........------------.....-
gi|294102626|ref|YP_003554484.1|  .........----------.....-----------...........------------.....-
gi|294101765|ref|YP_003553623.1|  .........A---------.....-----------...........------------.....-
gi|294102479|ref|YP_003554337.1|  .........PSRGKVSVDG.....CDVRTLDLTEL...........RKQ-IGIVPQDP.....V
gi|294101904|ref|YP_003553762.1|  .........PTEGQVLIGG.....RDITHLAVN--...........-KRDIGFVFQNY.....A
gi|294102557|ref|YP_003554415.1|  .........PTEGDVFFGD.....RRVNDVAPN--...........-HRNATMVFQSY.....A
gi|294101807|ref|YP_003553665.1|  .........----------.....-----------...........------------.....-
gi|294101806|ref|YP_003553664.1|  .........----------.....-----------...........------------.....-
gi|294102649|ref|YP_003554507.1|  .........PSSGSICIGD.....TDITRLSTPELrk.........LRRRVGMIFQHF.....N
gi|294101185|ref|YP_003553043.1|  .........DSEDNMI---.....-----------...........------------.....-
gi|294102868|ref|YP_003554726.1|  .........PDEGSIILEG.....EDITHLPPE--...........-KRPTATVFQSY.....A
gi|294102500|ref|YP_003554358.1|  .........A---------.....-----------...........------------.....-
gi|294102409|ref|YP_003554267.1|  .........----------.....-----------...........------------.....-
gi|294102354|ref|YP_003554212.1|  .........----------.....-----------...........------------.....-
gi|294101565|ref|YP_003553423.1|  .........GSEDAMIRL-.....-----------...........------------.....-
gi|294101424|ref|YP_003553282.1|  .........INDGEIYLYG.....QRVDNGKHSNKev.........ATL-VGMIFQQF.....N
gi|294101976|ref|YP_003553834.1|  .........----------.....-----------...........------------.....-
gi|294101061|ref|YP_003552919.1|  .........PDSGQIWLHG.....EEVTHSKKSINv..........LRQKMGMVFQNF.....Y
gi|294101048|ref|YP_003552906.1|  .........PTSGEIWVNG.....QEVSSLPKKDLtef........RRKQIAMVFQHY.....G
gi|294101977|ref|YP_003553835.1|  .........----------.....-----------...........------------.....-
gi|294101084|ref|YP_003552942.1|  .........IDSGTITIAG.....VTVSRTGKEKEldksfleachhMRQEVGMVFQSF.....N
gi|294101565|ref|YP_003553423.1|  .........DGNIAEILRG.....KKIVQ------...........------------.....-
gi|294101786|ref|YP_003553644.1|  .........PTSGTVFFDG.....EDVLKFNKAKMkk.........MRSQMQIIFQDPya...S
gi|294101493|ref|YP_003553351.1|  .........PTEGHYYLDG.....TDVSTIDENQLadi........RKNTIGFVFQGF.....N
gi|294101884|ref|YP_003553742.1|  .........KK--------.....-----------...........------------.....-
gi|294101894|ref|YP_003553752.1|  .........----------.....-----------...........------------.....-
gi|294101778|ref|YP_003553636.1|  .........----------.....-----------...........------------.....-
gi|294102313|ref|YP_003554171.1|  .........PSEGSVVVID.....RNVENLSHKESaql........RNHHIGFIFQTY.....N
gi|294102640|ref|YP_003554498.1|  .........ATGGEVLFKG.....QDALKFNNAQKre.........FHKQAQIVFQDPfs...S
gi|294101376|ref|YP_003553234.1|  .........VYFTHI----.....-----------...........------------.....-
gi|294102641|ref|YP_003554499.1|  ......pgeITNGEIFFDG.....QDVMKMTEAEKrdi........RGSKIAMIFQDPmt...S
gi|294101359|ref|YP_003553217.1|  .........----------.....-----------...........------------.....-
gi|294102459|ref|YP_003554317.1|  .........VNHPDIILMV.....-----------...........------------.....-
gi|294101785|ref|YP_003553643.1|  ......pghIESGTILYKN.....KDILGMTSSEIrkv........RGEQVSMIFQDPmt...S
gi|294101376|ref|YP_003553234.1|  .........----------.....-----------...........------------.....-
gi|294102074|ref|YP_003553932.1|  .........----------.....-----------...........------------.....-
gi|294102442|ref|YP_003554300.1|  .........QTRGQVTVGD.....QNLRKLRASQLpy.........YRRYLGVVFQDF.....K
gi|294101577|ref|YP_003553435.1|  .........PDSGRVMIDS.....KDITPFPMFRR...........ARIGVGYLPQEA.....S
gi|294101171|ref|YP_003553029.1|  .........PDGGRILFDG.....EDITPLKTYEV...........IRKGIARTFQNL.....R
gi|294102413|ref|YP_003554271.1|  .........PTEGNIFFNE.....DNITGFPPNKV...........CESGIARTFQNI.....R
gi|294102187|ref|YP_003554045.1|  .........NRERIVTIED.....AAELSMQQDHV...........VR----------.....-
gi|294102332|ref|YP_003554190.1|  .........PTAGQMMLGD.....DVIYHDGWKVKdlral......RRDHIGFVFQAP.....Y
gi|294102831|ref|YP_003554689.1|  .........RLGYSV----.....-----------...........------------.....-
gi|294101321|ref|YP_003553179.1|  .........-TKGWSNFEA.....YDMIDKAPEER...........------------.....-
gi|294101626|ref|YP_003553484.1|  .........-TKGWSNFEA.....YDMIDKAPEER...........------------.....-
gi|294101069|ref|YP_003552927.1|  .........PQKGTITLED.....KNMRRMSGREI...........ARR-IGYVPQSS.....E
gi|294102759|ref|YP_003554617.1|  ........tEVSGAVIFDN.....LNLISLRPEMLnai........RWKDIALIPQGAmn...S
gi|294101055|ref|YP_003552913.1|  ......rgvTLSGQIRLDG.....EDTFTLSPEEV...........RRR-IGMVFQSP.....T
gi|294101254|ref|YP_003553112.1|  .........PDRGHILIDG.....KKVSFSSPKDA...........IAAGIGMVHQHF.....M
gi|294102760|ref|YP_003554618.1|  .........PTEGNVELFG.....ENIDKCSHSQLie.........LRRRCGYVPQDPyg...S
gi|294101659|ref|YP_003553517.1|  .........PSQGACFVYG.....MDTREEKNLWA...........IRSHVAMVFQNPd....N
gi|294101172|ref|YP_003553030.1|  .........REKGLINFSG.....APLAQRSYDVV...........-KQGISLVPEGR.....R
gi|294102017|ref|YP_003553875.1|  .........MAQMGAFIPA.....A----------...........-EASMGLM---D.....R
gi|294101748|ref|YP_003553606.1|  .........----------.....-----------...........------------.....-
gi|294102409|ref|YP_003554267.1|  .........----------.....-----------...........------------.....-
gi|294102070|ref|YP_003553928.1|  .........V-----LVS-.....-----------...........------------.....-
gi|294102390|ref|YP_003554248.1|  .........----------.....-----------...........------------.....-
gi|294101403|ref|YP_003553261.1|  .........----------.....-----------...........------------.....-
gi|294101730|ref|YP_003553588.1|  .........CTGQKQSV--.....-----------...........------------.....-
gi|294102602|ref|YP_003554460.1|  .........IFRKGAHIEE.....RVMDSNELER-...........-ERGIT------.....-
gi|294102663|ref|YP_003554521.1|  ......pnvKVEGDIYLEG.....KNIYSGATDVIa..........LRRQVGMVFQKP.....N
gi|294101436|ref|YP_003553294.1|  .........----------.....-----------...........------------.....-
gi|294102150|ref|YP_003554008.1|  .........-YTGTVEIRK.....MKAQLLDSLDL...........------------.....-
gi|294101607|ref|YP_003553465.1|  .........KAGYKVVAID.....ADIGLRNLD--...........----VVMGLENR.....V
gi|294102035|ref|YP_003553893.1|  .........----------.....-----------...........------------.....-
gi|294102412|ref|YP_003554270.1|  .........SAKGKILYTSnegveENILGKTPEFI...........VKKGIAMSPEGR.....R
gi|294101660|ref|YP_003553518.1|  .........PEKGEVIVEG.....FVSRPKSQDLRk..........IRRLVGLVFQYPeq...Q
gi|294102549|ref|YP_003554407.1|  .........PTAGKFKIDN.....KILTIKTPRDA...........MKYGIGMVHQHF.....M
gi|294102841|ref|YP_003554699.1|  .........PARGKIEVLG.....TTPDRA-----...........VTS-VGYVPQEGvrd..K
gi|294101272|ref|YP_003553130.1|  .........REYGTMEWIG.....EAVPHLGQI--...........----AAYMQQKD.....L
gi|294101433|ref|YP_003553291.1|  .........KKGFSVGILD.....ADITGPSVPKL...........M-----------.....-
gi|294101963|ref|YP_003553821.1|  .........----------.....-----------...........------------.....-
gi|294101356|ref|YP_003553214.1|  .........PTEGNISYGY.....-----------...........-NVKMGFFSQESaq...N
gi|294102542|ref|YP_003554400.1|  .........PTEGTVYFKK.....ERVETVSVNY-...........-RRSVTLLLQNT.....Y
gi|294101861|ref|YP_003553719.1|  .........----------.....-----------...........------------.....-
gi|294102400|ref|YP_003554258.1|  .........----------.....-----------...........----AGRLSQAP.....L
gi|294102043|ref|YP_003553901.1|  .........Q---------.....-----------...........------------.....-
gi|294101077|ref|YP_003552935.1|  .........PQKGDIIVKG.....KVIKNQKDLRY...........LRQTIGFLFQDPdd...Q
gi|294102348|ref|YP_003554206.1|  .........PVKGSISFLG.....EDITSWSITDR...........AKAGLTLAWQMP.....A
gi|294102040|ref|YP_003553898.1|  .........RQGKKVILGA.....ADTFRAAAI--...........------------.....-
gi|294101613|ref|YP_003553471.1|  .........EGSPNCLR--.....-----------...........ITRQSDLLFQGS.....I
gi|294101367|ref|YP_003553225.1|  ......etgGYEGKFFING.....QEAQFKSPFDA...........LDAGIGMVHQEF.....S
gi|294101893|ref|YP_003553751.1|  .........RRFVNFSLGG.....-----------...........------------.....-
gi|294101841|ref|YP_003553699.1|  .........KI------AG.....YPFTTLSPN--...........------------.....-
gi|294102070|ref|YP_003553928.1|  .........A---------.....-----------...........------------.....-
gi|294102221|ref|YP_003554079.1|  .........----------.....-----------...........------------.....-
gi|294101356|ref|YP_003553214.1|  .........PREGNVYFPK.....-----------...........-GIRIGYLSQDL.....V
gi|294101345|ref|YP_003553203.1|  .........PLGGEIRVLE.....SSLAELSHKKR...........AQL-LSFVISGR.....P
gi|294102145|ref|YP_003554003.1|  .........----------.....-----------...........------------.....-
gi|294101756|ref|YP_003553614.1|  .........----------.....-----------...........------------.....-
gi|294102549|ref|YP_003554407.1|  .........VKEGQLLMGK.....RDITHLPPLKR...........RKLGLAYIPEDRikt..G
gi|294101372|ref|YP_003553230.1|  .........----------.....-----------...........------------.....-
gi|294101016|ref|YP_003552874.1|  .........NKNNS-----.....-----------...........------------.....-
gi|294101780|ref|YP_003553638.1|  .........--FDTLYAEG.....QRRYVESLSAY...........ARQFLGIQKKPDvddisG
gi|294101686|ref|YP_003553544.1|  .........ARGERVLYIS.....GEESASQVALR...........ARR-LLALHNNL.....D
gi|294102507|ref|YP_003554365.1|  .........PLSHEELLES.....LQIHSSA----...........------------.....-
gi|294101471|ref|YP_003553329.1|  .........PDRGKVLWKG.....QDIRTLSKTK-...........-KKNLRPYFQKI.....H
gi|294101845|ref|YP_003553703.1|  .........AQSELIRAGE.....EEAEV------...........--IALFFCPRTL.....Q
gi|294101553|ref|YP_003553411.1|  .........----------.....-----------...........------------.....-
gi|294101853|ref|YP_003553711.1|  .........----------.....-----------...........------------.....-
gi|294101780|ref|YP_003553638.1|  .........-YKGMKRILD.....KDFRERAGKHLsidgaeq....FRN-VVLVDQSP.....I
gi|294102079|ref|YP_003553937.1|  ........yLDTGAI----.....-----------...........------------.....-
gi|294101472|ref|YP_003553330.1|  ........lSVCGKVFLKK.....QNLLSVKEKELkkl........WGRYLFLMPQEPst...A
gi|294102235|ref|YP_003554093.1|  gnwpgvtveRKEGHFSYEG.....MNFTLVDLPGI...........YSLGAASIDE--.....-
gi|294102390|ref|YP_003554248.1|  .........----------.....-----------...........------------.....-
gi|294101443|ref|YP_003553301.1|  .........----------.....-----------...........------------.....-
gi|294101748|ref|YP_003553606.1|  .........----------.....-----------...........------------.....-
gi|294101649|ref|YP_003553507.1|  ........hISTGDILRQN.....-----------...........------------.....-
gi|294101715|ref|YP_003553573.1|  .........----------.....-----------...........------------.....-
gi|294101925|ref|YP_003553783.1|  .........D---------.....-----------...........------------.....-
gi|294101367|ref|YP_003553225.1|  .........-SGGTVTFDE.....TPIILNDPRSP...........LSVGIASVSEDRrgv..G
gi|294101751|ref|YP_003553609.1|  .........----------.....-----------...........------------.....-
gi|294101046|ref|YP_003552904.1|  .........TEGKAQMPEG.....-----------...........------------.....-
gi|294101779|ref|YP_003553637.1|  .........PV--------.....-----------...........------------.....-
gi|294101226|ref|YP_003553084.1|  .........ISSN---YPG.....TTVGFLEGWLR...........YNS---------.....-
gi|294101892|ref|YP_003553750.1|  .........AHVGST----.....-----------...........------------.....-
gi|294102315|ref|YP_003554173.1|  .........----EALMDN.....IPVIAIDPKGD...........ITNLLLSFPEQRse...D
gi|294102188|ref|YP_003554046.1|  .........----------.....-----------...........------------.....-
gi|294102320|ref|YP_003554178.1|  .........----------.....-----------...........---------N--.....-
gi|294102169|ref|YP_003554027.1|  .........----------.....-----------...........------------.....-
gi|294101254|ref|YP_003553112.1|  .........LKEGRIMIDD.....EELTHQPPKQF...........IARGVRYIPADRkgt..G
gi|294102077|ref|YP_003553935.1|  .........LY--------.....-----------...........------------.....-
gi|294102510|ref|YP_003554368.1|  ...vggvpgITRGVSWYKG.....QDILAVD----...........------------.....-
gi|294101748|ref|YP_003553606.1|  .........----------.....-----------...........-----G------.....-
gi|294101141|ref|YP_003552999.1|  .........EFNVPALCMT.....ASLPINRLDQL...........REAGLKIFPESI.....A
gi|294101018|ref|YP_003552876.1|  .......pfRSSRKSFLVN.....-----WDTEEK...........QAYLRGYFSGET.....N
gi|294101692|ref|YP_003553550.1|  .........----------.....-----------...........------------.....-
gi|294101032|ref|YP_003552890.1|  .........----------.....-----------...........------------.....-
gi|294101031|ref|YP_003552889.1|  .........-FSGKAVFCD.....VDVDAPNLQ--...........----LLLNPQDE.....Q
gi|294101431|ref|YP_003553289.1|  .........----------.....-----------...........------------.....-
gi|294102167|ref|YP_003554025.1|  .........----------.....-----------...........------------.....-
gi|294101458|ref|YP_003553316.1|  .........----------.....-----------...........------------.....-
gi|294102320|ref|YP_003554178.1|  .........---------G.....R----------...........------------.....-
gi|294101940|ref|YP_003553798.1|  .........----------.....-----------...........------------.....-
gi|294102120|ref|YP_003553978.1|  .........AKGKSAVFVP.....V----------...........------------.....-
gi|294101791|ref|YP_003553649.1|  .........----------.....-----------...........------------.....-
gi|294102136|ref|YP_003553994.1|  .........----------.....-----------...........------------.....-
gi|294101830|ref|YP_003553688.1|  .........-DQGLFAVDN.....IPPAL------...........------------.....-
gi|294102042|ref|YP_003553900.1|  .........----------.....-----------...........------------.....-
gi|294102015|ref|YP_003553873.1|  .........--AEVISVDS.....RQV--------...........------------.....-
gi|294102787|ref|YP_003554645.1|  .........----------.....-----------...........------------.....-
gi|294102032|ref|YP_003553890.1|  .........----------.....-----------...........------------.....-
gi|294102010|ref|YP_003553868.1|  .........EAGEKVTIAD.....IDIINPYFC--...........------------.....-
gi|294101586|ref|YP_003553444.1|  .........----------.....-----------...........------------.....-
gi|294101458|ref|YP_003553316.1|  .........----------.....-----------...........------------.....-
gi|294102625|ref|YP_003554483.1|  .........----------.....-----------...........-WQNIGMVFDAP.....L
gi|294102478|ref|YP_003554336.1|  .........----------.....-----------...........------------.....-
gi|294101874|ref|YP_003553732.1|  .......yiIDDGLVIARG.....RIMTGKSAKSE...........------------.....-
gi|294102071|ref|YP_003553929.1|  .........----------.....-----------...........------------.....-


                                    0       100         110                                         
                                    |         |           |                                         
d1g6ha_                             PLKEMTVLENLLIGE.ICPGE.SPLN..SL..................................
gi|294102520|ref|YP_003554378.1|  ---------------.-----.----..--..................................
gi|294102529|ref|YP_003554387.1|  ---------------.-----.----..--..................................
gi|294102437|ref|YP_003554295.1|  ---------------.-----.----..--..................................
gi|294102168|ref|YP_003554026.1|  ---------------.-----.----..--..................................
gi|294101779|ref|YP_003553637.1|  ---------------.-----.----..--..................................
gi|294102457|ref|YP_003554315.1|  -----T---------.-----.----..--..................................
gi|294101625|ref|YP_003553483.1|  ---------------.-----.----..--..................................
gi|294101185|ref|YP_003553043.1|  ---------------.-----.----..--..................................
gi|294102626|ref|YP_003554484.1|  ---------------.-----.----..--..................................
gi|294101765|ref|YP_003553623.1|  ---------------.-----.----..--..................................
gi|294102479|ref|YP_003554337.1|  LMKG-SLAFNISYGF.PQA--.----..TE..................................
gi|294101904|ref|YP_003553762.1|  LFPHMSIFDNVAYGL.KVR--.----..--..................................
gi|294102557|ref|YP_003554415.1|  IFPHLNVYENIAFGL.RLK--.----..--..................................
gi|294101807|ref|YP_003553665.1|  -----T---------.-----.----..--..................................
gi|294101806|ref|YP_003553664.1|  ---------------.-----.----..--..................................
gi|294102649|ref|YP_003554507.1|  LLTSRTVFQNVAFPL.EIE--.----..--..................................
gi|294101185|ref|YP_003553043.1|  ---------------.-----.----..--..................................
gi|294102868|ref|YP_003554726.1|  LFPHMTVLQNVIYGL.KFK--.----..--..................................
gi|294102500|ref|YP_003554358.1|  ---------------.-----.----..--..................................
gi|294102409|ref|YP_003554267.1|  ---------------.-----.----..--..................................
gi|294102354|ref|YP_003554212.1|  ---------------.-----.----..--..................................
gi|294101565|ref|YP_003553423.1|  ---------------.-----.----..--..................................
gi|294101424|ref|YP_003553282.1|  LFPHLSVLDNITLCP.IQA--.----..--..................................
gi|294101976|ref|YP_003553834.1|  ---------------.-----.----..--..................................
gi|294101061|ref|YP_003552919.1|  LFDHLTALRNVEIAL.LKV--.----..--..................................
gi|294101048|ref|YP_003552906.1|  LLPHKTIIDNVEFGL.KLQ--.----..--..................................
gi|294101977|ref|YP_003553835.1|  ---------------.-----.----..--..................................
gi|294101084|ref|YP_003552942.1|  LFPHRTVLENVMLAP.MVV--.----..--..................................
gi|294101565|ref|YP_003553423.1|  ---------------.-----.----..--..................................
gi|294101786|ref|YP_003553644.1|  LNPRMTVSQSIAAPL.IIQ--.----..--..................................
gi|294101493|ref|YP_003553351.1|  LLPRMTALENVELPM.LYS--.----..--..................................
gi|294101884|ref|YP_003553742.1|  ---------------.-----.----..--..................................
gi|294101894|ref|YP_003553752.1|  ---------------.-----.----..--..................................
gi|294101778|ref|YP_003553636.1|  ---------------.-----.----..--..................................
gi|294102313|ref|YP_003554171.1|  LFPVYNVYENIEFPL.LLL--.----..--..................................
gi|294102640|ref|YP_003554498.1|  LNPRMSVSQLIAEPL.LIN--.----..--..................................
gi|294101376|ref|YP_003553234.1|  ---------------.-----.----..--..................................
gi|294102641|ref|YP_003554499.1|  LNPIMTVEEQIMEMI.SLH--.----..--..................................
gi|294101359|ref|YP_003553217.1|  ---------------.-----.----..--..................................
gi|294102459|ref|YP_003554317.1|  ---------------.-----.----..--..................................
gi|294101785|ref|YP_003553643.1|  LNPIMIVGDQIAEAI.KTH--.----..--..................................
gi|294101376|ref|YP_003553234.1|  ---------------.-----.----..--..................................
gi|294102074|ref|YP_003553932.1|  ---------------.-----.----..--..................................
gi|294102442|ref|YP_003554300.1|  LLPHLTAWENVAFVL.ESM--.----..--..................................
gi|294101577|ref|YP_003553435.1|  IFRNLTVKENIEIVL.QEL--.----..--..................................
gi|294101171|ref|YP_003553029.1|  LFPRSSVLENVMTAA.QQHEA.YSFVeaVT..................................
gi|294102413|ref|YP_003554271.1|  LFSNETVLQNVMIGC.HVRQK.SKWWmaPF..................................
gi|294102187|ref|YP_003554045.1|  ---------------.-----.----..--..................................
gi|294102332|ref|YP_003554190.1|  LIPFLDVTDNVALLP.MLA--.----..--..................................
gi|294102831|ref|YP_003554689.1|  ---------------.-----.----..--..................................
gi|294101321|ref|YP_003553179.1|  ---------------.-----.----..--..................................
gi|294101626|ref|YP_003553484.1|  ---------------.-----.----..--..................................
gi|294101069|ref|YP_003552927.1|  KVRL-TAFDAILLGR.RPY--.----..--..................................
gi|294102759|ref|YP_003554617.1|  FTPVLTIGKHIEEVL.AIH--.----..--..................................
gi|294101055|ref|YP_003552913.1|  PFPF-SIYDNMAYPL.RYY--.----..--..................................
gi|294101254|ref|YP_003553112.1|  LIPSQTVWENMILGL.EGL--.----..--..................................
gi|294102760|ref|YP_003554618.1|  LPPTLTVLDAVAEPW.IIV--.----..--..................................
gi|294101659|ref|YP_003553517.1|  QIVGTVVEDDTAFGP.ENI--.----..--..................................
gi|294101172|ref|YP_003553030.1|  VFAPLTVYENLMMGA.FPR--.----..--..................................
gi|294102017|ref|YP_003553875.1|  VFTRIGARDELSRGN.STF--.----..--..................................
gi|294101748|ref|YP_003553606.1|  ---------------.-----.----..--..................................
gi|294102409|ref|YP_003554267.1|  ---------------.-----.----..--..................................
gi|294102070|ref|YP_003553928.1|  ---------------.-----.----..--..................................
gi|294102390|ref|YP_003554248.1|  ---------------.-----.----..--..................................
gi|294101403|ref|YP_003553261.1|  ---------------.-----.----..--..................................
gi|294101730|ref|YP_003553588.1|  ---------------.-----.----..--..................................
gi|294102602|ref|YP_003554460.1|  ---------------.-----.----..--..................................
gi|294102663|ref|YP_003554521.1|  PFPM-AIYDNVAYGP.RLQ--.----..--..................................
gi|294101436|ref|YP_003553294.1|  ---------------.-----.----..--..................................
gi|294102150|ref|YP_003554008.1|  ---------------.-----.----..--..................................
gi|294101607|ref|YP_003553465.1|  VYNFIDVIEG-----.-----.----..--..................................
gi|294102035|ref|YP_003553893.1|  ---------------.-----.----..--..................................
gi|294102412|ref|YP_003554270.1|  ILPHLTVEENLLLGA.YIR--.----..--..................................
gi|294101660|ref|YP_003553518.1|  LFAE-TVFDEVAFAP.RNW--.----..--..................................
gi|294102549|ref|YP_003554407.1|  LVPSLPVYKNVVLGD.EPT--.----..--..................................
gi|294102841|ref|YP_003554699.1|  IFPV-SVFDVVLMGR.LGI--.----..--..................................
gi|294101272|ref|YP_003553130.1|  LLPWLSLMQNAMLPQ.VFS--.----..--..................................
gi|294101433|ref|YP_003553291.1|  ---------------.-----.----..--..................................
gi|294101963|ref|YP_003553821.1|  ---------------.-----.----..--..................................
gi|294101356|ref|YP_003553214.1|  LNYNRTIWEEISNTG.YLG--.----..--..................................
gi|294102542|ref|YP_003554400.1|  LLKR-AVWENVAFGL.KVR--.----..--..................................
gi|294101861|ref|YP_003553719.1|  ---------------.-----.----..--..................................
gi|294102400|ref|YP_003554258.1|  FIDDSSMLSTLEFRA.RAR--.----..--..................................
gi|294102043|ref|YP_003553901.1|  ---------------.-----.----..--..................................
gi|294101077|ref|YP_003552935.1|  LFCP-TLLDDVLFGP.LNG--.----..--..................................
gi|294102348|ref|YP_003554206.1|  RYEGISIRDYLRIGP.QNS--.----..--..................................
gi|294102040|ref|YP_003553898.1|  ---------------.-----.----..--..................................
gi|294101613|ref|YP_003553471.1|  SLPTATETEVSLCIR.EDPKI.CTIK..REfspetgtslfvdgmrirlqdlddvkrqwhmegeq
gi|294101367|ref|YP_003553225.1|  LIPGFTAAENIVLNR.ESTQYnFLVE..SF..................................
gi|294101893|ref|YP_003553751.1|  ---------------.-----.----..--..................................
gi|294101841|ref|YP_003553699.1|  ---------------.-----.----..--..................................
gi|294102070|ref|YP_003553928.1|  ---------------.-----.----..--..................................
gi|294102221|ref|YP_003554079.1|  ---------------.-----.----..--..................................
gi|294101356|ref|YP_003553214.1|  EIEDTVLLHYLKKQ-.-----.----..-Agialvekelrateediaraakneeeyhsllkrhd
gi|294101345|ref|YP_003553203.1|  AIQGFSVFELVALGR.HPY--.----..--..................................
gi|294102145|ref|YP_003554003.1|  ---------------.-----.----..--..................................
gi|294101756|ref|YP_003553614.1|  ---------------.-----.----..--..................................
gi|294102549|ref|YP_003554407.1|  LAPLASLKDNALLGY.QYK--.---P..PF..................................
gi|294101372|ref|YP_003553230.1|  ---------------.-----.----..--..................................
gi|294101016|ref|YP_003552874.1|  ---------------.-----.----..--..................................
gi|294101780|ref|YP_003553638.1|  LSPAISIEQKGTSHN.PRS--.----..-Tvgtvteiydylrllygrlgvpycpscgkavirys
gi|294101686|ref|YP_003553544.1|  LFCD-----------.-----.----..--..................................
gi|294102507|ref|YP_003554365.1|  ---------------.-----.----..--..................................
gi|294101471|ref|YP_003553329.1|  QDPGSSFPQNRLIRT.IFE--.-DFF..RW..................................
gi|294101845|ref|YP_003553703.1|  LPEEISSEEGNLFLK.RVF--.----..-Trngrgktfiqgklfplslfnevaapllriqsqfa
gi|294101553|ref|YP_003553411.1|  ---------------.-----.----..--..................................
gi|294101853|ref|YP_003553711.1|  ---------------.-----.----..--..................................
gi|294101780|ref|YP_003553638.1|  ---GRTPRSNPATYT.GLFTL.IREL..FAelpeskirgyapgrfsfnvrggrceacsgagsvk
gi|294102079|ref|YP_003553937.1|  ---------------.-----.----..--..................................
gi|294101472|ref|YP_003553330.1|  LNPLLSVFRQVREVF.QHL--.----..--..................................
gi|294102235|ref|YP_003554093.1|  ---------------.-----.----..--..................................
gi|294102390|ref|YP_003554248.1|  ---------------.-----.--IV..ST..................................
gi|294101443|ref|YP_003553301.1|  ---------------.-----.----..--..................................
gi|294101748|ref|YP_003553606.1|  ---------------.-----.----..--..................................
gi|294101649|ref|YP_003553507.1|  ---------------.-----.----..--..................................
gi|294101715|ref|YP_003553573.1|  ---------------.-----.----..--..................................
gi|294101925|ref|YP_003553783.1|  ---------------.-----.----..--..................................
gi|294101367|ref|YP_003553225.1|  LLLEEPISWNVIFTAlQMQQK.YLKP..VL..................................
gi|294101751|ref|YP_003553609.1|  ---------------.-----.----..--..................................
gi|294101046|ref|YP_003552904.1|  ---------------.-----.----..--..................................
gi|294101779|ref|YP_003553637.1|  ---------------.-----.----..--..................................
gi|294101226|ref|YP_003553084.1|  ---------------.-----.----..--..................................
gi|294101892|ref|YP_003553750.1|  ---------------.-----.----..--..................................
gi|294102315|ref|YP_003554173.1|  FLPWINIENATAEGF.PPS--.----..--..................................
gi|294102188|ref|YP_003554046.1|  ---------------.-----.----..--..................................
gi|294102320|ref|YP_003554178.1|  ---------------.-----.----..--..................................
gi|294102169|ref|YP_003554027.1|  ---------------.-----.----..--..................................
gi|294101254|ref|YP_003553112.1|  LVPNMDIKENSILKK.YWN--.----..KP..................................
gi|294102077|ref|YP_003553935.1|  ---------------.-----.----..--..................................
gi|294102510|ref|YP_003554368.1|  ---------------.-----.----..--..................................
gi|294101748|ref|YP_003553606.1|  ---------------.-----.----..--..................................
gi|294101141|ref|YP_003552999.1|  SFPD-----------.-----.----..--..................................
gi|294101018|ref|YP_003552876.1|  LDIVATVGEKNIIQC.DGK--.----..-Rithgnvrslipalaflpgdlaivdgapsvrrqfl
gi|294101692|ref|YP_003553550.1|  ---------------.-----.----..--..................................
gi|294101032|ref|YP_003552890.1|  ---------------.-----.----..--..................................
gi|294101031|ref|YP_003552889.1|  AFSF-----------.-----.----..--..................................
gi|294101431|ref|YP_003553289.1|  ---------------.-----.----..--..................................
gi|294102167|ref|YP_003554025.1|  ---------------.-----.----..--..................................
gi|294101458|ref|YP_003553316.1|  ---------------.-----.----..--..................................
gi|294102320|ref|YP_003554178.1|  ---------------.-----.----..--..................................
gi|294101940|ref|YP_003553798.1|  ---------------.-----.----..--..................................
gi|294102120|ref|YP_003553978.1|  ---------------.-----.----..--..................................
gi|294101791|ref|YP_003553649.1|  ---------------.-----.----..--..................................
gi|294102136|ref|YP_003553994.1|  ---------------.-----.----..--..................................
gi|294101830|ref|YP_003553688.1|  ---------------.-----.----..--..................................
gi|294102042|ref|YP_003553900.1|  ---------------.-----.----..--..................................
gi|294102015|ref|YP_003553873.1|  ---------------.-----.----..--..................................
gi|294102787|ref|YP_003554645.1|  ---------------.-----.----..--..................................
gi|294102032|ref|YP_003553890.1|  ---------------.-----.----..--..................................
gi|294102010|ref|YP_003553868.1|  ---------------.-----.----..--..................................
gi|294101586|ref|YP_003553444.1|  ---------------.-----.----..--..................................
gi|294101458|ref|YP_003553316.1|  ---------------.-----.----..--..................................
gi|294102625|ref|YP_003554483.1|  LPLAEEVLQRYRIPY.SIN--.----..--..................................
gi|294102478|ref|YP_003554336.1|  ---------------.-----.----..--..................................
gi|294101874|ref|YP_003553732.1|  ---------------.-----.----..--..................................
gi|294102071|ref|YP_003553929.1|  ---------------.-----.----..--..................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  fafigqgevaeaihhrpqqrrsilealfgidqyrkkredanqklkfaseelarletlvseltsr
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  hl..............................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ldeivdvifrnypdqrleilspqvrgkkgefknlfaqnrekgfmrvrvdgtiywleeeialdkn
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  qlelldsdrqrdildsyggeeiiclknelrsvfsnallkekelrsvekkqkevidryenansil
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  vsmlflpdvyvdcevcggtrynretlevrykgrniadvlnmtv.....................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  drlcallfplyvrkmsdcrralrhrvillrerkdpsltskvlaplvswiwstraaavdllkigi
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  rdeiaamvtiaekarrlldeldekrrgyyfsrraflerelysfqsrihalerrknraaewetiw
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  krhtievvidrlkvlddrkgriseaveaalslsggyvllvteggkeqlltenyacpdcgislpe
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  qsfksispesnseaiwegrlerisksidehtkleqilarltggktgegiadsienlcleltqii
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  qefrillpsdivltferggaldlqdpm.....................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  keglsfyqslfnsyeqqkkvheerteslgfqretlrrqcfataltvksarerliaqkeekrhve
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ieprlfsfnnpygacpdcsglgshehfseehaidpvrsveegallpwkkkhymlrklytfsqsk
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  spdtekgskyqelgnnalvflqklsqsltvllseqslsdlyaeqeeienklgtlrklkrlagvr
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  evlskvdeeatlargtsysltqnlhkkkeevsalwqklsnlrsslraerqrrqeygneyarveg
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ewdltqpygtlpknvqnfilygsderlpmffsdrgerhqymgryegllpwlegrwnetesenvl
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  tleeltnyckeaemnltwlnesyrrseqsgaeakklrreasrlalelrkkrertarsleeavnh
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ecvkilsrlqarsealdknekeleeaknkvfvaeketetykkefeythlsykkiierhgeiyvq
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  eelagyrvedicqtchgyrlrpealmvqlnhhtidelvempvdrllpvlkemeften.......
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  slrdmameditfsitlsdlgkikstgad....................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  cqrlatslsqlkknvdvlenqletvlenteqrlypepvrvilaaqklgklpiqiklaaeafkce
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  eklaapleaylggrqfwlfvksleeaqlgielvkqkragritflpleqchprnpdygfplpcqg
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  tvgwatdliaseqlwspavnhllgdlliveeydvgmnlaragasfpivtlqgdvftvggsvsgg
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  kfrktggaierrlqiedleknlkdkrgslervvsllqeaeelecviakerafwkekeqeaekkl
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lshsirferqreeivrlekersfflndvedsgkllkrtqhslkeleeaiasfgdfpdetelere
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lasakgeeavlcekvksgevlinrieseaaqlterlrslsgelentelsldegldrlrelgvqs
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  yelwenikeidserarlsaeteslvertsllrercaeahervqieeekvkdsqrqvdsarleln
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  qiislwedayhypgtenisleeyeeeslahvrrlekkvrelgdydlgvlseneslknrlafltv
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                          120       
                                                                                            |       
d1g6ha_                             ....................................................FYKKWIPKEEEM
gi|294102520|ref|YP_003554378.1|  ....................................................------------
gi|294102529|ref|YP_003554387.1|  ....................................................------------
gi|294102437|ref|YP_003554295.1|  ....................................................------------
gi|294102168|ref|YP_003554026.1|  ....................................................------------
gi|294101779|ref|YP_003553637.1|  ....................................................------------
gi|294102457|ref|YP_003554315.1|  ....................................................------------
gi|294101625|ref|YP_003553483.1|  ....................................................------------
gi|294101185|ref|YP_003553043.1|  ....................................................------------
gi|294102626|ref|YP_003554484.1|  ....................................................------------
gi|294101765|ref|YP_003553623.1|  ....................................................------------
gi|294102479|ref|YP_003554337.1|  ....................................................EDIVKAAQIAGI
gi|294101904|ref|YP_003553762.1|  ....................................................-----GLSRKEA
gi|294102557|ref|YP_003554415.1|  ....................................................-----KMEESKI
gi|294101807|ref|YP_003553665.1|  ....................................................------------
gi|294101806|ref|YP_003553664.1|  ....................................................------------
gi|294102649|ref|YP_003554507.1|  ....................................................-----KWETDAI
gi|294101185|ref|YP_003553043.1|  ....................................................------------
gi|294102868|ref|YP_003554726.1|  ....................................................-----KIDRKKA
gi|294102500|ref|YP_003554358.1|  ....................................................------------
gi|294102409|ref|YP_003554267.1|  ....................................................------------
gi|294102354|ref|YP_003554212.1|  ....................................................------------
gi|294101565|ref|YP_003553423.1|  ....................................................------------
gi|294101424|ref|YP_003553282.1|  ....................................................----KGMKKKEA
gi|294101976|ref|YP_003553834.1|  ....................................................------------
gi|294101061|ref|YP_003552919.1|  ....................................................----KGMDKKHA
gi|294101048|ref|YP_003552906.1|  ....................................................-----GISEKER
gi|294101977|ref|YP_003553835.1|  ....................................................------------
gi|294101084|ref|YP_003552942.1|  ....................................................----KKASEEEA
gi|294101565|ref|YP_003553423.1|  ....................................................------------
gi|294101786|ref|YP_003553644.1|  ....................................................-GVYKSSEKDKI
gi|294101493|ref|YP_003553351.1|  ....................................................-----GISARKR
gi|294101884|ref|YP_003553742.1|  ....................................................------------
gi|294101894|ref|YP_003553752.1|  ....................................................------------
gi|294101778|ref|YP_003553636.1|  ....................................................------------
gi|294102313|ref|YP_003554171.1|  ....................................................-----KIPQKER
gi|294102640|ref|YP_003554498.1|  ....................................................---KACGSRKEV
gi|294101376|ref|YP_003553234.1|  ....................................................------------
gi|294102641|ref|YP_003554499.1|  ....................................................----SDFKGEAV
gi|294101359|ref|YP_003553217.1|  ....................................................------------
gi|294102459|ref|YP_003554317.1|  ....................................................------------
gi|294101785|ref|YP_003553643.1|  ....................................................----MHVSSAKA
gi|294101376|ref|YP_003553234.1|  ....................................................------------
gi|294102074|ref|YP_003553932.1|  ....................................................------------
gi|294102442|ref|YP_003554300.1|  ....................................................-----GMPRRMV
gi|294101577|ref|YP_003553435.1|  ....................................................-----GKPQKEI
gi|294101171|ref|YP_003553029.1|  ....................................................HFGKWRMKETSI
gi|294102413|ref|YP_003554271.1|  ....................................................PVPSMIQEEKEI
gi|294102187|ref|YP_003554045.1|  ....................................................------------
gi|294102332|ref|YP_003554190.1|  ....................................................-----GKPNAEA
gi|294102831|ref|YP_003554689.1|  ....................................................------------
gi|294101321|ref|YP_003553179.1|  ....................................................------------
gi|294101626|ref|YP_003553484.1|  ....................................................------------
gi|294101069|ref|YP_003552927.1|  ....................................................---VGWRLAESD
gi|294102759|ref|YP_003554617.1|  ....................................................----LGLSGEAR
gi|294101055|ref|YP_003552913.1|  ....................................................-GYGSKKKSKNL
gi|294101254|ref|YP_003553112.1|  ....................................................---PQLLPKKEI
gi|294102760|ref|YP_003554618.1|  ....................................................---NGRKSRLEA
gi|294101659|ref|YP_003553517.1|  ....................................................-----GLSPLEI
gi|294101172|ref|YP_003553030.1|  ....................................................---KEPEKVKQD
gi|294102017|ref|YP_003553875.1|  ....................................................--------MVEM
gi|294101748|ref|YP_003553606.1|  ....................................................------------
gi|294102409|ref|YP_003554267.1|  ....................................................------------
gi|294102070|ref|YP_003553928.1|  ....................................................------------
gi|294102390|ref|YP_003554248.1|  ....................................................------------
gi|294101403|ref|YP_003553261.1|  ....................................................------------
gi|294101730|ref|YP_003553588.1|  ....................................................------------
gi|294102602|ref|YP_003554460.1|  ....................................................------------
gi|294102663|ref|YP_003554521.1|  ....................................................----GIKSREKL
gi|294101436|ref|YP_003553294.1|  ....................................................------------
gi|294102150|ref|YP_003554008.1|  ....................................................------------
gi|294101607|ref|YP_003553465.1|  ....................................................------------
gi|294102035|ref|YP_003553893.1|  ....................................................------------
gi|294102412|ref|YP_003554270.1|  ....................................................---DDKEGIEKD
gi|294101660|ref|YP_003553518.1|  ....................................................-----GVSEEDL
gi|294102549|ref|YP_003554407.1|  ....................................................-TRGLIFNHHGA
gi|294102841|ref|YP_003554699.1|  ....................................................--GRRKIFTEED
gi|294101272|ref|YP_003553130.1|  ....................................................-----KEKHLRK
gi|294101433|ref|YP_003553291.1|  ....................................................------------
gi|294101963|ref|YP_003553821.1|  ....................................................------------
gi|294101356|ref|YP_003553214.1|  ....................................................-----------T
gi|294102542|ref|YP_003554400.1|  ....................................................-----GVRGKEL
gi|294101861|ref|YP_003553719.1|  ....................................................------------
gi|294102400|ref|YP_003554258.1|  ....................................................------------
gi|294102043|ref|YP_003553901.1|  ....................................................------------
gi|294101077|ref|YP_003552935.1|  ....................................................-----GINKEEA
gi|294102348|ref|YP_003554206.1|  ....................................................-----------S
gi|294102040|ref|YP_003553898.1|  ....................................................------------
gi|294101613|ref|YP_003553471.1|  qiedvhggigelqsliqstdervgllfgealkntderfnslfqrlfgggeahLELEEGLSLWEA
gi|294101367|ref|YP_003553225.1|  ....................................................GDRLRTLNTEEM
gi|294101893|ref|YP_003553751.1|  ....................................................------------
gi|294101841|ref|YP_003553699.1|  ....................................................------------
gi|294102070|ref|YP_003553928.1|  ....................................................------------
gi|294102221|ref|YP_003554079.1|  ....................................................------------
gi|294101356|ref|YP_003553214.1|  ....................................................SHRYEQLGGYEF
gi|294101345|ref|YP_003553203.1|  ....................................................-TNWKGELEDRD
gi|294102145|ref|YP_003554003.1|  ....................................................------------
gi|294101756|ref|YP_003553614.1|  ....................................................------------
gi|294102549|ref|YP_003554407.1|  ....................................................LKRNFFQNFRSI
gi|294101372|ref|YP_003553230.1|  ....................................................------------
gi|294101016|ref|YP_003552874.1|  ....................................................------------
gi|294101780|ref|YP_003553638.1|  ....................................................EQKIMGQVMIEL
gi|294101686|ref|YP_003553544.1|  ....................................................------------
gi|294102507|ref|YP_003554365.1|  ....................................................------------
gi|294101471|ref|YP_003553329.1|  ....................................................GYHPALSSEKEW
gi|294101845|ref|YP_003553703.1|  ....................................................E-----------
gi|294101553|ref|YP_003553411.1|  ....................................................------------
gi|294101853|ref|YP_003553711.1|  ....................................................------------
gi|294101780|ref|YP_003553638.1|  ....................................................DDAFEFFKEIPR
gi|294102079|ref|YP_003553937.1|  ....................................................------------
gi|294101472|ref|YP_003553330.1|  ....................................................----RGMDRHTA
gi|294102235|ref|YP_003554093.1|  ....................................................------------
gi|294102390|ref|YP_003554248.1|  ....................................................TVIEVGVDVPQA
gi|294101443|ref|YP_003553301.1|  ....................................................------------
gi|294101748|ref|YP_003553606.1|  ....................................................------------
gi|294101649|ref|YP_003553507.1|  ....................................................------------
gi|294101715|ref|YP_003553573.1|  ....................................................------------
gi|294101925|ref|YP_003553783.1|  ....................................................------------
gi|294101367|ref|YP_003553225.1|  ....................................................GGLFKIRDEEAI
gi|294101751|ref|YP_003553609.1|  ....................................................------------
gi|294101046|ref|YP_003552904.1|  ....................................................------------
gi|294101779|ref|YP_003553637.1|  ....................................................------------
gi|294101226|ref|YP_003553084.1|  ....................................................------------
gi|294101892|ref|YP_003553750.1|  ....................................................------------
gi|294102315|ref|YP_003554173.1|  ....................................................------------
gi|294102188|ref|YP_003554046.1|  ....................................................------------
gi|294102320|ref|YP_003554178.1|  ....................................................------------
gi|294102169|ref|YP_003554027.1|  ....................................................------------
gi|294101254|ref|YP_003553112.1|  ....................................................VARGPMIDWKAV
gi|294102077|ref|YP_003553935.1|  ....................................................------------
gi|294102510|ref|YP_003554368.1|  ....................................................------------
gi|294101748|ref|YP_003553606.1|  ....................................................------------
gi|294101141|ref|YP_003552999.1|  ....................................................------------
gi|294101018|ref|YP_003552876.1|  ....................................................QDYWESVRKWRE
gi|294101692|ref|YP_003553550.1|  ....................................................------------
gi|294101032|ref|YP_003552890.1|  ....................................................------------
gi|294101031|ref|YP_003552889.1|  ....................................................------------
gi|294101431|ref|YP_003553289.1|  ....................................................------------
gi|294102167|ref|YP_003554025.1|  ....................................................------------
gi|294101458|ref|YP_003553316.1|  ....................................................------------
gi|294102320|ref|YP_003554178.1|  ....................................................------------
gi|294101940|ref|YP_003553798.1|  ....................................................------------
gi|294102120|ref|YP_003553978.1|  ....................................................------------
gi|294101791|ref|YP_003553649.1|  ....................................................------------
gi|294102136|ref|YP_003553994.1|  ....................................................------------
gi|294101830|ref|YP_003553688.1|  ....................................................------------
gi|294102042|ref|YP_003553900.1|  ....................................................------------
gi|294102015|ref|YP_003553873.1|  ....................................................------------
gi|294102787|ref|YP_003554645.1|  ....................................................------------
gi|294102032|ref|YP_003553890.1|  ....................................................------------
gi|294102010|ref|YP_003553868.1|  ....................................................------------
gi|294101586|ref|YP_003553444.1|  ....................................................------------
gi|294101458|ref|YP_003553316.1|  ....................................................--------K---
gi|294102625|ref|YP_003554483.1|  ....................................................------------
gi|294102478|ref|YP_003554336.1|  ....................................................------------
gi|294101874|ref|YP_003553732.1|  ....................................................------------
gi|294102071|ref|YP_003553929.1|  ....................................................------------


                                    130       140              150       160                170     
                                      |         |                |         |                  |     
d1g6ha_                             VEKAFKILEFLKLSH......LYDRKA.GELSGGQMKLVEIGRALMT.........NPK..MIV
gi|294102520|ref|YP_003554378.1|  ---------------......------.-------------------.........---..---
gi|294102529|ref|YP_003554387.1|  ---------------......------.-------------------.........---..---
gi|294102437|ref|YP_003554295.1|  ---------------......------.-------------------.........---..---
gi|294102168|ref|YP_003554026.1|  ---------------......------.-------------------.........---..---
gi|294101779|ref|YP_003553637.1|  ---------------......------.-------------------.........---..---
gi|294102457|ref|YP_003554315.1|  ---------------......------.-------------------.........---..---
gi|294101625|ref|YP_003553483.1|  ---------------......------.-------------------.........---..---
gi|294101185|ref|YP_003553043.1|  ---------------......------.-------------------.........---..---
gi|294102626|ref|YP_003554484.1|  -R-------------......------.-------------------.........---..---
gi|294101765|ref|YP_003553623.1|  ---------------......------.-------------------.........---..---
gi|294102479|ref|YP_003554337.1|  HTFITSLPE--GYDT......EVGERG.VTLSGGQRQRVAIARAIIR.........NPR..ILI
gi|294101904|ref|YP_003553762.1|  ELKVKEVLNLVGLIG......VDERFP.HQLSGGEQQRVALARVLVI.........DPR..VLL
gi|294102557|ref|YP_003554415.1|  REKMEGVIDLVGLTG......LESRQP.SQLSGGQQQRVALARAIIM.........EPA..LLL
gi|294101807|ref|YP_003553665.1|  ---------------......------.-------------------.........---..---
gi|294101806|ref|YP_003553664.1|  ---------------......------.-------------------.........---..---
gi|294102649|ref|YP_003554507.1|  SKRVTEVLDLVDLSD......KAQSYP.SQLSGGQKQRVGIARALAN.........NPS..LLL
gi|294101185|ref|YP_003553043.1|  ---------------......------.-------------------.........---..---
gi|294102868|ref|YP_003554726.1|  MQMGDEMLAKVGLPD......SASKSI.DQLSGGEQQRVALARSLVT.........EPK..VLL
gi|294102500|ref|YP_003554358.1|  ---------------......------.-------------------.........---..---
gi|294102409|ref|YP_003554267.1|  ---------------......------.-------------------.........---..---
gi|294102354|ref|YP_003554212.1|  ---------------......------.-------------------.........---..---
gi|294101565|ref|YP_003553423.1|  ---------------......------.-------------------.........---..---
gi|294101424|ref|YP_003553282.1|  EDLAIRLLERVGLGD......KVYAKP.SQLSGGQQQRVAIARALAM.........QPK..IML
gi|294101976|ref|YP_003553834.1|  -----------G---......------.-------------------.........---..---
gi|294101061|ref|YP_003552919.1|  REKAMLELERVGMAA......FADHYP.TQLSGGQAQRVSIARALAM.........DPD..VML
gi|294101048|ref|YP_003552906.1|  RERSNVALERVGLKG......WENYYP.SSLSGGMRQRVGIARALVM.........DTP..ILL
gi|294101977|ref|YP_003553835.1|  ---------------......------.-------------------.........---..---
gi|294101084|ref|YP_003552942.1|  HEIALRLLEKVGLSE......HAHKYP.ATLSGGQTQRGAIARALAM.........NPK..VML
gi|294101565|ref|YP_003553423.1|  ---------------......------.-------------------.........---..---
gi|294101786|ref|YP_003553644.1|  QKKVDQTMDLVGLAKr.....FANSYP.HELDGGRRQRIGIARALTL.........NPK..FIV
gi|294101493|ref|YP_003553351.1|  HERALHALQIVDLED......RANHQP.QQLSGGQQQRVAIARALAN.........DAP..LIL
gi|294101884|ref|YP_003553742.1|  ---------------......------.-------------------.........---..---
gi|294101894|ref|YP_003553752.1|  ---------------......------.-------------------.........---..---
gi|294101778|ref|YP_003553636.1|  ---------------......------.-------------------.........---..---
gi|294102313|ref|YP_003554171.1|  KEKIFDALEWLGLTD......KIDSRP.SQLSGGECQRVAVARAVVK.........RPE..LIL
gi|294102640|ref|YP_003554498.1|  DNKVKELMDTVGLAEr.....LTTSFP.HELDGGRRQRIGVARALAL.........DPE..FIV
gi|294101376|ref|YP_003553234.1|  ---------------......------.-------------------.........---..---
gi|294102641|ref|YP_003554499.1|  RKRAHEMLALVGIRPe.....RGKEYP.HQFSGGMRQRVGIAIALAC.........EPT..LLI
gi|294101359|ref|YP_003553217.1|  ---------------......------.-------------------.........GIK..IVV
gi|294102459|ref|YP_003554317.1|  ---------------......------.-------------------.........---..---
gi|294101785|ref|YP_003553643.1|  TKKASEMMELVGIDPv.....RMSDYP.HQFSGGMKQRVVIAMALAC.........NPK..VLI
gi|294101376|ref|YP_003553234.1|  ---------------......------.-------------------.........---..---
gi|294102074|ref|YP_003553932.1|  ---------------......------.-------------------.........---..---
gi|294102442|ref|YP_003554300.1|  QKRTNEVVDQVGLWR......RRFLYP.PQLSGGEQQRVAIARAMAN.........SPA..IFI
gi|294101577|ref|YP_003553435.1|  ETMVSHILEELGLTS......LASIPG.YALSGGERRRVEIARCLSI.........MPD..FLL
gi|294101171|ref|YP_003553029.1|  RDRSMELLNRVGLAD......RALQPA.GTLPYGYQRRLEIARALAL.........DPR..LLL
gi|294102413|ref|YP_003554271.1|  REKSMKLLQSVSLAQ......DANVLS.SSLPYGAQRRLEIARALAT.........DPS..FLL
gi|294102187|ref|YP_003554045.1|  ---------------......------.-------------------.........---..---
gi|294102332|ref|YP_003554190.1|  RQQAIELLKALDVEH......RAKAMP.SQLSGGEQQRVAIARGLVN.........RPP..VIL
gi|294102831|ref|YP_003554689.1|  ---------------......------.-------------------.........---..---
gi|294101321|ref|YP_003553179.1|  ---------------......------.-------------------.........---..---
gi|294101626|ref|YP_003553484.1|  ---------------......------.-------------------.........---..---
gi|294101069|ref|YP_003552927.1|  IKKVDAIIHTLGLDE......LALRYL.DEMSGGELQKVTIARALVQ.........EPR..ILL
gi|294102759|ref|YP_003554617.1|  RHRCRSLLEEADLEWs.....LANRYP.HELSGGQKQRAAIATALAC.........DPD..FLL
gi|294101055|ref|YP_003552913.1|  DVIIRNKLEDVGLFEevkd..SLSMNA.TLLSGGQQQRLCIARALAV.........EPE..ILL
gi|294101254|ref|YP_003553112.1|  HQQIIDISRQYGLEV......DPDAKI.WQLSIGEQQRVAILQMLYR.........KAQ..VLI
gi|294102760|ref|YP_003554618.1|  YSKARRLLKTLGIEEeri...LLSRVR.SGLSGGQRQRVSIARSLIL.........EPA..LLL
gi|294101659|ref|YP_003553517.1|  RQRVDWALSVTGLSH......KMQNPT.YSLSGGEKQRLAVAGALAL.........DPP..CLV
gi|294101172|ref|YP_003553030.1|  LQWVFSLFP--RLEE......RRDQYA.GTLSGGEQQMLAIGRALMS.........RPR..LLL
gi|294102017|ref|YP_003553875.1|  IETANILHN------......------.-----------------VT.........DRS..IVV
gi|294101748|ref|YP_003553606.1|  ---------------......------.-------------------.........---..---
gi|294102409|ref|YP_003554267.1|  ---------------......------.-------------------.........---..---
gi|294102070|ref|YP_003553928.1|  ---------------......------.-------------------.........---..---
gi|294102390|ref|YP_003554248.1|  ---------------......------.-------------------.........---..---
gi|294101403|ref|YP_003553261.1|  ---------------......------.-------------------.........---..---
gi|294101730|ref|YP_003553588.1|  ---------------......------.-------------------.........---..---
gi|294102602|ref|YP_003554460.1|  ---------------......------.-------------------.........---..---
gi|294102663|ref|YP_003554521.1|  DEIVKRSLIGAALWSevkd..NLKSSG.LGLSGGQQQRLCIARAIAT.........EPE..VLL
gi|294101436|ref|YP_003553294.1|  ---------------......------.-------------------.........---..---
gi|294102150|ref|YP_003554008.1|  ---------------......------.-------------------.........---..---
gi|294101607|ref|YP_003553465.1|  ---------------......------.-------------------.........---..---
gi|294102035|ref|YP_003553893.1|  ---------------......------.-------------------.........--D..IVI
gi|294102412|ref|YP_003554270.1|  MDHVYSLFP--RLRE......RAWQKG.GTLSGGEQQMLAVGRALMS.........RPD..LVM
gi|294101660|ref|YP_003553518.1|  EKVVNETLLEVGIPLd.....FLDRNP.FQLSGGEKRRIALASVLAA.........EPA..YLV
gi|294102549|ref|YP_003554407.1|  IEAVRHLSAQYGLNI......DPLAPV.HSLPVGIQQRVEILKLLYR.........KAE..ILI
gi|294102841|ref|YP_003554699.1|  KKIAMDVLEHMGLAG......RRNDPM.GDLSQGQRQRVLIARALAS.........RPR..ILL
gi|294101272|ref|YP_003553130.1|  NKKAKGLFERFGLNG......FEDYLP.GAVSGGMKQRCALIRTLMF.........ERE..IVL
gi|294101433|ref|YP_003553291.1|  ---------------......------.-------------------.........---..---
gi|294101963|ref|YP_003553821.1|  ---------------......------.-------------------.........---..---
gi|294101356|ref|YP_003553214.1|  DTEKRGLLGAFLFSGd.....DIYKLI.SVLSGGEKSRVALLKLLLE.........ETN..LLI
gi|294102542|ref|YP_003554400.1|  MKSMEEALYFVGLAPsq....FARRKW.YELSGGEAQRVALASRLAI.........KPE..VLL
gi|294101861|ref|YP_003553719.1|  ---------------......------.-------------------.........---..---
gi|294102400|ref|YP_003554258.1|  ---------------......------.-------------------.........---..---
gi|294102043|ref|YP_003553901.1|  ---------------......------.-------------------.........---..---
gi|294101077|ref|YP_003552935.1|  YEQAINVLKTLNIDN......LAHTPP.YALSGGQKRLGALAAVLAM.........KPD..LLL
gi|294102348|ref|YP_003554206.1|  ERNLEEAMDFVQMSPl.....FLDRAIdKSLSGGERKRIELASIYLM.........KPR..LAI
gi|294102040|ref|YP_003553898.1|  ---------------......------.-------------------.........---..---
gi|294101613|ref|YP_003553471.1|  GVDIFARPP-----G......KRLQNL.AQLSGGEQSLTAIALLFATmeva.....EVP..LAI
gi|294101367|ref|YP_003553225.1|  RQRGENAIEKLNVVI......SPDTLV.SEMPVGHKQFTEIAREIDKk........KTQ..LLV
gi|294101893|ref|YP_003553751.1|  ---------------......------.-------------------.........---..---
gi|294101841|ref|YP_003553699.1|  ---------------......------.-------------------.........---..---
gi|294102070|ref|YP_003553928.1|  ---------------......------.-------------------.........---..---
gi|294102221|ref|YP_003554079.1|  ---------------......------.-------------------.........---..---
gi|294101356|ref|YP_003553214.1|  AAMAQKVMKGLGFSDg.....DGQRYT.STFSGGWKMRISLAAMLLS.........SPD..ILL
gi|294101345|ref|YP_003553203.1|  IKAVEKALVEVNAWH......LSGRDF.AKLSDGESQRVLIARALAQ.........DTP..ILL
gi|294102145|ref|YP_003554003.1|  ---------------......------.-------------------.........---..---
gi|294101756|ref|YP_003553614.1|  ---------------......------.-------------------.........---..---
gi|294102549|ref|YP_003554407.1|  REFALHLMERYNIMAa.....SENIQA.GTLSGGNMQRLVMARELEQ.........QPD..FLL
gi|294101372|ref|YP_003553230.1|  ---------------......------.-------------------.........---..---
gi|294101016|ref|YP_003552874.1|  ---------------......------.-------------------.........---..---
gi|294101780|ref|YP_003553638.1|  EKRL-SFLVDVGVGYl.....SLMRRA.DTLSGGESQRIRLATQIGS.........KLSgvLYV
gi|294101686|ref|YP_003553544.1|  ---------------......------.-------------------.........---..---
gi|294102507|ref|YP_003554365.1|  ---------------......------.-------------------.........---..---
gi|294101471|ref|YP_003553329.1|  WNALGEGMEKASLSEr.....LLHRYP.CQLSGGELQRFALLRALLF.........SPL..FLV
gi|294101845|ref|YP_003553703.1|  --ISFLM-----ASGmm....PPGPVM.KIASGGELSRLLLALQLALpdsq.....LPG..TLV
gi|294101553|ref|YP_003553411.1|  ---------------......------.-------------------.........---..---
gi|294101853|ref|YP_003553711.1|  ---------------......------.-------------------.........---..---
gi|294101780|ref|YP_003553638.1|  IASKLALIQEAGLGYi.....RLGQSA.LTLSGGEAQRVKLAKELSKrft......GPT..LYL
gi|294102079|ref|YP_003553937.1|  ---------------......------.-------------------.........---..---
gi|294101472|ref|YP_003553330.1|  RTATQNLFSALGITQe.....ASRERP.GKLSGGMAQRALLAMALAS.........PAE..FIL
gi|294102235|ref|YP_003554093.1|  ---------------......------.-------------------.........---..---
gi|294102390|ref|YP_003554248.1|  TVMVIEDADRFGLSQ......LHQLRG.-------------------.........---..---
gi|294101443|ref|YP_003553301.1|  ---------------......------.-------------------.........---..---
gi|294101748|ref|YP_003553606.1|  ---------------......------.-------------------.........---..---
gi|294101649|ref|YP_003553507.1|  ---------------......------.-------------------.........---..---
gi|294101715|ref|YP_003553573.1|  ---------------......-IEQNL.STFSAHLKNIIHILS-EAT.........RSS..LVL
gi|294101925|ref|YP_003553783.1|  ---------------......------.-------------------.........---..---
gi|294101367|ref|YP_003553225.1|  REVTKKYIDTLEIKCt.....GDYQRV.QELSGGNQQKVCLAKAFAL.........HPK..LLF
gi|294101751|ref|YP_003553609.1|  ---------------......------.-------------------.........---..---
gi|294101046|ref|YP_003552904.1|  ---------------......------.-------------------.........---..---
gi|294101779|ref|YP_003553637.1|  ---------------......------.-------------------.........---..---
gi|294101226|ref|YP_003553084.1|  ---------------......------.-------------------.........---..---
gi|294101892|ref|YP_003553750.1|  ---------------......------.-------------------.........---..---
gi|294102315|ref|YP_003554173.1|  ---------------......------.-------------------.........---..---
gi|294102188|ref|YP_003554046.1|  ---I-----------......------.-------------------.........---..---
gi|294102320|ref|YP_003554178.1|  ---------------......------.-------------------.........---..---
gi|294102169|ref|YP_003554027.1|  ---------------......------.-------------------.........---..---
gi|294101254|ref|YP_003553112.1|  FSHAINLVKKYSVSTp.....SIETPV.KNLSGGNLQKLMLGRELCD.........APK..ALI
gi|294102077|ref|YP_003553935.1|  ---------------......------.-------------------.........---..---
gi|294102510|ref|YP_003554368.1|  ---------------......------.-------------------.........---..---
gi|294101748|ref|YP_003553606.1|  ---------------......------.-------------------.........---..---
gi|294101141|ref|YP_003552999.1|  ---------------......------.-------------------.........---..---
gi|294101018|ref|YP_003552876.1|  KEHITGVPQVGPQRDdmiittKGQSVS.IVMSRGQRRRTAVALMLAAgwaverklrRKP..LLI
gi|294101692|ref|YP_003553550.1|  ---------------......------.-------------------.........DFD..VLI
gi|294101032|ref|YP_003552890.1|  ---------------......------.-------------------.........---..---
gi|294101031|ref|YP_003552889.1|  ---------------......------.-------------------.........---..---
gi|294101431|ref|YP_003553289.1|  ---------------......------.-------------------.........---..---
gi|294102167|ref|YP_003554025.1|  ---------------......------.-------------------.........---..---
gi|294101458|ref|YP_003553316.1|  ---------------......------.-------------------.........---..---
gi|294102320|ref|YP_003554178.1|  ---------------......------.-------------------.........---..---
gi|294101940|ref|YP_003553798.1|  ---------------......------.-------------------.........---..---
gi|294102120|ref|YP_003553978.1|  ---------------......------.-------------------.........---..---
gi|294101791|ref|YP_003553649.1|  ---------------......------.-------------------.........---..---
gi|294102136|ref|YP_003553994.1|  ---------------......------.-------------------.........-TS..ILL
gi|294101830|ref|YP_003553688.1|  ---------------......------.-------------------.........---..---
gi|294102042|ref|YP_003553900.1|  ---------------......------.-------------------.........---..---
gi|294102015|ref|YP_003553873.1|  ---------------......------.-------------------.........---..---
gi|294102787|ref|YP_003554645.1|  ---------------......------.-------------------.........---..---
gi|294102032|ref|YP_003553890.1|  ---------------......------.-------------------.........---..---
gi|294102010|ref|YP_003553868.1|  ---------------......------.-------------------.........---..---
gi|294101586|ref|YP_003553444.1|  ---------------......------.-------------------.........---..---
gi|294101458|ref|YP_003553316.1|  ---------------......------.-------------------.........---..---
gi|294102625|ref|YP_003554483.1|  ---------------......---E--.-GLTVGQTALWDIA-----.........---..---
gi|294102478|ref|YP_003554336.1|  ---------------......------.-------------------.........---..---
gi|294101874|ref|YP_003553732.1|  ---------------......------.-------------------.........---..---
gi|294102071|ref|YP_003553929.1|  ---------------......------.---------------APLP.........DPQ..LIL


                                        180         190           200       210       220       230 
                                          |           |             |         |         |         | 
d1g6ha_                             MDEPIAGVAPGLAH..DIFNHVLELKAK....GITFLIIEHRLDIVLNYIDHLYVMFNGQIIAE
gi|294102520|ref|YP_003554378.1|  --------------..------------....--------------------------------
gi|294102529|ref|YP_003554387.1|  --------------..------------....--------------------------------
gi|294102437|ref|YP_003554295.1|  --------------..-LLKELHTLQEQgk..DRARLMISGSAHVVMP----------------
gi|294102168|ref|YP_003554026.1|  --------------..------------....--------------------------------
gi|294101779|ref|YP_003553637.1|  --------------..------------....--------------------------------
gi|294102457|ref|YP_003554315.1|  --------------..------------....--------------------------------
gi|294101625|ref|YP_003553483.1|  --------------..------------....--------------------------------
gi|294101185|ref|YP_003553043.1|  --------------..------------....--------------------------------
gi|294102626|ref|YP_003554484.1|  --------------..------------....--------------------------------
gi|294101765|ref|YP_003553623.1|  --------------..------------....--------------------------------
gi|294102479|ref|YP_003554337.1|  LDEATSSLDVAVES..QIQEAMEKAME-....GRTSFVIAHRLSTVRS-ADRILVLSKGHIVES
gi|294101904|ref|YP_003553762.1|  MDEPLSNLDAKLRI..YMRAEIRKIQKKl...GITCIHVTHDQKEALTIADRIVVLNKGKIEQV
gi|294102557|ref|YP_003554415.1|  FDEPLSNLDAKLRE..QMRIEIRHLQKRl...GITSVYVTHDQAEAMSISDRVVVMNKGRIEQV
gi|294101807|ref|YP_003553665.1|  --------------..------------....--------------------------------
gi|294101806|ref|YP_003553664.1|  --------------..------------....--------------------------------
gi|294102649|ref|YP_003554507.1|  CDEATSALDPKTTQ..SILALLDEINRKl...GITIVLVTHEMGVIRQICHRVAVLEHGQVVEL
gi|294101185|ref|YP_003553043.1|  --------------..------------....--------------------------------
gi|294102868|ref|YP_003554726.1|  LDEPLSNLDAKLRI..RMRREIRQLQKGi...GITAIYVTHDQEEALALSDRIVVMEKGEIIQI
gi|294102500|ref|YP_003554358.1|  --------------..------------....--------------------------------
gi|294102409|ref|YP_003554267.1|  --------------..------------....--------------------------------
gi|294102354|ref|YP_003554212.1|  --------------..------------....--------------------------------
gi|294101565|ref|YP_003553423.1|  --------------..------------....--------------------------------
gi|294101424|ref|YP_003553282.1|  FDEPTSALDPELVG..EVLEVIAQLAET....GMTMVIITHEMLFAKDVSDRIIFMADGNIVEQ
gi|294101976|ref|YP_003553834.1|  --------------..------------....--------------------------------
gi|294101061|ref|YP_003552919.1|  FDEPTSALDPELIG..EVLEVMRNLAKG....GMTMLVVTHEMGFACSVANEIMFMEEGRILES
gi|294101048|ref|YP_003552906.1|  MDEPFSGLDPLIRR..EMQDELIRLQKEl...KKTIFFVTHDLDEAMRMGDRMAVMKNGTIVQM
gi|294101977|ref|YP_003553835.1|  --------------..------------....--------------------------------
gi|294101084|ref|YP_003552942.1|  YDEPTSALDPELVG..EVLQVMKDLDNE....GMTQIIVTHQMRFARNASDYIVFMDGGEIVEM
gi|294101565|ref|YP_003553423.1|  --------------..------------....--------------------------------
gi|294101786|ref|YP_003553644.1|  CDEPVSALDVSIQA..QILNLIQDLQVQf...GLTYLFITHDLSVVKHLSTNIMVMYLGQVVEL
gi|294101493|ref|YP_003553351.1|  ADEPTGNLDSKTGI..DVMKLFVRLNVEs...GKTIIQVTHERDMALF-GSRIITVKDGTIVH-
gi|294101884|ref|YP_003553742.1|  --------------..------------....--------------------------------
gi|294101894|ref|YP_003553752.1|  --------------..------------....--------------------------------
gi|294101778|ref|YP_003553636.1|  --------------..------------....--------------------------------
gi|294102313|ref|YP_003554171.1|  ADEPTANLDSENSY..NILEMMVRLNKEl...ETTFIFATHDEKVMKY-LRRKIHLFDGRVA--
gi|294102640|ref|YP_003554498.1|  LDEPVSALDVCIQA..QILNLLGDLKKEr...GYTYLFISHNLSVVRYVSDEVAVMYLGQVVEK
gi|294101376|ref|YP_003553234.1|  --------------..------------....--------------------------------
gi|294102641|ref|YP_003554499.1|  ADEPTTALDVTIQA..QVLDLIKNLQKIv...NTSLLLITHDLGIVAEICDEVAIMYAGRLVEY
gi|294101359|ref|YP_003553217.1|  LDEGDHMLDLGFKE..ELEAILDSLPNC....QRVWLFSATMPAEIKNLAKRY-----------
gi|294102459|ref|YP_003554317.1|  --------------..------------....--------------------------------
gi|294101785|ref|YP_003553643.1|  ADEPTTALDVTIQA..QVLEMMNELKKKf...NMATILITHDLGIVAQTCEKAAVIYAGEIVEY
gi|294101376|ref|YP_003553234.1|  --------------..------------....--------------------------------
gi|294102074|ref|YP_003553932.1|  --------------..------------....--------------------------------
gi|294102442|ref|YP_003554300.1|  ADEPTGNLDIHTAE..DVMRLLVALNAA....GATVIMATHDQYLVDAYRQRVVELQEGRIVR-
gi|294101577|ref|YP_003553435.1|  LDEPFSGIDPIAVY..DIQQIILSLRAK....GYGILLTDHNVRDTLAITDRTYLIHQGEIVIE
gi|294101171|ref|YP_003553029.1|  LDEPAAGMNPEEVM..ALNELIKSIHMEf...QLAILVIEHHMDLVMEICPRIICMNFGAKIAE
gi|294102413|ref|YP_003554271.1|  LDEPAAGMNPLETV..DLMSFIRRIRDEf...NLTILLIEHDMKVVMGICEYIWVLDYGKLIAE
gi|294102187|ref|YP_003554045.1|  --------------..------------....--------------------------------
gi|294102332|ref|YP_003554190.1|  ADEPTAPLDSERAL..AVIRILNDMAQRf...ETAVIVVTHDEKIIPT-FKRIYHIRDGVTYE-
gi|294102831|ref|YP_003554689.1|  --------------..------------....--------------------------------
gi|294101321|ref|YP_003553179.1|  --------------..------------....--------------------------------
gi|294101626|ref|YP_003553484.1|  --------------..------------....--------------------------------
gi|294101069|ref|YP_003552927.1|  LDEPISSLDVKNQI..EIMETMKHIIKGh...GLSAVMSLHDLTMALRYGDRFVFMKKGEIRYI
gi|294102759|ref|YP_003554617.1|  ADEPTTALDVITQK..EIILTLERLARGr...NMGLLLVTHDLPLAVQICDAIAVMHEGEIVEE
gi|294101055|ref|YP_003552913.1|  LDEPCSSLDVKNTQ..NIEMMLRALCQ-....QYSIIIVTHNLFQARRISHRTFFILDGEIIEA
gi|294101254|ref|YP_003553112.1|  LDEPTAVLTPQEAL..RLFSTIQQMTAE....GHGIVFISHKLDEVLSLSDRISILRKGE----
gi|294102760|ref|YP_003554618.1|  CDEPTSMQDASTRS..EIIHVLNERVKE....GMAMVFVTHDLYLARGAAKRGIVLLEGECCEE
gi|294101659|ref|YP_003553517.1|  LDEPTAMLDPQGRR..DLLDVLKTLHAQ....GRTIIYITHRLEETVH-CDRALVLKSGKVQWD
gi|294101172|ref|YP_003553030.1|  LDEPSLGLAPIIIR..DIFKELRRINSE....GVTILLVEQNARQALLLSHRGYVLQTGSIIMA
gi|294102017|ref|YP_003553875.1|  LDEIGRGTSTYDGM..SIAWAVLEYLDHgcgsKPKVLFATHYHELVAL-E--------------
gi|294101748|ref|YP_003553606.1|  --------------..------------....--------------------------------
gi|294102409|ref|YP_003554267.1|  --------------..------------....----------------------------L---
gi|294102070|ref|YP_003553928.1|  --------------..------------....--------------------------------
gi|294102390|ref|YP_003554248.1|  --------------..------------....--------------------------------
gi|294101403|ref|YP_003553261.1|  --------------..------------....--------------------------------
gi|294101730|ref|YP_003553588.1|  --------------..------------....--------------------------------
gi|294102602|ref|YP_003554460.1|  --------------..------------....--------------------------------
gi|294102663|ref|YP_003554521.1|  MDEPTSALDPMATA..RIEELVRTLKE-....RYTVIIVTHNMQQAARISDYTAFFLMGELIEY
gi|294101436|ref|YP_003553294.1|  --------------..------------....--------------------------------
gi|294102150|ref|YP_003554008.1|  --------------..------------....--------------------------------
gi|294101607|ref|YP_003553465.1|  --------------..------------....--------------------------------
gi|294102035|ref|YP_003553893.1|  LDEINVALDYELVEldQVIDILKK----....--------------------------------
gi|294102412|ref|YP_003554270.1|  MDEPSLGLAPMLVK..EVFDIIREINAQ....GKTVLLVEQNAFAALKVAHHAYILEVGSIVLS
gi|294101660|ref|YP_003553518.1|  LDEPTAGLDATGRK..DLIKLLSKQKKK....GRGIIFVTHDLETALMSSDSILVLEGGREVVQ
gi|294102549|ref|YP_003554407.1|  FDEPTAVLSPREIE..GLFSIIREFRKA....GKTIIFIAHNLNEVLAVSDVITVMRKGKHIAT
gi|294102841|ref|YP_003554699.1|  MDEPLASIDPEARG..VLYEDLASFAG-....NVTIILVSHDLSVIANGATAV-----------
gi|294101272|ref|YP_003553130.1|  LDEPLSALDAITRR..SLQSLLLSLQKDf...KKTVLMITHDIDEALYLADTVLVLTQ------
gi|294101433|ref|YP_003553291.1|  --------------..------------....--------------------------------
gi|294101963|ref|YP_003553821.1|  --------------..------------....--------------------------------
gi|294101356|ref|YP_003553214.1|  LDEPTNHLDMRTRD..IFQQALTEYHG-....--TIIIVSHDRYFLDKLVSRVIEIREGKILEY
gi|294102542|ref|YP_003554400.1|  LDEPTASVDRVSAE..LIKQGVRMCREKw...GTTLVLVSHDVLWVKSLSDRHLILTEGEL---
gi|294101861|ref|YP_003553719.1|  --------------..------------....--------------------------------
gi|294102400|ref|YP_003554258.1|  --------------..------------....--------------------------------
gi|294102043|ref|YP_003553901.1|  --------------..------------....--------------------------------
gi|294101077|ref|YP_003552935.1|  LDEPSSGLDERAWQ..NLVDVLNQL---....DMALIIASHDIPFLEHVTRRGYELSSG-----
gi|294102348|ref|YP_003554206.1|  LDEPDSGVDLLALR..EVLGLLRLLADQ....GSGVMVITHREDVAAG-CDRSYLMCDGRIILE
gi|294102040|ref|YP_003553898.1|  --------------..------------....--------------------------------
gi|294101613|ref|YP_003553471.1|  LDEVDASLDEYNLL..RFIDLVSDYAM-....HMQILAMTHRRSTMER-ADVLY----------
gi|294101367|ref|YP_003553225.1|  LDEPTAVLTESEAE..ILLASMRKLAAL....GIAIVFISHRLHEVIDVCDKIVVLRDGQVVHE
gi|294101893|ref|YP_003553751.1|  --------------..------------....--------------------------------
gi|294101841|ref|YP_003553699.1|  --------------..------------....--------------------------------
gi|294102070|ref|YP_003553928.1|  --------------..------------....--------------------------------
gi|294102221|ref|YP_003554079.1|  --------------..------------....--------------------------------
gi|294101356|ref|YP_003553214.1|  LDEPTNHLDTESME..WLEDWLLNFNG-....--TLIAISHDRHFLDKICTSTAELSQGAIS--
gi|294101345|ref|YP_003553203.1|  LDEPTAFLDLPRKV..ELLSLLRQYAWKm...NKGVLMSVHDIDLALRFADRIWVMSPSHSFTV
gi|294102145|ref|YP_003554003.1|  --------------..------------....--------------------------------
gi|294101756|ref|YP_003553614.1|  --------------..------------....--------------------------------
gi|294102549|ref|YP_003554407.1|  VSQPTRGVDIGGIS..FIHDRLLSLRRA....GKAILMISADLDEILSLSDRIAVMNRGEIVAV
gi|294101372|ref|YP_003553230.1|  --------------..------------....--------------------------------
gi|294101016|ref|YP_003552874.1|  --------------..------------....--------------------------------
gi|294101780|ref|YP_003553638.1|  LDEPTIGLHSRDTD..RLLRTLRSIRDL....GNTVVVVEHDRETMLA-ADAIVEMGPG-----
gi|294101686|ref|YP_003553544.1|  --------------..------------....--------------------------------
gi|294102507|ref|YP_003554365.1|  --------------..------------....--------------------------------
gi|294101471|ref|YP_003553329.1|  ADEPTSRLDPSVQA..KVAHMLVEEAHVk...SIAVLFISHDEVLLNALCSRIIRL--------
gi|294101845|ref|YP_003553703.1|  FDEVEAGLGGKAAV..LAGYKLKQLAE-....KCRVILITHEATIAAL-AEQHFVV--------
gi|294101553|ref|YP_003553411.1|  --------------..------------....--------------------------------
gi|294101853|ref|YP_003553711.1|  --------------..------------....--------------------------------
gi|294101780|ref|YP_003553638.1|  LDEPTTGLFYTDVK..KLLHILHRIVDQ....GNTVVTIEHNLDVLLS-SDYIIDLG-------
gi|294102079|ref|YP_003553937.1|  --------------..------------....--------------------------------
gi|294101472|ref|YP_003553330.1|  LDEPTKGLDSSRKE..DATALVKGIINA....GKTLLCITHDFSLPKQIGGQTGVLFSGLLVES
gi|294102235|ref|YP_003554093.1|  --------------..------------....--------------------------------
gi|294102390|ref|YP_003554248.1|  --------------..------------....--------------------------------
gi|294101443|ref|YP_003553301.1|  --------------..------------....--------------------------------
gi|294101748|ref|YP_003553606.1|  --------------..-----VLQELNR....GGQVFFVSNRINRLKG----------------
gi|294101649|ref|YP_003553507.1|  --------------..------------....--------------------------------
gi|294101715|ref|YP_003553573.1|  LDELGAGTDPQEGA..ALGIALIDTLREk...KSITLATTHHN---------------------
gi|294101925|ref|YP_003553783.1|  --------------..------------....--------------------------------
gi|294101367|ref|YP_003553225.1|  VSEPTRGIDVGAKR..VVLDTLREYNQKr...GTTIVMISSELEELRSICDRIAIVNEGKIA--
gi|294101751|ref|YP_003553609.1|  --------------..------------....--------------------------------
gi|294101046|ref|YP_003552904.1|  --------------..------------....--------------------------------
gi|294101779|ref|YP_003553637.1|  --------------..------------....--------------------------------
gi|294101226|ref|YP_003553084.1|  --------------..------------....--------------------------------
gi|294101892|ref|YP_003553750.1|  --------------..------------....--------------------------------
gi|294102315|ref|YP_003554173.1|  --------------..------------....--------------------------------
gi|294102188|ref|YP_003554046.1|  --------------..------------....--------------------------------
gi|294102320|ref|YP_003554178.1|  --------------..------------....--------------------------------
gi|294102169|ref|YP_003554027.1|  --------------..------------....--------------------------------
gi|294101254|ref|YP_003553112.1|  AVHPTWGLDVAATQ..FVREQLLLERDR....GAAVFLVSEDLEELLSLSDRLAVIFKGEIMGI
gi|294102077|ref|YP_003553935.1|  --------------..------------....--------------------------------
gi|294102510|ref|YP_003554368.1|  --------------..------------....--------------------------------
gi|294101748|ref|YP_003553606.1|  --------------..------------....--------------------------------
gi|294101141|ref|YP_003552999.1|  --------------..------------....--------------------------------
gi|294101018|ref|YP_003552876.1|  LDEIAAELDDRGRN..ILIDALVE----....--------------------------------
gi|294101692|ref|YP_003553550.1|  CDEAHRMVDAA---..------------....--------------------------------
gi|294101032|ref|YP_003552890.1|  --------------..------------....--------------------------------
gi|294101031|ref|YP_003552889.1|  --------------..------------....--------------------------------
gi|294101431|ref|YP_003553289.1|  --------------..------------....--------------------------------
gi|294102167|ref|YP_003554025.1|  --------------..------------....--------------------------------
gi|294101458|ref|YP_003553316.1|  --------------..------N-----....--------------------------------
gi|294102320|ref|YP_003554178.1|  --------------..------------....--------------------------------
gi|294101940|ref|YP_003553798.1|  --------------..------------....--------------------------------
gi|294102120|ref|YP_003553978.1|  --------------..------------....--------------------------------
gi|294101791|ref|YP_003553649.1|  --------------..------------....--------------------------------
gi|294102136|ref|YP_003553994.1|  VDEIDATLHPSILY..KLLKLFEDYSNRy...KIQIICTSHSLSLIEF----------------
gi|294101830|ref|YP_003553688.1|  --------------..------------....--------------------------------
gi|294102042|ref|YP_003553900.1|  --------------..------------....-----V--------------------------
gi|294102015|ref|YP_003553873.1|  --------------..------------....--------------------------------
gi|294102787|ref|YP_003554645.1|  --------------..------------....--------------------------------
gi|294102032|ref|YP_003553890.1|  --------------..------------....--------------------------------
gi|294102010|ref|YP_003553868.1|  --------------..------------....--------------------------------
gi|294101586|ref|YP_003553444.1|  --------------..------------....--------------------------------
gi|294101458|ref|YP_003553316.1|  --------------..------------....--------------------------------
gi|294102625|ref|YP_003554483.1|  --------------..------------....--------------------------------
gi|294102478|ref|YP_003554336.1|  --------------..---------Q--....--------------------------------
gi|294101874|ref|YP_003553732.1|  --------------..------------....--------------------------------
gi|294102071|ref|YP_003553929.1|  VDE-----------..------------....--------------------------------


                                          240       250                                             
                                            |         |                                             
d1g6ha_                             GRGEEEIKN--------------vlsdpkvveiyige...........................
gi|294102520|ref|YP_003554378.1|  -----------------------ldnhlhqgnplnidprrvvfrrvidlneralryvnvglggk
gi|294102529|ref|YP_003554387.1|  -----------------------gfditvasevmailclsanikelkerlskivvgytyngtvv
gi|294102437|ref|YP_003554295.1|  -----------------------yhkildkadeqfrskdkkigttgrgigpcyvdkfnrcgiri
gi|294102168|ref|YP_003554026.1|  -----------------------lrrligtkgnimvvgdpdqsiygwrgadmtmilnfekdfpa
gi|294101779|ref|YP_003553637.1|  -----------------------lvlahnktlaaqlytefktffphnavhyfvsyydyyqpeay
gi|294102457|ref|YP_003554315.1|  -----------------------lvpyleaarelktkptqhsvqelrrigilpdiiicrshypi
gi|294101625|ref|YP_003553483.1|  -----------------------tgrnykmgethegsatmdwmeqerergitissaattciwrd
gi|294101185|ref|YP_003553043.1|  -----------------------vrgdvpeglkdrsifaldmgslvagakyrgefeerlkavln
gi|294102626|ref|YP_003554484.1|  -----------------------fkeilvdefqdtnplqdrliqavrshsqrlfivgdlkqsiy
gi|294101765|ref|YP_003553623.1|  -----------------------ltlnvttiedpverfheginqvevderagrtfevvlrsllr
gi|294102479|ref|YP_003554337.1|  GTHDELLEKGGIYRHLY------elqf.....................................
gi|294101904|ref|YP_003553762.1|  AAPFELYANPA------------tlfvadfigqanifkg.........................
gi|294102557|ref|YP_003554415.1|  GTPIELYARPS------------nsfvaafigkvnfmpak........................
gi|294101807|ref|YP_003553665.1|  -----------------------aaeylafeqdmhvvviltdltnycealreisaarkevpgrr
gi|294101806|ref|YP_003553664.1|  -----------------------aesdivvyvgcgergnemtdvllefpeledprsgeplmkrt
gi|294102649|ref|YP_003554507.1|  GAVKDVFMKP-------------qsktaref.................................
gi|294101185|ref|YP_003553043.1|  -----------------------ridmseymekfsvsrligappgyvgyeeggqlteavrrrpy
gi|294102868|ref|YP_003554726.1|  DTPRNIY----------------fhaqnsfvadfigrsniit......................
gi|294102500|ref|YP_003554358.1|  -----------------------pfvkveatkftevgyvgrdvdsmirdlvetavamvkrvkie
gi|294102409|ref|YP_003554267.1|  -----------------------dvhyvvkdgeiiivdeftgrlmfgrrysdglhqaieakekv
gi|294102354|ref|YP_003554212.1|  -----------------------sngdinrmgnvvdgntvadfgaeeqkrqisintalvtlern
gi|294101565|ref|YP_003553423.1|  -----------------------dmsefmerhevgkligappgyvgydeggklteairrrpysv
gi|294101424|ref|YP_003553282.1|  GSPQDIMVKP-------------ahprtqaf.................................
gi|294101976|ref|YP_003553834.1|  -----------------------ypgymysdlaeiyeragcvencqgsitqipiitmpdddmth
gi|294101061|ref|YP_003552919.1|  GSPDKLLNTPQY-----------ertrqf...................................
gi|294101048|ref|YP_003552906.1|  GAPAQILANP-------------adeyvarfvqdk.............................
gi|294101977|ref|YP_003553835.1|  -----------------------cnaeiiiyigcgergnemtevleefpelsdpfhnaplmerm
gi|294101084|ref|YP_003552942.1|  ADGDVLFETPQ------------nkrtkaf..................................
gi|294101565|ref|YP_003553423.1|  -----------------------lnignlvagtkyrgefeermrkllkelretgdviifideih
gi|294101786|ref|YP_003553644.1|  ADSKKLFKNP-------------vhpytktl.................................
gi|294101493|ref|YP_003553351.1|  -----------------------derv.....................................
gi|294101884|ref|YP_003553742.1|  -----------------------kktvgiiavdpsspfsggailadrirmqrhandpdvyirsm
gi|294101894|ref|YP_003553752.1|  -----------------------vpfamadattlteagyvgedvenilvrllqaadydiqaaer
gi|294101778|ref|YP_003553636.1|  -----------------------vpffsvsgsdfvemfvgvgaarvrdlfeqarkyqpciifid
gi|294102313|ref|YP_003554171.1|  -----------------------qde......................................
gi|294102640|ref|YP_003554498.1|  AGNTILFKD--------------plhpytqal................................
gi|294101376|ref|YP_003553234.1|  -----------------------sgpeiigkfygeseerlrnvfdeaqahapaiifideidaia
gi|294102641|ref|YP_003554499.1|  SDIRQLYSKP-------------mhpytqg..................................
gi|294101359|ref|YP_003553217.1|  -----------------------lktpvfislteegeahedithevylvptrhkeeglinvllw
gi|294102459|ref|YP_003554317.1|  -----------------------lliderpeevtdmarsvdgeiiastfdrpaeehlrvanlal
gi|294101785|ref|YP_003553643.1|  GTVHEIFKNMR------------hpyti....................................
gi|294101376|ref|YP_003553234.1|  -----------------------sgvnfipvkgpalmskyvgeserairevfkkakqaspsily
gi|294102074|ref|YP_003553932.1|  -----------------------dlvysiscttrqprdgerdgvdyrflseeefkklveekkfl
gi|294102442|ref|YP_003554300.1|  -----------------------deekg....................................
gi|294101577|ref|YP_003553435.1|  GSPDEVAQS--------------evarkfy..................................
gi|294101171|ref|YP_003553029.1|  GSPEEIQANSEVLKAYL------ge.......................................
gi|294102413|ref|YP_003554271.1|  GNPDEIQSNPRVIEAYL------ge.......................................
gi|294102187|ref|YP_003554045.1|  -----------------------mesrpvniegtgaitirmlvrnslrmrpdriivgecrgeea
gi|294102332|ref|YP_003554190.1|  -----------------------eegq.....................................
gi|294102831|ref|YP_003554689.1|  -----------------------lavdmdpqgnctsglgiearaievslydvllggasaqdalm
gi|294101321|ref|YP_003553179.1|  -----------------------ergitinishveyqtenrhyahidcpghadyiknmitgaaq
gi|294101626|ref|YP_003553484.1|  -----------------------ergitinishveyqtenrhyahidcpghadyiknmitgaaq
gi|294101069|ref|YP_003552927.1|  LARDEI-----------------s........................................
gi|294102759|ref|YP_003554617.1|  GAPADIVTKPRHR----------httq.....................................
gi|294101055|ref|YP_003552913.1|  GPTKDLFENP-------------.........................................
gi|294101254|ref|YP_003553112.1|  -----------------------kt.......................................
gi|294102760|ref|YP_003554618.1|  NSTEALLSAPKH-----------aytralv..................................
gi|294101659|ref|YP_003553517.1|  GTISELFRH--------------te.......................................
gi|294101172|ref|YP_003553030.1|  GTSEDLLNSADIRNAY-------lg.......................................
gi|294102017|ref|YP_003553875.1|  -----------------------dhlnglknlsmavhegergisflykvvdgpadrsygievar
gi|294101748|ref|YP_003553606.1|  -----------------------mraafkaseagkqvvvlvpttilaqqhyhtfrsrmagfpir
gi|294102409|ref|YP_003554267.1|  -----------------------rkegnvedldpskyqqlleeyrqicakerdevldkgglkii
gi|294102070|ref|YP_003553928.1|  -----------------------dipgttrdatdtviemkegkfrfidtaglrkksridsdiey
gi|294102390|ref|YP_003554248.1|  -----------------------avlallqaveggyqgafmapteilaqqhyyrlhsfleplgv
gi|294101403|ref|YP_003553261.1|  -----------------------lhgiaeaqkaggiaafidaehaldprlaaslgvdvqslyva
gi|294101730|ref|YP_003553588.1|  -----------------------epcndcpnclainggesldvieidgasnnsvdevrelkahv
gi|294102602|ref|YP_003554460.1|  -----------------------irakhctvewngyliniidtpghadfsgevervlstvdsvl
gi|294102663|ref|YP_003554521.1|  GKTPKLFTSP-------------g........................................
gi|294101436|ref|YP_003553294.1|  -----------------------gaevkpyasgktdpnramvsvpdprfehlvtifepkkqtpa
gi|294102150|ref|YP_003554008.1|  -----------------------erergitiklvpvrmsykskdgneyilnlidtpghvdftye
gi|294101607|ref|YP_003553465.1|  -----------------------tcrlpqalirdkrvdnlfllpaaqtrtkdavspdqmvelce
gi|294102035|ref|YP_003553893.1|  -----------------------rppfvevvltgrnppvalleyadlitemkeirhpfqkgitg
gi|294102412|ref|YP_003554270.1|  GPGEDLLKNPRVKEA--------yl.......................................
gi|294101660|ref|YP_003553518.1|  GAPGKIIEE--------------ls.......................................
gi|294102549|ref|YP_003554407.1|  LPRSE------------------at.......................................
gi|294102841|ref|YP_003554699.1|  -----------------------acv......................................
gi|294101272|ref|YP_003553130.1|  -----------------------apmkirdritlpsekprnldsseyiaik.............
gi|294101433|ref|YP_003553291.1|  -----------------------gvtdspygspqgiippassifdikvmsvnlllddptkpvvw
gi|294101963|ref|YP_003553821.1|  -----------------------tareaggitqhigastvtyegknivfldtpgheaftamrar
gi|294101356|ref|YP_003553214.1|  -----------------------pgnysyfiq................................
gi|294102542|ref|YP_003554400.1|  -----------------------stss.....................................
gi|294101861|ref|YP_003553719.1|  -----------------------gqlrvttgpalekagdiaailsnlepfdvlfideihrlpan
gi|294102400|ref|YP_003554258.1|  -----------------------rfksrfenlglivvdylqlmsfarridskqqevaeisralk
gi|294102043|ref|YP_003553901.1|  -----------------------kkkepvlwtrepggwvhgdfvrtlllekdlrhelselflfv
gi|294101077|ref|YP_003552935.1|  -----------------------.........................................
gi|294102348|ref|YP_003554206.1|  GSAAAVK----------------ry.......................................
gi|294102040|ref|YP_003553898.1|  -----------------------dqlkiwgertgsrviaqqqgsdsaavaydalqaarasgadv
gi|294101613|ref|YP_003553471.1|  -----------------------gvtmdepgls...............................
gi|294101367|ref|YP_003553225.1|  TTPA-------------------k........................................
gi|294101893|ref|YP_003553751.1|  -----------------------vrdeaeirghrrtyvgaqpgriiqkmrqagtknpimlmdei
gi|294101841|ref|YP_003553699.1|  -----------------------lgilavdddrivvadvpgliegahenkglgiyflrhiertr
gi|294102070|ref|YP_003553928.1|  -----------------------ivddmpgvtrdriygetewkgrqfyivdtggllvrdehplv
gi|294102221|ref|YP_003554079.1|  -----------------------yalsrlgiktlvvstdpahsladafnrpigldvipvaenlw
gi|294101356|ref|YP_003553214.1|  -----------------------lykg.....................................
gi|294101345|ref|YP_003553203.1|  GIPED------------------l........................................
gi|294102145|ref|YP_003554003.1|  -----------------------scdrlneekkrgitielgfaplklhdgrvvsivdvpghekf
gi|294101756|ref|YP_003553614.1|  -----------------------vsivsekpqttrnaihgiynepemqivftdtpgihrprhkl
gi|294102549|ref|YP_003554407.1|  LPRKE------------------asr......................................
gi|294101372|ref|YP_003553230.1|  -----------------------aivtaipgttrdlieevltyrgipirlvdtagigapgdeie
gi|294101016|ref|YP_003552874.1|  -----------------------lkvtyvssekfinefiqsiknnrtqefkskyrsvdillidd
gi|294101780|ref|YP_003553638.1|  -----------------------ageqgg...................................
gi|294101686|ref|YP_003553544.1|  -----------------------tdldgalshveghgfvvldsvqamrssledgwpgtpsqvra
gi|294102507|ref|YP_003554365.1|  -----------------------rpdykpsleppfhivhptastvaicgggaslrpgeislahr
gi|294101471|ref|YP_003553329.1|  -----------------------.........................................
gi|294101845|ref|YP_003553703.1|  -----------------------arqenksfikeiek...........................
gi|294101553|ref|YP_003553411.1|  -----------------------qnahnplvvacdlrrpaaieqlkvlaqqskvafygpsggtq
gi|294101853|ref|YP_003553711.1|  -----------------------crkpeelrllmidpkrvelsiyehlphmlakpvtspkkaiq
gi|294101780|ref|YP_003553638.1|  -----------------------peggmeggs................................
gi|294102079|ref|YP_003553937.1|  -----------------------yralafylnamgfepvespylteilskikvslsdgcvying
gi|294101472|ref|YP_003553330.1|  GDSQIVLQHPS------------hpytqgl..................................
gi|294102235|ref|YP_003554093.1|  -----------------------qvaseflikekpelaitvvdasnlerslylvvqmleagqpl
gi|294102390|ref|YP_003554248.1|  -----------------------rvgrggnqsycvllsnpttregverlkvmcattdgfkiaea
gi|294101443|ref|YP_003553301.1|  -----------------------rslleinavsakvselrdlveeaknlkilsgsaaiafvdei
gi|294101748|ref|YP_003553606.1|  -----------------------kyeelkimfpearismahgqmaekdlertmldfyngnldil
gi|294101649|ref|YP_003553507.1|  -----------------------vkektklgcqaqefmnggklvpdeiivgmmgerlkekdcek
gi|294101715|ref|YP_003553573.1|  -----------------------piksyalttphvetasmefnvetlaptyhllmgipgrsnai
gi|294101925|ref|YP_003553783.1|  -----------------------ydgsrvilidphgeyasafpsakvfrinapsnplyipfwlm
gi|294101367|ref|YP_003553225.1|  -----------------------gt.......................................
gi|294101751|ref|YP_003553609.1|  -----------------------vchgvamlkagaisrivlvrpaveageslgylpgdlrekve
gi|294101046|ref|YP_003552904.1|  -----------------------isriiftapikalsnerymdlrrmgfdvgietgdfkrneea
gi|294101779|ref|YP_003553637.1|  -----------------------lvlahnktlaaqlytefktffphnavhyfvsyydyyqpeay
gi|294101226|ref|YP_003553084.1|  -----------------------evyriidvpgaytldptneaeqvarrmvdegadlaiivlda
gi|294101892|ref|YP_003553750.1|  -----------------------pgktrsvnfykieaevdfflvdlpgygyaargfkekekwak
gi|294102315|ref|YP_003554173.1|  -----------------------eyaareaekwkkglagwgidgdrikkmresvsfsiytpgsn
gi|294102188|ref|YP_003554046.1|  -----------------------eslsdrfdyivvdlhrnfgditielaegcqriwlvtdcsct
gi|294102320|ref|YP_003554178.1|  -----------------------elnqlerqsqrnmgrfmkillvkrlessffafrntgqrfln
gi|294102169|ref|YP_003554027.1|  -----------------------tkkaasfrfaviegdiatsrdaerlsklgvpaiqinthggc
gi|294101254|ref|YP_003553112.1|  LDH--------------------pe.......................................
gi|294102077|ref|YP_003553935.1|  -----------------------vadqlfstldtyvrkvelsdghdvlvsdtvgfirdlppali
gi|294102510|ref|YP_003554368.1|  -----------------------spgildprshnevhrrl........................
gi|294101748|ref|YP_003553606.1|  -----------------------ilatspggllspfltgegvfplrremgeergrllrwlevag
gi|294101141|ref|YP_003552999.1|  -----------------------lkekasamryrvkqckkeealeealkaykngekvlwvvntv
gi|294101018|ref|YP_003552876.1|  -----------------------sswqvfaata...............................
gi|294101692|ref|YP_003553550.1|  -----------------------rsissvrvswedlvrllrskgaataesflsnreeeqgvlrd
gi|294101032|ref|YP_003552890.1|  -----------------------slskgtaidldvdepdlglvlqiknpkkenvykvvpqieaa
gi|294101031|ref|YP_003552889.1|  -----------------------tgrkipeidterctvcggcvgfcrfnalekanngitllpwk
gi|294101431|ref|YP_003553289.1|  -----------------------vcglnptvisldnyfvdrektpldeqgnydfevleaidldl
gi|294102167|ref|YP_003554025.1|  -----------------------iwkslgatiidadalaheawkdttvlrraserwgtqvllgn
gi|294101458|ref|YP_003553316.1|  -----------------------nrtsggiifttiqkfapftnetngevidfnrwgrvaenssp
gi|294102320|ref|YP_003554178.1|  -----------------------tlviappvllektnpgswpnvfsdfrvpadyesigrldnli
gi|294101940|ref|YP_003553798.1|  -----------------------lhgavnflqgnperrvlffsldmskeettqrlfmrelevst
gi|294102120|ref|YP_003553978.1|  -----------------------veildeiragfdegtaykiqqavkdadcvaiddlgaqrkdk
gi|294101791|ref|YP_003553649.1|  -----------------------dglgargvrspsftlineyegrlplahvdlyrlergdeyel
gi|294102136|ref|YP_003553994.1|  -----------------------alarkynviylldn...........................
gi|294101830|ref|YP_003553688.1|  -----------------------lpqllellsqhraavqeglaavvdvrggrllndlfsvvdsl
gi|294102042|ref|YP_003553900.1|  -----------------------viqsadtlllpaansmlkiveeppehgvilfllendkflpt
gi|294102015|ref|YP_003553873.1|  -----------------------yrymnvgtdkvtfqtrqhilhhmldvvdpdevfsaadfvdk
gi|294102787|ref|YP_003554645.1|  -----------------------yslfgcpdgrssrnlyapphggkqkgsliieslkgerfslv
gi|294102032|ref|YP_003553890.1|  -----------------------yslqrlhesakekpapddwiyaynfsdpsrplainlpagkg
gi|294102010|ref|YP_003553868.1|  -----------------------irqvsdvlekkglsvitmpeqakwldmslvtpkvdwalhde
gi|294101586|ref|YP_003553444.1|  -----------------------eagihvgyikhshekvlspmdtdtgkvlsqgipalywgvdg
gi|294101458|ref|YP_003553316.1|  -----------------------erlkskwarleaivgteqrikqiakdivehfekrdlaqene
gi|294102625|ref|YP_003554483.1|  -----------------------rriwnagehgwplgetwdilrepclagreiatsppadiftl
gi|294102478|ref|YP_003554336.1|  -----------------------khnvelivaddafqhrrlgrdvdivlvdaccpfgngrlvpa
gi|294101874|ref|YP_003553732.1|  -----------------------knlvrairralfefpehreevvsflekqapctvmiiatsta
gi|294102071|ref|YP_003553929.1|  -----------------------esspayrmqaapllhi.........................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  tngvpresgfditvasevmailclsesikelkerlaqivvaytydgtavtagdlnaqgsmavvl
gi|294102529|ref|YP_003554387.1|  tagdlnahgsmaallkdalkpnlvqtlehvpafvhggpfaniahgcnslqatkyglkladyfit
gi|294102437|ref|YP_003554295.1|  edlfdpdilreklsfnlelknllltkvynaepvafddiyaqarawgkalepyvadvslalream
gi|294102168|ref|YP_003554026.1|  akvvvldqnyrstgnilkaanaviisnerrrkknlwtardmgekiyvllapneyqeadfilsem
gi|294101779|ref|YP_003553637.1|  ipssdtyiekdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavge
gi|294102457|ref|YP_003554315.1|  cdemkekialfcnvpkeaviealdeptiyqvplslqaqefdrlvmrllsf..............
gi|294101625|ref|YP_003553483.1|  cfvniidtpghvdftveversmrvldgavavfcavggvepqsetvwrqadkyhvpriafvnkmd
gi|294101185|ref|YP_003553043.1|  eiktsegriilfidelhtivgagaaegaidagnmlkpmlargelhcigattideyrkriekdaa
gi|294102626|ref|YP_003554484.1|  rfrhadlslfgsyikkakyghgdyilldtsfrskeilvhevndlfssvwkdglgqelplpfesl
gi|294101765|ref|YP_003553623.1|  qdpdiilvgeirdsetahlvmraaltghlvlstlhtddaanaplrliemgvppflivsslkavv
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  gypgylytdlatmyeragrlkgkkgsitqipiltmpeddkthpipdltgyitegqiilsrglhr
gi|294101806|ref|YP_003553664.1|  vliantsnmpvaareasiytaitmaeyyrdmgysvalmadstsrwaealremsgrleempgeeg
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  svilfdeiekahhdvfnvllqilddgrvtdsqghvvdfkntviimtsnigaplllegitgdgqi
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  evqgpaeeraewrlvdallprperktsmpdfmkifsgkeaeetppqeedtirestrnkvyallk
gi|294102409|ref|YP_003554267.1|  rvgresqtlatitlqnyfrmyrklagmtgtavteseefkeiygldvivvptn............
gi|294102354|ref|YP_003554212.1|  gkrlylldtpgfadfigemrsamrvsdsalavvsglhgvevqtgkayeyaedfsipvafvvskl
gi|294101565|ref|YP_003553423.1|  vlfdeiekahedvfnillqiledgrltdgqghtvdfrnaviimtsnigakdwvkgtslgfsisg
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  pvvdlsgyitegqivldrgihdrgayppinvlpslsrlmnk.......................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  vliantsnmpvaareasvylgmtlaeyfrdmgyntaimadstsrwaealreiggrleempgeeg
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  siigaggaegavdaanilkpslsrgefqvigattldeyrkyiekdaalerrfqpvmveepsvdd
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  gtrgslggvsrstreavkildacgkdvviietvgvgqseidivkladtvclvlvpgmgddiqim
gi|294101894|ref|YP_003553752.1|  giiyideldkitrksesasitrdvsgegvqqallkilegtlsnvppkggrkhpyqdfiqmdtsn
gi|294101778|ref|YP_003553636.1|  emdavgrhrgaglggghdereqtlnqllveldgfdestgiiliaatnrpdildpallrpgrfdr
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  pkreemggekqverrvvaqllalmdglesrgqvivigatnipntldpalrrpgrfdreisipip
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ekpsraivfchtraetveltrrlhdenfqamclhgemsqrernmalsqfrsgrtpllvatnvaa
gi|294102459|ref|YP_003554317.1|  ekakrlvetgkdvvllldsitrlarasnlvvppsgrtlsggmdpaalyfpkrffgaarnieegg
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  fdeieslvpirgrdsgagasftervisqflaemsgieelkgvtvlattnridlidpallssgrf
gi|294102074|ref|YP_003553932.1|  ewavvhehlygtlksdvekvleagvdvvleidvqgalqvknafddsvlifimppskeelerrlr
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  fdmlqamntghdgslttlhansprdvlsrlesmvlmagmelpvraireqissgidlivhqerlk
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  atswqgvsllpatidlagaevelasvisretclrrhmanlnqfdvaiidcppslglltinalva
gi|294101321|ref|YP_003553179.1|  mdgailvvsaadgpmpqtrehvllarqvnvpavvvfmnktdqvdddelldlvemeirellskyd
gi|294101626|ref|YP_003553484.1|  mdgailvvsaadgpmpqtrehvllarqvnvpavvvfmnktdqvdddelldlvemeirellskyd
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  lagippavlkrafhlletfe............................................
gi|294101748|ref|YP_003553606.1|  vevlsrfvstsrqkriledtkkglvdiligtqrllqkdiefkdlglliideehrfgvmhkeklk
gi|294102409|ref|YP_003554267.1|  gterhesrridnqlrgrsgrqgdpgssrfylsleddllrlfgseriqgimeklgmeegeai...
gi|294102070|ref|YP_003553928.1|  ysfvrtlqavdrsdvallvmdasepttdqdkkmaaqviekgkglillinkwdtleaadklgdem
gi|294102390|ref|YP_003554248.1|  svvlligslknrareltlqkistgeahvvvgthalfsdpvtfsnlgfavideqhrfgvlqknal
gi|294101403|ref|YP_003553261.1|  qpdsgeqalyvldtlvrsgavdlvvvdsvaaltpqaeidgkigdsqlglqarlmsyalrrltsa
gi|294101730|ref|YP_003553588.1|  slsafsslykvyiidevhmlslsafnallktleeppshvvfilattephkvpvtirsrcqhipf
gi|294102602|ref|YP_003554460.1|  llvdanegpmpqtryvlmralamglrpivfinkvdrphanpmsalnqtfdlfielgaaeeqldf
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  tvefvdlaglsrdaskgaglgnaflsfvaesdalvhvvrtfdnpevphpednidpardwnivem
gi|294102150|ref|YP_003554008.1|  vsrsiascegallvvdasqgveaqtvanaymavdqgleiipvinkidlpsahpesvqkeieevv
gi|294101607|ref|YP_003553465.1|  mlkkegfdfilldspagieggfknaaagatealvvttpeipsvrdadriigllesmekkpirlv
gi|294102035|ref|YP_003553893.1|  rrgiey..........................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  rgpiiasvikqfwedvawdktdfiivdlppgtadapltvmqtidldgflvvtspqelsvmvvek
gi|294101963|ref|YP_003553821.1|  gaqatdiailvvaaddglmpqtkeainharaagvpivvavnkidkpaarpdrvrqqlsdvglvp
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  veeilypsmedfslhiivgkgplannicltlppftlvgattrlglltsplrarfgiveqlalyn
gi|294102400|ref|YP_003554258.1|  gvareldvpvialsqlsraveqrnekmpqlsdlrdsgaieqdadlvmllyrpgyydtaaspeee
gi|294102043|ref|YP_003553901.1|  idrcehvsqvispalscgqivlcerytdstrayqiwgrglpeekvedlfawcsfpepdltlwid
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  liidtagrlhskhnlmeeltkivrvierevgrdsmenllvldavmgqngfaqaesfhkalslng
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  dkigqdfrgdpasallevldpaqnsnftdhyiesafdlsnvifittanvthtipaplldrmevi
gi|294101841|ref|YP_003553699.1|  vlihvldlsvgtpedvlyqwevicsefkaykesllerpymvvgnkidierghenapaiesfmka
gi|294102070|ref|YP_003553928.1|  egirkqatlaieeshvilfvidgfngpnwmdedvahilrrsgkpvivvanklddgihedrvyda
gi|294102221|ref|YP_003554079.1|  gieidaeeeakkymkaiqdkmlhivsaviveeikrqieiaymspgaeeaaifdkfielmesign
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  irqmvagasgidavmlvvaadegvmpqtrehlailnllgvhdgviviskadlvdeellelaiad
gi|294101756|ref|YP_003553614.1|  gealvkaavrslenadlilyvvevddisispeddriieilqevstpiflvvnkidqvqqserrl
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  amgiaraekammeadvriwvidgsepltpadlalvqkisatnhivtinkadlplviseemingl
gi|294101016|ref|YP_003552874.1|  iqflgnkgssqeeffhtfnqlhvskkqivicsdrppkeiqniedrlvsrfewglvtdiqmpdle
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  vaqqcidsakktgipfvvvghitkegriagpmllehmvdavllfsgedtsayrmirgtknrygn
gi|294102507|ref|YP_003554365.1|  gilfldeftefrrdllealrqpledgsivvsraagrvefpcrvlllaacnpcpcgwagdpvesc
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  dvikvakealayaedhlndviifdtagrlhvdedlmeelsrlkdlvnpheillvvdamtgqeav
gi|294101853|ref|YP_003553711.1|  alawavremeqrydifakarvrnlagynekaipkdrlphiviivdeladlmftaqkdvedyicr
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  advtehirsprvdsivssyaalptvrrcllsiqreqaeegglvadgrdmgtvvfpdatikiylt
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  iialnmadvaenkgirihreklekalgvpvvptvarerkgledlvkrvkdrfengvsl......
gi|294102390|ref|YP_003554248.1|  dlrlrgpgevcgvrqhgitdfrvadllkd...................................
gi|294101443|ref|YP_003553301.1|  yhfnksqqnallpsvekgdiilvgtttenpwfeinktllsrlvvfqlkplaeedlvqilykalk
gi|294101748|ref|YP_003553606.1|  vcttivesgldiprantlivddaqelglaqmyqlrgrvgrreegayayflypetmplqketmer
gi|294101649|ref|YP_003553507.1|  gflldgfprtvpqaealdqllatmnlsldavilldvddevvvkrlcgrrmcrqcgeiyhvtfkp
gi|294101715|ref|YP_003553573.1|  yiaerygmpsevlqkaratlkeq.........................................
gi|294101925|ref|YP_003553783.1|  nfdelafflvgakptddqrveyrllrelittfkkencklksgdvtqefitadspipfsarklwy
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  pyvrplydafydlfsperflryidknvieiaplaymrgrtlndsfiildeaqnttpeqmkmflt
gi|294101046|ref|YP_003552904.1|  piicctqeiytlkytkephqkliidefhyifedpdrartyidgirgtapttsilvmsatfsqpg
gi|294101779|ref|YP_003553637.1|  ipssdtyiekdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavge
gi|294101226|ref|YP_003553084.1|  talernlylafqamergihtivalnmvdearhrgisidveklekllgvpvvptvalsgqginri
gi|294101892|ref|YP_003553750.1|  lieqyitqretlqllvhlvdfrhgllkndqelqewisqigipslvvftkadkiskgrhkgmlhs
gi|294102315|ref|YP_003554173.1|  sgikvnvlgsfrcpsekiindhdlflekvqnttstllsllniesdplsgrehlliskifeqswr
gi|294102188|ref|YP_003554046.1|  gvknlhlvtglldqlriswiergvivnkaeredrsivekiqreygvkgllpfdeklekgwlkge
gi|294102320|ref|YP_003554178.1|  synmflkelddgfiyvskkysnkifellesdddealqklidegkaeryssedfkdelrtdlehd
gi|294102169|ref|YP_003554027.1|  hleanlvskafkelpledldvifienvgnlvcpaefdigedmkvavssvpegadkplkyphlfs
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  aafrttleeisvsslillvldgsmpdvmetldvveetlsdigagaiprlivlnkidkidlslip
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  yervdlvwtpgqyvvrgfivdiydpayalpirieffdeivesirsfhpqsqmsaatldeieihs
gi|294101141|ref|YP_003552999.1|  krcqeiamelqesfaenllcyhsrfrlkdrqkwhkkliekfrdpepmiaittqvcemsldlsas
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  elssvqeegrklfellevsiadgvlipvrneelyrcgllvsshietalkmlrsieelcnekpyd
gi|294101032|ref|YP_003552890.1|  rckgcgvcadncafgalnqfgthapvvnmqlchgcgvcelvcpqkaikdskasigimniknqes
gi|294101031|ref|YP_003552889.1|  cegcggcalvcphqaismhsyeqgqywrgtttygplwharlhageensgmlvarlkkesrkeal
gi|294101431|ref|YP_003553289.1|  lesqlakllkgeevrvpefdfikgkkfpgatlrlnkhdvliiegihglnekvtavvpeemkfgi
gi|294102167|ref|YP_003554025.1|  ghinpsvvasivfsdmteyewvcdmihpfvriemerkvaslqgwviaeipllfenripwwvdls
gi|294101458|ref|YP_003553316.1|  ytantmltdrrnvvviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtp
gi|294102320|ref|YP_003554178.1|  ergtekytniiideahrfrtettityeklaeicrgkrvilvtatpynnspkdilsllklfqkgq
gi|294101940|ref|YP_003553798.1|  nalhglikvnsprirearegmkkhlnrlevvgeesgqrwtidrlekhvalripslvvidyltll
gi|294102120|ref|YP_003553978.1|  swvderlfslidaryrsgkqtiittnacsmsqlkemlgehgtrivsrltema............
gi|294101791|ref|YP_003553649.1|  glceyaddgfvlviewpdrlaeqpt.......................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  kgtiplvqvlfldssdeslvrrfettrrrhplgdhipvlegiqkerallapvreyadvvldtsg
gi|294102042|ref|YP_003553900.1|  lksrcwnlal......................................................
gi|294102015|ref|YP_003553873.1|  smaaierimnrgkiplfvggtpfyyhalfegvltkdlprdrkltdelekfaskhgnqalhdqls
gi|294102787|ref|YP_003554645.1|  mngrnstfsgarngtsledllgyvdremyerifsvgledmqkirplndrgiqsrffsagaglgt
gi|294102032|ref|YP_003553890.1|  kemgsafeellselkiaiskafeksqyedakaqlvknfqeqvnglmeevrawagekgfalkrtp
gi|294102010|ref|YP_003553868.1|  strllmdiggdaegalalkqfepiikkvgyrlilvvnafrpqtasvtriqkmmkkmesicglev
gi|294101586|ref|YP_003553444.1|  cryekpgeisiydiqnrigsnfdillleggksfpchkiw.........................
gi|294101458|ref|YP_003553316.1|  ggkgmivamsrriaidlykeivalrpdwhsddlmsgkikvvitgsssdpsdwqafigskadret
gi|294102625|ref|YP_003554483.1|  nekgwigflehaapergldsfkkmclfvktikkggtpveilsalyslaaenpswgkelslwamd
gi|294102478|ref|YP_003554336.1|  gilreppkaiqrahivvitkadqvs.......................................
gi|294101874|ref|YP_003553732.1|  malkivrilnlpqperfi..............................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6ha_                             ................................................................
gi|294102520|ref|YP_003554378.1|  kdalkpnlvqtlehvpafvhggpfaniahgcnsiqatkyglklsdyfiteagfgadlgaekffd
gi|294102529|ref|YP_003554387.1|  eagfgadlgaekffdikcrignltpsavvivatvralkmhggvakneltgenlealskgipnle
gi|294102437|ref|YP_003554295.1|  legkgilfegaqgtlldvdhgtypfvtssspiaaggcvglgvgpsdvdrvigvvkayctrvgeg
gi|294102168|ref|YP_003554026.1|  hrlhnfcgyrygdmavlyrinamsriyeqkciekgvpyrvvrgtafydrkeikdvlsfmrlavn
gi|294101779|ref|YP_003553637.1|  kwdrrgfmerlidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidpv
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  rvgadfyqvvngirtrlgarsvplqlpigsedrfsgivdliqmkavffqddlgtapvvgeipge
gi|294101185|ref|YP_003553043.1|  larrfqpvlveqpdvedtisilrglkerlevhhgvrirdnalvgaavlsnryitdrflpdkaid
gi|294102626|ref|YP_003554484.1|  evphylsthelrqqctvdpfltyleggkegekirearlrqirrlallfsqyyeekrtvwdkqke
gi|294101765|ref|YP_003553623.1|  sqrlirllcplckkpdsnspvgcsycggrgfhgrvgvfeylpitervqelllhkapvqkirtqa
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  kgiyppvdvmpslsrlkdk.............................................
gi|294101806|ref|YP_003553664.1|  ypaylgtrlasfyeragraiclgsdgregsvtaigavsppggdlsepvsqntlrvtkvfwglda
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  kedareavmkelrqafrpeflnrvddvvlfkplqrheirqivkllaqelqkrlkdhridlelse
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  agklderevelevaesasmgipilggagmdsmgmninemlsgllpkktkkrrmkvsdgkkllqa
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  drensdyartlddikkqlsdkavpfflpigkeasfkgvvdilnqkayeyvtdgsgsfkeisipa
gi|294101565|ref|YP_003553423.1|  eadgyfdwdktksdildavqktfrpefinrvdemvvfrplskkemlvivdimlsdvrerlryqd
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ypaylgtrlaqyyeragrakllglperegsvtvinavspaggdfsepvtqaslrlsgafwaldk
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  tisileglrdryeshhrvkisddalvaaarlssryiterflpdkaidlideaaararlktmeip
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  kagimeiadifvvnkadrpgaekietevklmldligktdwfppihmtvaekgdgvaelvegiek
gi|294101894|ref|YP_003553752.1|  ilficggafagieevigrrvnkkmigfggdilsvkehrnyelmrqvqpedlmafgfipeligrl
gi|294101778|ref|YP_003553636.1|  hivvdrpdvkgreeilavhvrnkkiaddvdlgvvarrtpgfvgadlanlvneaallaaragksl
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  drngrfeilqihtrgmplaedvdlmrlsdithgfvgadlealakeaamsslrellpcidyeqav
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  rgldvegvshviqmglpdnretfvhrsgrtgraghegrnllvlspkea................
gi|294102459|ref|YP_003554317.1|  sltvigtalvdtgsrmddviyeefkgtgnmelhlsrklaeqrifpavditksgtrreell....
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  dvvlelpmpdakarleifqihlqkkplaedvhleelvrsteghsggdihficrkasalairdfl
gi|294102074|ref|YP_003553932.1|  nrgteeedtvqlrlsnalkemekmhmydyvvvndsvlraaleikriiasynl............
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  dgtrr...........................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ahklvvpiqceyyalegvgqlahtiglvrdclnpdlavdgvlltmydsrtrlandvveevrrqf
gi|294101321|ref|YP_003553179.1|  fpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapqretdkpflmpiedvfti
gi|294101626|ref|YP_003553484.1|  fpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapqretdkpflmpiedvfti
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  dtregldvltlsatpiprtlslslrglrsfsiistpp...........................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  rkrvrdempflshapllfvsaltkrglnkltqtiknvqenrsrrigttelnrlirdvlafqtlp
gi|294102390|ref|YP_003554248.1|  rakganegqaphilvmtatpiprtltlsvygdlsvsvidempp.....................
gi|294101403|ref|YP_003553261.1|  isrsncvvvfinqlrakistgyssgpqetttggralkfyssvrvevkrgksinkgedaighelw
gi|294101730|ref|YP_003553588.1|  rkidvqnivkslsmvahnenrnaeeealweiarqadgamrdalslleqvma.............
gi|294102602|ref|YP_003554460.1|  pvlygsgldgwavrdlnkyahegmkhlfetiaeyvpapkvnlhap...................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  eliyrdlgvidnrlsrlaakkrllpeeeeekkllercqaflmeekplrelglsedeqrklsgfa
gi|294102150|ref|YP_003554008.1|  gidadgailasakegigiqdilerivaqvpapegdteaplqalifdsvynnyrg..........
gi|294101607|ref|YP_003553465.1|  inrvkpsmvkegemldvqdvldvlaieligivpdddsvvksanrgepltsgdtslasmafsnia
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  alnmtkmmevpllgavenmsyvtcpdcgkaievfgpshvkeieekfslpvlgkfpldlelshlg
gi|294101963|ref|YP_003553821.1|  eewggdsimvdvsaktgegiphllemvllvaemeelradp........................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  vdetseivqrgakvlgieieeeaayeiarrsrgtprvairllkrvrdvaevrqspsintavasv
gi|294102400|ref|YP_003554258.1|  dnratiriakhrngptgdvnlvfl........................................
gi|294102043|ref|YP_003553901.1|  tplpvainrikttrghfdriesetdgflnrvcegykelskrfphrivridgsqpteevsaqiwk
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  vilskydntakggvilaiahrlalpiryiglgesvddlrlfepqefvralle............
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  rlpgyvaeekihiakkhllpklfkehgltdkmisitsktvektirdytreagvrnlqrslatlc
gi|294101841|ref|YP_003553699.1|  rnipyyntsaitgegiaefmgnivalcrehtrphsei...........................
gi|294102070|ref|YP_003553928.1|  yslgfehvvgisalhkryiddlmdmavsllpsdeee............................
gi|294102221|ref|YP_003554079.1|  pydvivfdtaptghtlrlitlpeilgiwiehliekranamelmkvaakydkdlqekikedpiid
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  vtdfvqgtflegkvvvpvssvtnknipllmeelaklidrvqprtrrgpffmpidrafpisgfgt
gi|294101756|ref|YP_003553614.1|  mavaslfkeklpivgalgvsakkgynidklvqilkdklpagfpwydeeiltdrperflageiir
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  lpqspvfvisaekregiealkdai........................................
gi|294101016|ref|YP_003552874.1|  triailqkkaqirnyevpedvisflaqnvpsnirelegalnri.....................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  tdelgifemtekgl..................................................
gi|294102507|ref|YP_003554365.1|  scsayekeryskrlsgpildridlhvsvprllpkelisfedqsgedsetvrqrvcearekqrlr
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  kvatsfheklsltgvvlskldgdarggaalairattqvpikfagvgegidaielfdakrmaqri
gi|294101853|ref|YP_003553711.1|  laqmaratgihlllatqrpsvnvvtglikaniparvaftlpsqadsrtiidvsgaekllgkgdm
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  asdsvrakrrhlqllergekvsfdevlrqiqnrdqfdsnreiaplcqasdaifvdtssmtedev
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  deekglgalklavsedvitvlakmaggdarqaltrlellassvaasgaaeltmah.........
gi|294101748|ref|YP_003553606.1|  feaisafsdigsgyslalqdlqirgsgdiigvsqhgqdervgyrfyykmleeeiar........
gi|294101649|ref|YP_003553507.1|  ssqgmrcekcggelfqrdddketvirsrlkvyhdqtaplisyydekgllrkvnagtssssvmae