SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

P-loop containing nucleoside triphosphate hydrolases alignments in Aminobacterium colombiense DSM 12261

These alignments are sequences aligned to the 0037960 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1g6oa_                             lsaedkkfleveralkeaalnplrhate....................................
gi|294102520|ref|YP_003554378.1|  dieiarsakmkpivevaaqlgideeelelygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102529|ref|YP_003554387.1|  dieiaqnaelkpivevaaqlginedeleyygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102437|ref|YP_003554295.1|  veiiigaqwgdegkgrvvdalgnrvevfaryqgganaghtvivedekyvfhllpsgmlypcklc
gi|294102168|ref|YP_003554026.1|  dsildklnprqqeavrycdgpllvlagagsgktrvlahkiayliekgyaspkgilavtftnkaa
gi|294101779|ref|YP_003553637.1|  adwgpsgdqpeaieklveslkngtrfq.....................................
gi|294102457|ref|YP_003554315.1|  tkfifvtggvvsslgkgitaaslgvllkkrgfrvsiikldpylnvdagtmnpfqhgevfvtddg
gi|294101625|ref|YP_003553483.1|  emkkirnigiaahidagktttterilfytgrnykmgethegsatmdw.................
gi|294101185|ref|YP_003553043.1|  tyealdkygrdlvkmarlgkldpvigrdeevrrvirilsr........................
gi|294102626|ref|YP_003554484.1|  tqpgqfkaitadaplvavsagagtgktwtlawrfiwilvtgradtneiltltftekaalemaer
gi|294101765|ref|YP_003553623.1|  ydaafpakdivd....................................................
gi|294102479|ref|YP_003554337.1|  hpvplgvi........................................................
gi|294101904|ref|YP_003553762.1|  i...............................................................
gi|294102557|ref|YP_003554415.1|  yikkivkdfgsyddps................................................
gi|294101807|ref|YP_003553665.1|  tlpvsrdmlgrifngrgepidggapilpdakldingmpmnpfsrdypsefiqtgistidgmnpm
gi|294101806|ref|YP_003553664.1|  vietiaviknesgeeknvvmlqrwpvrkprpvarrlppiiplttgqr.................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ipvtrlmegerekllkldeilhqrvigqdeavelvadavi........................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ltprmivecldryivgqekakravaialrnrmrrrnlprdlaneva..................
gi|294102409|ref|YP_003554267.1|  pneralkryrqiaddinglepeysaksdedlrslvadfkrranegesldnllvevfalvrevsr
gi|294102354|ref|YP_003554212.1|  kpedirs.........................................................
gi|294101565|ref|YP_003553423.1|  ipvtqlteeetqrllrmeeeihcrligqeeavsavarairrarsgmkdp...............
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  kmpvglslvgqvlngrgrsidgtplsfidkdlpitgmpinpvrrtspnayvetgissidmmntl
gi|294101061|ref|YP_003552919.1|  i...............................................................
gi|294101048|ref|YP_003552906.1|  dksed...........................................................
gi|294101977|ref|YP_003553835.1|  engveltmkqrwevrrprpvlsrlsfdaplltgqrildtl........................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ptldqlgidlseksrkdeldpvigrdkeiqrviqilarrtknnpvllgdpgvgktaiveglaqk
gi|294101786|ref|YP_003553644.1|  l...............................................................
gi|294101493|ref|YP_003553351.1|  l...............................................................
gi|294101884|ref|YP_003553742.1|  aekalhgdiralariislveneapeseeimkylyphtgka........................
gi|294101894|ref|YP_003553752.1|  dtpkpaevkkfldqyvigqedakkilsvavynhfkristmseenddiel...............
gi|294101778|ref|YP_003553636.1|  dnrpkvtfddvagcdeskeelseviqflrdpgkfralg..........................
gi|294102313|ref|YP_003554171.1|  i...............................................................
gi|294102640|ref|YP_003554498.1|  l...............................................................
gi|294101376|ref|YP_003553234.1|  isyedigglgpqiqrvremielplrf......................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  skvlilsptrelsqqiwkeakwfgnyinvsaaslvggmdmsqqirslrdgsavvtgtpgrvldh
gi|294102459|ref|YP_003554317.1|  lrngdviwgmvrppkdqehyeallrvemvnfadpeaarkrphfgtltpifpdsrltletdpdei
gi|294101785|ref|YP_003553643.1|  i...............................................................
gi|294101376|ref|YP_003553234.1|  pdvtwsdiggleaikeelieavqwplkynsvye...............................
gi|294102074|ref|YP_003553932.1|  m...............................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  l...............................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  v...............................................................
gi|294102187|ref|YP_003554045.1|  ei..............................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  mlsiavtnqkg.....................................................
gi|294101321|ref|YP_003553179.1|  akphlnvgt.......................................................
gi|294101626|ref|YP_003553484.1|  akphlnvgt.......................................................
gi|294101069|ref|YP_003552927.1|  i...............................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  i...............................................................
gi|294101254|ref|YP_003553112.1|  p...............................................................
gi|294102760|ref|YP_003554618.1|  td..............................................................
gi|294101659|ref|YP_003553517.1|  t...............................................................
gi|294101172|ref|YP_003553030.1|  ni..............................................................
gi|294102017|ref|YP_003553875.1|  yirpqinnglnlkieggrhpvieatfldlpf.................................
gi|294101748|ref|YP_003553606.1|  vldslrgtrwkkavektrervreevknlvrlyarrellkgyafpvaseiyrhfveafpyvetpd
gi|294102409|ref|YP_003554267.1|  pmvrsdfpdviyrtslekfhavaeeveetysngqpvlvgttsienseriskllkarkiphqvln
gi|294102070|ref|YP_003553928.1|  fehvvgisalhkryiddlmdmavsllpsdeeeerdpeeir........................
gi|294102390|ref|YP_003554248.1|  dplpdflrlkhafpplydsilemhypqgreswkkardrlayqelfvlqtgmalrrgersrlaek
gi|294101403|ref|YP_003553261.1|  redilelaiddirskfgegsimrlgdpfkvqvevistgilpldvalgigg..............
gi|294101730|ref|YP_003553588.1|  ekrvsha.........................................................
gi|294102602|ref|YP_003554460.1|  vqaekirnlaiiahidh...............................................
gi|294102663|ref|YP_003554521.1|  i...............................................................
gi|294101436|ref|YP_003553294.1|  lkc.............................................................
gi|294102150|ref|YP_003554008.1|  slsrirnfciiahidh................................................
gi|294101607|ref|YP_003553465.1|  prviv...........................................................
gi|294102035|ref|YP_003553893.1|  rrfvqvymgdgkgkttaalglairaagwnmkvgiiqfmkgwpqygelaslarfpeiqlvqtgrp
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ms..............................................................
gi|294102549|ref|YP_003554407.1|  lw..............................................................
gi|294102841|ref|YP_003554699.1|  pa..............................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  kkdvgkviavgs....................................................
gi|294101963|ref|YP_003553821.1|  khmeprpp........................................................
gi|294101356|ref|YP_003553214.1|  dssekavaih......................................................
gi|294102542|ref|YP_003554400.1|  r...............................................................
gi|294101861|ref|YP_003553719.1|  lrpsslqdfvgqqklkdklsiyvqaarqrkeal...............................
gi|294102400|ref|YP_003554258.1|  vtgfstgfyqfdrmtgglqpgslniiaarpsmgktalalniaqyggverkepilifslemsaeq
gi|294102043|ref|YP_003553901.1|  mfitle..........................................................
gi|294101077|ref|YP_003552935.1|  mp..............................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ksp.............................................................
gi|294101613|ref|YP_003553471.1|  mfierlrlkgfksfggsheltfs.........................................
gi|294101367|ref|YP_003553225.1|  e...............................................................
gi|294101893|ref|YP_003553751.1|  pwntyteenlditkaqrildedhyglvkvkerilefla..........................
gi|294101841|ref|YP_003553699.1|  d...............................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  mvhhv...........................................................
gi|294101356|ref|YP_003553214.1|  i...............................................................
gi|294101345|ref|YP_003553203.1|  p...............................................................
gi|294102145|ref|YP_003554003.1|  eislvlgtaghidh..................................................
gi|294101756|ref|YP_003553614.1|  p...............................................................
gi|294102549|ref|YP_003554407.1|  pf..............................................................
gi|294101372|ref|YP_003553230.1|  ytgeemveisthggtlvaqkclesligkgarlaepgeftrraflngkidlsqaeavlgiirsks
gi|294101016|ref|YP_003552874.1|  lnpnyifnsfvvgksnrlahaaslavaetpgeaynp............................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  idesgcekprssdlmavniidvrppqrftsgipeldrvlgggwv....................
gi|294102507|ref|YP_003554365.1|  pnpdladik.......................................................
gi|294101471|ref|YP_003553329.1|  flrkggs.........................................................
gi|294101845|ref|YP_003553703.1|  mleelslrniggldsahlh.............................................
gi|294101553|ref|YP_003553411.1|  dvdykvvkslvdsirgrcigqevldsitpgqqvvaivyeelvslmgedvvpfiiss........
gi|294101853|ref|YP_003553711.1|  lrveapipgkpyvgieipnpkrrgvllrrilesqafeqadynlplpmgvrvdsrpliigledlp
gi|294101780|ref|YP_003553638.1|  ah..............................................................
gi|294102079|ref|YP_003553937.1|  mknl............................................................
gi|294101472|ref|YP_003553330.1|  f...............................................................
gi|294102235|ref|YP_003554093.1|  it..............................................................
gi|294102390|ref|YP_003554248.1|  ppgrtpiqtrwlkkkeegrlwafirercsareriywvcplidesetlsvasvteryeylkklfp
gi|294101443|ref|YP_003553301.1|  qwerpladrmrpsslddfvgqnhllapgtplrqilqsgkvps......................
gi|294101748|ref|YP_003553606.1|  ppynrvpvltmvgprkknlihra.........................................
gi|294101649|ref|YP_003553507.1|  m...............................................................
gi|294101715|ref|YP_003553573.1|  wtlpelskkpffvfydllhpllgekgipltiecgrsf...........................
gi|294101925|ref|YP_003553783.1|  sieigkhsssdnlsvyvdihklilr.......................................
gi|294101367|ref|YP_003553225.1|  lagni...........................................................
gi|294101751|ref|YP_003553609.1|  pvrpktggqklyiea.................................................
gi|294101046|ref|YP_003552904.1|  nav.............................................................
gi|294101779|ref|YP_003553637.1|  t...............................................................
gi|294101226|ref|YP_003553084.1|  l...............................................................
gi|294101892|ref|YP_003553750.1|  ppqtlpe.........................................................
gi|294102315|ref|YP_003554173.1|  sdnlvlydskdltthg................................................
gi|294102188|ref|YP_003554046.1|  eriavlscrggaggssfsislalqlasmgkrtalidgdlymgdvafllntpyelnwtswanecl
gi|294102320|ref|YP_003554178.1|  ekytniiideahrfrtettityeklaeicrgkrvilvtatpynnspkdilsllklfqkgqksti
gi|294102169|ref|YP_003554027.1|  svmaadeefarrmrdeshhrgilv........................................
gi|294101254|ref|YP_003553112.1|  kkitvlgdr.......................................................
gi|294102077|ref|YP_003553935.1|  ryrrekagip......................................................
gi|294102510|ref|YP_003554368.1|  hmakgkrkleelvqkldlilevrdaraphltsspmsdqlsricpvyivlsradlaeegatkawl
gi|294101748|ref|YP_003553606.1|  qvhlpvdggarawilggasvpllvvfsdqrqaedfvsdfenlwegeivrllyelplsvegvrnk
gi|294101141|ref|YP_003552999.1|  drtcllapcgsgktlaawkwgsgvasrhpisrfiflyptratategfrdyvswapetdgtllhg
gi|294101018|ref|YP_003552876.1|  lewaa...........................................................
gi|294101692|ref|YP_003553550.1|  iwdsfmqqrntvfvaeaptgigktfallapalkwalpqekrilfltagitlqeqlirkdlprlk
gi|294101032|ref|YP_003552890.1|  mfrltvas........................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ek..............................................................
gi|294102167|ref|YP_003554025.1|  lv..............................................................
gi|294101458|ref|YP_003553316.1|  aplcipqlevlikgmflkdrfldiirhfvlfqsdgkeikkilagyhqyhavnkalqstqratme
gi|294102320|ref|YP_003554178.1|  fkrleyqeqavlnakkivleygg.........................................
gi|294101940|ref|YP_003553798.1|  rlgirrldtafdg...................................................
gi|294102120|ref|YP_003553978.1|  rtakglama.......................................................
gi|294101791|ref|YP_003553649.1|  h...............................................................
gi|294102136|ref|YP_003553994.1|  mvkqidirkyrkmed.................................................
gi|294101830|ref|YP_003553688.1|  rc..............................................................
gi|294102042|ref|YP_003553900.1|  iaidiarlllcekknacgqclsccswhekthpdlvlsgslekaptisecreiavelslypvvas
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  mrfiefkirsfgllenmeghf...........................................
gi|294102032|ref|YP_003553890.1|  le..............................................................
gi|294102010|ref|YP_003553868.1|  tllaslirlyewp...................................................
gi|294101586|ref|YP_003553444.1|  yi..............................................................
gi|294101458|ref|YP_003553316.1|  vviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltdkntrvvfg
gi|294102625|ref|YP_003554483.1|  ivagsprmemetlarelvlwknkkgylsgqeilpaetpwqnigmvfdapllplaeevlqryrip
gi|294102478|ref|YP_003554336.1|  ipvisvgnitlggtnktpfvemlsrhfynmgvrvgivsrgyggrtsepvvikgtssereivgde
gi|294101874|ref|YP_003553732.1|  h...............................................................
gi|294102071|ref|YP_003553929.1|  lqehpgpaillfperalaeffysfletegveniflwpsvggkklweawnrtrsgehkiiiggpg


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  gegkttttvglaqglaklgkkvsialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102529|ref|YP_003554387.1|  gegkttttvglgqglaklgkrvcialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102437|ref|YP_003554295.1|  vvgngvvvdpeqllkelhtlqeqgkdrarlmisgsahvvmpyhkildkadeqfrskdkkigttg
gi|294102168|ref|YP_003554026.1|  remgervqalvgakasamqvstfhsfglhflfrnsdqleflglrkgfaifdrndsrslvkkime
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  aetdldlghyerfideslsadnnvttgkiystviskerhgcylggtvqviphitneiqdrilka
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  iknlllqlamelpsqkvffqkaadridegyistihsfsmrvlkecglateldpesgtiappqes
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  vrgqklpifsgsglphnrmaaqiarqatvisghedfavvfaamgitfeeas.............
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  rtlglrhfdvqlmggmalhegkitemktgegktlvatlavvlnalsgngvhvvtvndylakrda
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  vrgqklpifsgsglpaneiaaqivqqaavpgretdflvifaamgitrrearyfidtfestgain
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  iqdgniaeilrgkkivqlnignlvagtkyrgefeermrkllkelretgdviifideihsiigag
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  irrgtldtsgi.....................................................
gi|294102459|ref|YP_003554317.1|  strlidlf........................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  qlraeqeilqdmesshpmdr............................................
gi|294102409|ref|YP_003554267.1|  akyhekeaqivaqagrfgavtvatnmagrgtdivlggnpdfl......................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  apilpesgrlkerflkeifpyplteaqkkvsleisqdmalni......................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  dfvkkgsplqfdieeaqrglelakkwiekglf................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  lvqrmlgseakvnihdirngsfaekdwekladaag.............................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  eealraatrtlrgelssfakdiynemltisssievgldfpeedipfienegvesalytlkqgle
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  dlnvgllhgqlpsseketimrsfarghldlivsttvievgvdvp....................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  sgtvdgerylalgpkdlmimptaknpvqaelvksgmgdrlieslsdrfdyivv...........
gi|294102320|ref|YP_003554178.1|  pnlp............................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  qffssikqkawafnflegriqllrrdlaklrpahrel...........................
gi|294101748|ref|YP_003553606.1|  slllqrgetlskwkqekgilatspggllspfltgegvfplrremgeergrllrwlevag.....
gi|294101141|ref|YP_003552999.1|  tsnyelqgmfdnpdprsekefltndrlfavglwq..............................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ellgydvsfgllkgrgnyvcvrralelehegflsfgdsgaasiylsewlkktqtgdlselklps
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  qgdrrvgviwhtqgsgkslsmvfyagklvideelenptivvitdrndlddqlfstflkseellr
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  crlvv...........................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  dyidiydmtravedgttvkifyesriakldlpeemkpqidseyeeiteyqeysqkerlkskwar
gi|294102625|ref|YP_003554483.1|  ysinegltvgqtalwdi...............................................
gi|294102478|ref|YP_003554336.1|  plllasrlphvpvavsrdrlkdvealqkhnvelivad...........................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  aif.............................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  aittahnllaalldnhlhqgnplnidprrvvfrrvidlneralryvnvglggktngvpresgfd
gi|294102529|ref|YP_003554387.1|  aitsahnllsalidnhlhqgnplnidprrvvfrrvvdlneralrhvivglggka..........
gi|294102437|ref|YP_003554295.1|  rgigpcyvdkfnrcgiriedlfdpdilreklsfnlel...........................
gi|294102168|ref|YP_003554026.1|  dlkldpkqidptnvldhiskaktegnhktlepvglegiehevyrkyhdelrrqnavdfddllil
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  addndiviaeiggtvgdi..............................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  lfwkeaeealdrwdgnwfakssshlwaqriaklfsdplfmdsvntfgpnatvelaksslalfas
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ewmgpiyrflglsvkciyaymdqkerkeaylsdvtygtnsefgfdylrdnmavakdqlvqrghh
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ngiffmnlasdsaverlltprmaltaaeyfafekgydvlvimt.....................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  gaegavdaanilkpslsrgefqvigattldeyrkyiekda........................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  dlldrcnt........................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  dfpifprvaaqvrgclghrcpyrdrcfiqkalkkaqnwdvivsnyhmyfayvmngkgtfpv...
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ntpvqaqdrv......................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  leaivgteqrikqiak................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  itvasevmailclsesik..............................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  plhllmvdeklreqeqsrldwilvde......................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  qgqtpkdlwqwgsdlfsrdqdavdtarltlfrrwedewhrflqpesgifynlnelggtgklcgn
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  fcivdevdsilideartpliisgpsednvemyttadqiarqlkegrdfekdekernvaftedgi
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  vrnlitrwqqqpskenlphfiqslieglkgasgklaneiafhlkepvsqyrnrlikeepwitvf
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  arcenllkmpglfsdaansdlahrivqavkahvlfqkdvhy.......................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  tqgfdekeqayrscllgfsailwqlwdefrrrknrlsfddmiryamealehspsyaerfkeilv
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                         10        20        30        40           
                                                          |         |         |         |           
d1g6oa_                             .............----------------------------ELFGDFLKMENITEICYNGNK..
gi|294102520|ref|YP_003554378.1|  .............-------------------------------------------------..
gi|294102529|ref|YP_003554387.1|  .............-------------------------------------------------..
gi|294102437|ref|YP_003554295.1|  .............-------------------------------------------------..
gi|294102168|ref|YP_003554026.1|  .............-------------------------------------------------..
gi|294101779|ref|YP_003553637.1|  .............-------------------------------------------------..
gi|294102457|ref|YP_003554315.1|  .............-------------------------------------------------..
gi|294101625|ref|YP_003553483.1|  .............-------------------------------------------------..
gi|294101185|ref|YP_003553043.1|  .............-------------------------------------------------..
gi|294102626|ref|YP_003554484.1|  defqdtnplqdrl-------------------------------------------------..
gi|294101765|ref|YP_003553623.1|  .............--------------------------FVDRIINEAAKNGASDIHIEGLSaw
gi|294102479|ref|YP_003554337.1|  .............-------------------------------------------------..
gi|294101904|ref|YP_003553762.1|  .............-------------------------------------------------..
gi|294102557|ref|YP_003554415.1|  .............-------------------------------------------------..
gi|294101807|ref|YP_003553665.1|  .............-------------------------------------------------..
gi|294101806|ref|YP_003553664.1|  .............-------------------------------------------------..
gi|294102649|ref|YP_003554507.1|  .............-------------------------------------------------..
gi|294101185|ref|YP_003553043.1|  .............-------------------------------------------------..
gi|294102868|ref|YP_003554726.1|  .............-------------------------------------------------..
gi|294102500|ref|YP_003554358.1|  .............-------------------------------------------------..
gi|294102409|ref|YP_003554267.1|  .............-------------------------------------------------..
gi|294102354|ref|YP_003554212.1|  .............-------------------------------------------------..
gi|294101565|ref|YP_003553423.1|  .............-------------------------------------------------..
gi|294101424|ref|YP_003553282.1|  .............-------------------------------------------------..
gi|294101976|ref|YP_003553834.1|  .............-------------------------------------------------..
gi|294101061|ref|YP_003552919.1|  .............-------------------------------------------------..
gi|294101048|ref|YP_003552906.1|  .............-------------------------------------------------..
gi|294101977|ref|YP_003553835.1|  .............-------------------------------------------------..
gi|294101084|ref|YP_003552942.1|  .............-------------------------------------------------..
gi|294101565|ref|YP_003553423.1|  .............-------------------------ALERRFQPVMVEEPSVDDTI----..
gi|294101786|ref|YP_003553644.1|  .............-------------------------------------------------..
gi|294101493|ref|YP_003553351.1|  .............-------------------------------------------------..
gi|294101884|ref|YP_003553742.1|  .............-------------------------------------------------..
gi|294101894|ref|YP_003553752.1|  .............-------------------------------------------------..
gi|294101778|ref|YP_003553636.1|  .............-------------------------------------------------..
gi|294102313|ref|YP_003554171.1|  .............-------------------------------------------------..
gi|294102640|ref|YP_003554498.1|  .............-------------------------------------------------..
gi|294101376|ref|YP_003553234.1|  .............-------------------------------------------------..
gi|294102641|ref|YP_003554499.1|  .............-------------------------------------------------..
gi|294101359|ref|YP_003553217.1|  .............-------------------------------------------------..
gi|294102459|ref|YP_003554317.1|  .............-------------------------------------------------..
gi|294101785|ref|YP_003553643.1|  .............-------------------------------------------------..
gi|294101376|ref|YP_003553234.1|  .............-------------------------------------------------..
gi|294102074|ref|YP_003553932.1|  .............-------------------------------------------------..
gi|294102442|ref|YP_003554300.1|  .............-------------------------------------------------..
gi|294101577|ref|YP_003553435.1|  .............-------------------------------------------------..
gi|294101171|ref|YP_003553029.1|  .............-------------------------------------------------..
gi|294102413|ref|YP_003554271.1|  .............-------------------------------------------------..
gi|294102187|ref|YP_003554045.1|  .............--------------NRLHDDLLNEVFGYGPIQPLLDDDTVTEIMVNGCE..
gi|294102332|ref|YP_003554190.1|  .............-------------------------------------------------..
gi|294102831|ref|YP_003554689.1|  .............-------------------------------------------------..
gi|294101321|ref|YP_003553179.1|  .............-------------------------------------------------..
gi|294101626|ref|YP_003553484.1|  .............-------------------------------------------------..
gi|294101069|ref|YP_003552927.1|  .............-------------------------------------------------..
gi|294102759|ref|YP_003554617.1|  .............-------------------------------------------------..
gi|294101055|ref|YP_003552913.1|  .............-------------------------------------------------..
gi|294101254|ref|YP_003553112.1|  .............-------------------------------------------------..
gi|294102760|ref|YP_003554618.1|  .............-------------------------------------------------..
gi|294101659|ref|YP_003553517.1|  .............-------------------------------------------------..
gi|294101172|ref|YP_003553030.1|  .............-------------------------------------------------..
gi|294102017|ref|YP_003553875.1|  .............-------------------------------------------------..
gi|294101748|ref|YP_003553606.1|  .............-------------------------------------------------..
gi|294102409|ref|YP_003554267.1|  .............-------------------------------------------------..
gi|294102070|ref|YP_003553928.1|  .............-------------------------------------------------..
gi|294102390|ref|YP_003554248.1|  .............-------------------------------------------------..
gi|294101403|ref|YP_003553261.1|  .............-------------------------------------------------..
gi|294101730|ref|YP_003553588.1|  .............-------------------------------------------------..
gi|294102602|ref|YP_003554460.1|  .............-------------------------------------------------..
gi|294102663|ref|YP_003554521.1|  .............-------------------------------------------------..
gi|294101436|ref|YP_003553294.1|  .............-------------------------------------------------..
gi|294102150|ref|YP_003554008.1|  .............-------------------------------------------------..
gi|294101607|ref|YP_003553465.1|  .............-------------------------------------------------..
gi|294102035|ref|YP_003553893.1|  .............-------------------------------------------------..
gi|294102412|ref|YP_003554270.1|  .............-------------------------------------------------..
gi|294101660|ref|YP_003553518.1|  .............-------------------------------------------------..
gi|294102549|ref|YP_003554407.1|  .............-------------------------------------------------..
gi|294102841|ref|YP_003554699.1|  .............-------------------------------------------------..
gi|294101272|ref|YP_003553130.1|  .............-------------------------------------------------..
gi|294101433|ref|YP_003553291.1|  .............-------------------------------------------------..
gi|294101963|ref|YP_003553821.1|  .............-------------------------------------------------..
gi|294101356|ref|YP_003553214.1|  .............-------------------------------------------------..
gi|294102542|ref|YP_003554400.1|  .............-------------------------------------------------..
gi|294101861|ref|YP_003553719.1|  .............-------------------------------------------------..
gi|294102400|ref|YP_003554258.1|  .............-------------------------------------------------..
gi|294102043|ref|YP_003553901.1|  .............-------------------------------------------------..
gi|294101077|ref|YP_003552935.1|  .............-------------------------------------------------..
gi|294102348|ref|YP_003554206.1|  .............-------------------------------------------------..
gi|294102040|ref|YP_003553898.1|  .............-------------------------------------------------..
gi|294101613|ref|YP_003553471.1|  .............-------------------------------------------------..
gi|294101367|ref|YP_003553225.1|  .............-------------------------------------------------..
gi|294101893|ref|YP_003553751.1|  .............-------------------------------------------------..
gi|294101841|ref|YP_003553699.1|  .............-------------------------------------------------..
gi|294102070|ref|YP_003553928.1|  .............-------------------------------------------------..
gi|294102221|ref|YP_003554079.1|  .............-------------------------------------------------..
gi|294101356|ref|YP_003553214.1|  .............-------------------------------------------------..
gi|294101345|ref|YP_003553203.1|  .............-------------------------------------------------..
gi|294102145|ref|YP_003554003.1|  .............-------------------------------------------------..
gi|294101756|ref|YP_003553614.1|  .............-------------------------------------------------..
gi|294102549|ref|YP_003554407.1|  .............-------------------------------------------------..
gi|294101372|ref|YP_003553230.1|  .............-------------------------------------------------..
gi|294101016|ref|YP_003552874.1|  .............-------------------------------------------------..
gi|294101780|ref|YP_003553638.1|  .............-------------------------------------------------..
gi|294101686|ref|YP_003553544.1|  .............-------------------------------------------------..
gi|294102507|ref|YP_003554365.1|  .............-------------------------------------------------..
gi|294101471|ref|YP_003553329.1|  .............-------------------------------------------------..
gi|294101845|ref|YP_003553703.1|  .............-------------------------------------------------..
gi|294101553|ref|YP_003553411.1|  .............-------------------------------------------------..
gi|294101853|ref|YP_003553711.1|  .............-------------------------------------------------..
gi|294101780|ref|YP_003553638.1|  .............-------------------------------------------------..
gi|294102079|ref|YP_003553937.1|  .............-------------------------------------------------..
gi|294101472|ref|YP_003553330.1|  .............-------------------------------------------------..
gi|294102235|ref|YP_003554093.1|  .............-------------------------------------------------..
gi|294102390|ref|YP_003554248.1|  .............-------------------------------------------------..
gi|294101443|ref|YP_003553301.1|  .............-------------------------------------------------..
gi|294101748|ref|YP_003553606.1|  .............-------------------------------------------------..
gi|294101649|ref|YP_003553507.1|  .............-------------------------------------------------..
gi|294101715|ref|YP_003553573.1|  .............-------------------------------------------------..
gi|294101925|ref|YP_003553783.1|  .............-------------------------------------------------..
gi|294101367|ref|YP_003553225.1|  .............-------------------------------------------------..
gi|294101751|ref|YP_003553609.1|  .............-------------------------------------------------..
gi|294101046|ref|YP_003552904.1|  .............-------------------------------------------------..
gi|294101779|ref|YP_003553637.1|  .............-------------------------------------------------..
gi|294101226|ref|YP_003553084.1|  .............-------------------------------------------------..
gi|294101892|ref|YP_003553750.1|  .............-------------------------------------------------..
gi|294102315|ref|YP_003554173.1|  .............-------------------------------------------------..
gi|294102188|ref|YP_003554046.1|  .............-------------------------------------------------..
gi|294102320|ref|YP_003554178.1|  .............-------------------NLESFFNSLDKKLKQLDRKKDYDKYIETVK..
gi|294102169|ref|YP_003554027.1|  .............-------------------------------------------------..
gi|294101254|ref|YP_003553112.1|  .............-------------------------------------------------..
gi|294102077|ref|YP_003553935.1|  .............-------------------------------------------------..
gi|294102510|ref|YP_003554368.1|  .............-------------------------------------------------..
gi|294101748|ref|YP_003553606.1|  .............-------------------------------------Y-----------..
gi|294101141|ref|YP_003552999.1|  .............-------------------------------------------------..
gi|294101018|ref|YP_003552876.1|  .............-------------------------------------------------..
gi|294101692|ref|YP_003553550.1|  .............-------------------------------------------------..
gi|294101032|ref|YP_003552890.1|  .............-------------------------------------------------..
gi|294101031|ref|YP_003552889.1|  .............-------------------------------------------------..
gi|294101431|ref|YP_003553289.1|  .............-------------------------------------------------..
gi|294102167|ref|YP_003554025.1|  .............-------------------------------------------------..
gi|294101458|ref|YP_003553316.1|  .............--------------------------H----------------------..
gi|294102320|ref|YP_003554178.1|  .............-------------------------------------------------..
gi|294101940|ref|YP_003553798.1|  .............-------------------------------------------------..
gi|294102120|ref|YP_003553978.1|  .............-------------------------------------------------..
gi|294101791|ref|YP_003553649.1|  .............-------------------------------------------------..
gi|294102136|ref|YP_003553994.1|  .............-------------------------------------------------..
gi|294101830|ref|YP_003553688.1|  .............-------------------------------------------------..
gi|294102042|ref|YP_003553900.1|  .............-------------------------------------------------..
gi|294102015|ref|YP_003553873.1|  .............-------------------------------------------------..
gi|294102787|ref|YP_003554645.1|  .............-------------------------------------------------..
gi|294102032|ref|YP_003553890.1|  .............-------------------------------------------------..
gi|294102010|ref|YP_003553868.1|  .............-------------------------------------------------..
gi|294101586|ref|YP_003553444.1|  .............-------------------------------------------------..
gi|294101458|ref|YP_003553316.1|  .............-------------------------------------------------..
gi|294102625|ref|YP_003554483.1|  .............-------------------------------------------------..
gi|294102478|ref|YP_003554336.1|  .............-------------------------------------------------..
gi|294101874|ref|YP_003553732.1|  .............-------------------------------------------------..
gi|294102071|ref|YP_003553929.1|  .............-------------------------------------------------..


                                    50        60        70        80        90       100          11
                                     |         |         |         |         |         |            
d1g6oa_                             .VVWVLKNNGEWQPFDVRDRKAFSLSRLMHFARCCASFKKKTIDNYENPILSSN...LANGERV
gi|294102520|ref|YP_003554378.1|  .-----------------------------------------------------...-------
gi|294102529|ref|YP_003554387.1|  .-----------------------------------------------------...-------
gi|294102437|ref|YP_003554295.1|  .-----------------------------------------------------...-------
gi|294102168|ref|YP_003554026.1|  .-----------------------------------------------------...-------
gi|294101779|ref|YP_003553637.1|  .-----------------------------------------------------...-------
gi|294102457|ref|YP_003554315.1|  .-----------------------------------------------------...-------
gi|294101625|ref|YP_003553483.1|  .-----------------------------------------------------...-------
gi|294101185|ref|YP_003553043.1|  .-----------------------------------------------------...-------
gi|294102626|ref|YP_003554484.1|  .-----------------------------------------------------...-------
gi|294101765|ref|YP_003553623.1|  sRVRFRIDGYCRAVY------SFSLDFHPAIISRIKIMASMDISDKRRPQDGQFnikTGSQDFL
gi|294102479|ref|YP_003554337.1|  .-----------------------------------------------------...-------
gi|294101904|ref|YP_003553762.1|  .-----------------------------------------------------...-------
gi|294102557|ref|YP_003554415.1|  .-----------------------------------------------------...-------
gi|294101807|ref|YP_003553665.1|  .---------------------------------------------------F-...-------
gi|294101806|ref|YP_003553664.1|  .-----------------------------------------------------...-------
gi|294102649|ref|YP_003554507.1|  .-----------------------------------------------------...-------
gi|294101185|ref|YP_003553043.1|  .-----------------------------------------------------...-------
gi|294102868|ref|YP_003554726.1|  .-----------------------------------------------------...-------
gi|294102500|ref|YP_003554358.1|  .-----------------------------------------------------...-------
gi|294102409|ref|YP_003554267.1|  .-----------------------------------------------------...-------
gi|294102354|ref|YP_003554212.1|  .-----------------------------------------------------...-------
gi|294101565|ref|YP_003553423.1|  .-----------------------------------------------------...-------
gi|294101424|ref|YP_003553282.1|  .-----------------------------------------------------...-------
gi|294101976|ref|YP_003553834.1|  .-------D---------------------------------------------...-------
gi|294101061|ref|YP_003552919.1|  .-----------------------------------------------------...-------
gi|294101048|ref|YP_003552906.1|  .-----------------------------------------------------...-------
gi|294101977|ref|YP_003553835.1|  .-----------------------------------------------------...-------
gi|294101084|ref|YP_003552942.1|  .-----------------------------------------------------...-------
gi|294101565|ref|YP_003553423.1|  .----SILEGLRDRYES----HHRVKISDDALVAAARLSSRYITERFLPDKAID...LIDEAAA
gi|294101786|ref|YP_003553644.1|  .-----------------------------------------------------...-------
gi|294101493|ref|YP_003553351.1|  .-----------------------------------------------------...-------
gi|294101884|ref|YP_003553742.1|  .-----------------------------------------------------...-------
gi|294101894|ref|YP_003553752.1|  .-----------------------------------------------------...-------
gi|294101778|ref|YP_003553636.1|  .-----------------------------------------------------...-------
gi|294102313|ref|YP_003554171.1|  .-----------------------------------------------------...-------
gi|294102640|ref|YP_003554498.1|  .-----------------------------------------------------...-------
gi|294101376|ref|YP_003553234.1|  .-----------------------------------------------------...-------
gi|294102641|ref|YP_003554499.1|  .-----------------------------------------------------...-------
gi|294101359|ref|YP_003553217.1|  .-----------------------------------------------------...-------
gi|294102459|ref|YP_003554317.1|  .-----------------------------------------------------...-------
gi|294101785|ref|YP_003553643.1|  .-----------------------------------------------------...-------
gi|294101376|ref|YP_003553234.1|  .-----------------------------------------------------...-------
gi|294102074|ref|YP_003553932.1|  .-----------------------------------------------------...-------
gi|294102442|ref|YP_003554300.1|  .-----------------------------------------------------...-------
gi|294101577|ref|YP_003553435.1|  .-----------------------------------------------------...-------
gi|294101171|ref|YP_003553029.1|  .-----------------------------------------------------...-------
gi|294102413|ref|YP_003554271.1|  .-----------------------------------------------------...-------
gi|294102187|ref|YP_003554045.1|  .QVFVERWGKIEPTDVF----FNNDNHIRRIIDKIVAPLGRRIDEAS-PMVDAR...LPDGSRV
gi|294102332|ref|YP_003554190.1|  .-----------------------------------------------------...-------
gi|294102831|ref|YP_003554689.1|  .-----------------------------------------------------...-------
gi|294101321|ref|YP_003553179.1|  .-----------------------------------------------------...-------
gi|294101626|ref|YP_003553484.1|  .-----------------------------------------------------...-------
gi|294101069|ref|YP_003552927.1|  .-----------------------------------------------------...-------
gi|294102759|ref|YP_003554617.1|  .-----------------------------------------------------...-------
gi|294101055|ref|YP_003552913.1|  .-----------------------------------------------------...-------
gi|294101254|ref|YP_003553112.1|  .-----------------------------------------------------...-------
gi|294102760|ref|YP_003554618.1|  .-----------------------------------------------------...-------
gi|294101659|ref|YP_003553517.1|  .-----------------------------------------------------...-------
gi|294101172|ref|YP_003553030.1|  .-----------------------------------------------------...-------
gi|294102017|ref|YP_003553875.1|  .-----------------------------------------------------...-------
gi|294101748|ref|YP_003553606.1|  .-----------------------------------------------------...-------
gi|294102409|ref|YP_003554267.1|  .-----------------------------------------------------...-------
gi|294102070|ref|YP_003553928.1|  .-----------------------------------------------------...-------
gi|294102390|ref|YP_003554248.1|  .-----------------------------------------------------...-------
gi|294101403|ref|YP_003553261.1|  .-----------------------------------------------------...-------
gi|294101730|ref|YP_003553588.1|  .-----------------------------------------------------...-------
gi|294102602|ref|YP_003554460.1|  .-----------------------------------------------------...-------
gi|294102663|ref|YP_003554521.1|  .-----------------------------------------------------...-------
gi|294101436|ref|YP_003553294.1|  .-----------------------------------------------------...-------
gi|294102150|ref|YP_003554008.1|  .-----------------------------------------------------...-------
gi|294101607|ref|YP_003553465.1|  .-----------------------------------------------------...-------
gi|294102035|ref|YP_003553893.1|  .-----------------------------------------------------...-------
gi|294102412|ref|YP_003554270.1|  .-----------------------------------------------------...-------
gi|294101660|ref|YP_003553518.1|  .-----------------------------------------------------...-------
gi|294102549|ref|YP_003554407.1|  .-----------------------------------------------------...-------
gi|294102841|ref|YP_003554699.1|  .-----------------------------------------------------...-------
gi|294101272|ref|YP_003553130.1|  .-----------------------------------------------------...-------
gi|294101433|ref|YP_003553291.1|  .-----------------------------------------------------...-------
gi|294101963|ref|YP_003553821.1|  .-----------------------------------------------------...-------
gi|294101356|ref|YP_003553214.1|  .-----------------------------------------------------...-------
gi|294102542|ref|YP_003554400.1|  .-----------------------------------------------------...-------
gi|294101861|ref|YP_003553719.1|  .-----------------------------------------------------...-------
gi|294102400|ref|YP_003554258.1|  .-----------------------------------------------------...-------
gi|294102043|ref|YP_003553901.1|  .-----------------------------------------------------...-------
gi|294101077|ref|YP_003552935.1|  .-----------------------------------------------------...-------
gi|294102348|ref|YP_003554206.1|  .-----------------------------------------------------...-------
gi|294102040|ref|YP_003553898.1|  .-----------------------------------------------------...-------
gi|294101613|ref|YP_003553471.1|  .-----------------------------------------------------...-------
gi|294101367|ref|YP_003553225.1|  .-----------------------------------------------------...-------
gi|294101893|ref|YP_003553751.1|  .-----------------------------------------------------...-------
gi|294101841|ref|YP_003553699.1|  .-----------------------------------------------------...-------
gi|294102070|ref|YP_003553928.1|  .-----------------------------------------------------...-------
gi|294102221|ref|YP_003554079.1|  .-----------------------------------------------------...-------
gi|294101356|ref|YP_003553214.1|  .-----------------------------------------------------...-------
gi|294101345|ref|YP_003553203.1|  .-----------------------------------------------------...-------
gi|294102145|ref|YP_003554003.1|  .-----------------------------------------------------...-------
gi|294101756|ref|YP_003553614.1|  .-----------------------------------------------------...-------
gi|294102549|ref|YP_003554407.1|  .-----------------------------------------------------...-------
gi|294101372|ref|YP_003553230.1|  .-----------------------------------------------------...-------
gi|294101016|ref|YP_003552874.1|  .-----------------------------------------------------...-------
gi|294101780|ref|YP_003553638.1|  .-----------------------------------------------------...-------
gi|294101686|ref|YP_003553544.1|  .-----------------------------------------------------...-------
gi|294102507|ref|YP_003554365.1|  .-----------------------------------------------------...-------
gi|294101471|ref|YP_003553329.1|  .-----------------------------------------------------...-------
gi|294101845|ref|YP_003553703.1|  .-----------------------------------------------------...-------
gi|294101553|ref|YP_003553411.1|  .-----------------------------------------------------...-------
gi|294101853|ref|YP_003553711.1|  .-----------------------------------------------------...-------
gi|294101780|ref|YP_003553638.1|  .-----------------------------------------------------...-------
gi|294102079|ref|YP_003553937.1|  .-----------------------------------------------------...-------
gi|294101472|ref|YP_003553330.1|  .-----------------------------------------------------...-------
gi|294102235|ref|YP_003554093.1|  .-----------------------------------------------------...-------
gi|294102390|ref|YP_003554248.1|  .-----------------------------------------------------...-------
gi|294101443|ref|YP_003553301.1|  .-----------------------------------------------------...-------
gi|294101748|ref|YP_003553606.1|  .-----------------------------------------------------...-------
gi|294101649|ref|YP_003553507.1|  .-----------------------------------------------------...-------
gi|294101715|ref|YP_003553573.1|  .-----------------------------------------------------...-------
gi|294101925|ref|YP_003553783.1|  .-----------------------------------------------------...-------
gi|294101367|ref|YP_003553225.1|  .-----------------------------------------------------...-------
gi|294101751|ref|YP_003553609.1|  .-----------------------------------------------------...-------
gi|294101046|ref|YP_003552904.1|  .-----------------------------------------------------...-------
gi|294101779|ref|YP_003553637.1|  .-----------------------------------------------------...-------
gi|294101226|ref|YP_003553084.1|  .-----------------------------------------------------...-------
gi|294101892|ref|YP_003553750.1|  .-----------------------------------------------------...-------
gi|294102315|ref|YP_003554173.1|  .-----------------------------------------------------...-------
gi|294102188|ref|YP_003554046.1|  .-----------------------------------------------------...-------
gi|294102320|ref|YP_003554178.1|  .ENAREIRNKVLKYLMV-------------------------------------...-------
gi|294102169|ref|YP_003554027.1|  .-----------------------------------------------------...-------
gi|294101254|ref|YP_003553112.1|  .-----------------------------------------------------...-------
gi|294102077|ref|YP_003553935.1|  .-----------------------------------------------------...-------
gi|294102510|ref|YP_003554368.1|  .-----------------------------------------------------...-------
gi|294101748|ref|YP_003553606.1|  .-----------------------------------------------------...-------
gi|294101141|ref|YP_003552999.1|  .---------------------------------------K-------------...-------
gi|294101018|ref|YP_003552876.1|  .-----------------------------------------------------...-------
gi|294101692|ref|YP_003553550.1|  .-----------------------------------------------------...-------
gi|294101032|ref|YP_003552890.1|  .-----------------------------------------------------...-------
gi|294101031|ref|YP_003552889.1|  .-----------------------------------------------------...-------
gi|294101431|ref|YP_003553289.1|  .-----------------------------------------------------...-------
gi|294102167|ref|YP_003554025.1|  .-----------------------------------------------------...-------
gi|294101458|ref|YP_003553316.1|  .-----------------------------------------------------...-------
gi|294102320|ref|YP_003554178.1|  .-----------------------------------------------------...-------
gi|294101940|ref|YP_003553798.1|  .-----------------------------------------------------...-------
gi|294102120|ref|YP_003553978.1|  .-----------------------------------------------------...-------
gi|294101791|ref|YP_003553649.1|  .-----------------------------------------------------...-------
gi|294102136|ref|YP_003553994.1|  .-----------------------------------------------------...-------
gi|294101830|ref|YP_003553688.1|  .-----------------------------------------------------...-------
gi|294102042|ref|YP_003553900.1|  .-----------------------------------------------------...-------
gi|294102015|ref|YP_003553873.1|  .-----------------------------------------------------...-------
gi|294102787|ref|YP_003554645.1|  .-----------------------------------------------------...-------
gi|294102032|ref|YP_003553890.1|  .-----------------------------------------------------...-------
gi|294102010|ref|YP_003553868.1|  .-----------------------------------------------------...-------
gi|294101586|ref|YP_003553444.1|  .-----------------------------------------------------...-------
gi|294101458|ref|YP_003553316.1|  .--------------------------------D--------------------...-------
gi|294102625|ref|YP_003554483.1|  .-----------------------------------------------------...-------
gi|294102478|ref|YP_003554336.1|  .-----------------------------------------------------...-------
gi|294101874|ref|YP_003553732.1|  .-----------------------------------------------------...-------
gi|294102071|ref|YP_003553929.1|  .-----------------------------------------------------...-------


                                    0       120       130       140       150                  160  
                                    |         |         |         |         |                    |  
d1g6oa_                             QIVLSPVTVNDETISISIRIPSKTTYPHSFFEEQGFYNLLD.......NK....EQAISAIKDG
gi|294102520|ref|YP_003554378.1|  -------------------E---------------------.......--....----------
gi|294102529|ref|YP_003554387.1|  -----------------------------------------.......--....----------
gi|294102437|ref|YP_003554295.1|  ----------------------------------K------.......--....----------
gi|294102168|ref|YP_003554026.1|  -----------------------------------------.......--....----------
gi|294101779|ref|YP_003553637.1|  -----------------------------------------.......--....----------
gi|294102457|ref|YP_003554315.1|  -----------------------------------------.......--....----------
gi|294101625|ref|YP_003553483.1|  -----------------------------------------.......--....----------
gi|294101185|ref|YP_003553043.1|  -----------------------------------------.......--....----------
gi|294102626|ref|YP_003554484.1|  -----------------------------------------.......--....----------
gi|294101765|ref|YP_003553623.1|  DVRVSSLPT-VDGEKIALRLLDSSKIP----DNIYQLGFEQ.......RD....LELLE--KLL
gi|294102479|ref|YP_003554337.1|  ----------------------------QGAIKMEDVWFAY.......KDe...QWVLKGVALE
gi|294101904|ref|YP_003553762.1|  --------------------------------SLTHLTKIFtk.....GKes..FKAVDDVHLD
gi|294102557|ref|YP_003554415.1|  -----------------------------------------.......NR....VRAVDRVDLH
gi|294101807|ref|YP_003553665.1|  -----------------------------------------.......--....----------
gi|294101806|ref|YP_003553664.1|  -----------------------------------------.......--....--VVDA-FFP
gi|294102649|ref|YP_003554507.1|  ------------------------------MISIQNLYKTYpceg...GD....FEALRNVSIN
gi|294101185|ref|YP_003553043.1|  -----------------------------------------.......--....-RARSGIKDP
gi|294102868|ref|YP_003554726.1|  -------------------------------LQLKQLNKKF.......GH....SYAVRDFSFD
gi|294102500|ref|YP_003554358.1|  -----------------------------------------.......--....----------
gi|294102409|ref|YP_003554267.1|  -----------------------------------------.......--....----------
gi|294102354|ref|YP_003554212.1|  -----------------------------------------.......--....----------
gi|294101565|ref|YP_003553423.1|  -----------------------------------------.......--....----------
gi|294101424|ref|YP_003553282.1|  -------------------------------IEVKNLHKSF.......GN....LHVLQGVSMT
gi|294101976|ref|YP_003553834.1|  -----------------------------------------.......--....----------
gi|294101061|ref|YP_003552919.1|  -------------------------------LRVEDIHKSY.......GG....VEVLRGISFT
gi|294101048|ref|YP_003552906.1|  -----------------------------------------.......-A....VVAVRGVSLA
gi|294101977|ref|YP_003553835.1|  -----------------------------------------.......--....--------FP
gi|294101084|ref|YP_003552942.1|  ------------------------------LIHVENLYKSF.......ED....GEVLNGISID
gi|294101565|ref|YP_003553423.1|  RARLKTM----------------------------------.......--....----------
gi|294101786|ref|YP_003553644.1|  -------------------------------LKVDHLKKHFytpy...GT....LFAVDDVSFS
gi|294101493|ref|YP_003553351.1|  -------------------------------VRVDNIYKTYsm.....GEvd..VTALQGVSFS
gi|294101884|ref|YP_003553742.1|  -----------------------------------------.......--....----------
gi|294101894|ref|YP_003553752.1|  -----------------------------------------.......--....----------
gi|294101778|ref|YP_003553636.1|  -----------------------------------------.......--....--------AK
gi|294102313|ref|YP_003554171.1|  -------------------------------VNIKELTKRYpm.....GDht..FTALSSVDLE
gi|294102640|ref|YP_003554498.1|  -------------------------------LDIRNLKKYFnvsk...GL....LHAVDDITLT
gi|294101376|ref|YP_003553234.1|  -----------------------------------------.......--....PQVFD--RLG
gi|294102641|ref|YP_003554499.1|  ------------------------------LLDIRNLSVRF.......NTdsgiVHAVNNLNLS
gi|294101359|ref|YP_003553217.1|  -----------------------------------------.......--....----------
gi|294102459|ref|YP_003554317.1|  -----------------------------------------.......--....--------AP
gi|294101785|ref|YP_003553643.1|  -------------------------------LEIRNLRVSYeted...GT....VEALNGIDLD
gi|294101376|ref|YP_003553234.1|  -----------------------------------------.......--....-------KFN
gi|294102074|ref|YP_003553932.1|  -----------------------------------------.......--....----------
gi|294102442|ref|YP_003554300.1|  -------------------------------IRLAGVTKIFq......PD....IVALEDVYLS
gi|294101577|ref|YP_003553435.1|  --------------------------------KARKVCKAF.......KG....RTVVSSVDLD
gi|294101171|ref|YP_003553029.1|  ------------------------------LLELNGVDKFF.......GG....VHAVQSMSFA
gi|294102413|ref|YP_003554271.1|  -------------------------------LETKGLTMCF.......GG....LTAVNSFNMA
gi|294102187|ref|YP_003554045.1|  NAVIPPVS--IDGPTLTVRKFRREPFTAQDLIALGTLS---.......--....DESVSFLRVA
gi|294102332|ref|YP_003554190.1|  -------------------------------IRISGLRKRY.......GSgdtaVDALKMVNMH
gi|294102831|ref|YP_003554689.1|  -----------------------------------------.......--....----------
gi|294101321|ref|YP_003553179.1|  -----------------------------------------.......--....----------
gi|294101626|ref|YP_003553484.1|  -----------------------------------------.......--....----------
gi|294101069|ref|YP_003552927.1|  -------------------------------LSVDDLHFSY.......GE....TPILKNISLS
gi|294102759|ref|YP_003554617.1|  ------------------------------MIEIVDLSITYktes...HD....VSAVKNAFLS
gi|294101055|ref|YP_003552913.1|  -------------------------------LEIHQLAVAF.......NN....KKILKNINAN
gi|294101254|ref|YP_003553112.1|  ------------------------------LVQMQEITKEF.......AG....IVANHNIDFD
gi|294102760|ref|YP_003554618.1|  -----------------------------------KVSVFYpsrdgknSG....QWALRNISLS
gi|294101659|ref|YP_003553517.1|  ---------------------------------LQGVGFSY.......PEad..SSALDQVSFQ
gi|294101172|ref|YP_003553030.1|  ------------------------------LLDVQNLQVSY.......GA....IRALRGISLQ
gi|294102017|ref|YP_003553875.1|  -----------------------------------------.......--....--VPNDIVLD
gi|294101748|ref|YP_003553606.1|  -----------------------------------------.......--....----------
gi|294102409|ref|YP_003554267.1|  -----------------------------------------.......--....----------
gi|294102070|ref|YP_003553928.1|  -----------------------------------------.......--....----------
gi|294102390|ref|YP_003554248.1|  -----------------------------------------.......--....----------
gi|294101403|ref|YP_003553261.1|  -----------------------------------------.......--....----------
gi|294101730|ref|YP_003553588.1|  -----------------------------------------.......--....----------
gi|294102602|ref|YP_003554460.1|  -----------------------------------------.......--....----------
gi|294102663|ref|YP_003554521.1|  ---------------------------------VSNLNLFY.......GK....NQVLHNINMD
gi|294101436|ref|YP_003553294.1|  -----------------------------------------.......--....----------
gi|294102150|ref|YP_003554008.1|  -----------------------------------------.......--....----------
gi|294101607|ref|YP_003553465.1|  -----------------------------------------.......--....----------
gi|294102035|ref|YP_003553893.1|  -----------------------------------------.......--....----------
gi|294102412|ref|YP_003554270.1|  -------------------------------LKIEELHVYY.......GG....IHAVKGISLH
gi|294101660|ref|YP_003553518.1|  -------------------------------IIIKNLTHTYhpst...PLe...TVALEGINLT
gi|294102549|ref|YP_003554407.1|  ---------------------------------ISRLTKTF.......GT....LRAVDDFSLE
gi|294102841|ref|YP_003554699.1|  -------------------------------VVFEDVSFGY.......ENg...TMVLDQASFQ
gi|294101272|ref|YP_003553130.1|  ------------------------------MLRLSHLGKKY.......NG....LPVIDQFDLD
gi|294101433|ref|YP_003553291.1|  -----------------------------------------.......--....----------
gi|294101963|ref|YP_003553821.1|  -----------------------------------------.......--....----------
gi|294101356|ref|YP_003553214.1|  --------------------FPQCPRSGQEVISVKDVKKTY.......GD....NLIFKDISFS
gi|294102542|ref|YP_003554400.1|  ---------------------------------LKNIKHFY.......SQ....RCVLQIPSLE
gi|294101861|ref|YP_003553719.1|  -----------------------------------------.......--....----------
gi|294102400|ref|YP_003554258.1|  -----------------------------------------.......--....----------
gi|294102043|ref|YP_003553901.1|  -----------------------------------------.......--....----------
gi|294101077|ref|YP_003552935.1|  ------------------------------LLRLKSIAFAY.......PRs...SPLFTHLSFE
gi|294102348|ref|YP_003554206.1|  ------------------------------LLKVDSITVRR.......DN....ATILKDISLR
gi|294102040|ref|YP_003553898.1|  -----------------------------------------.......--....----------
gi|294101613|ref|YP_003553471.1|  -----------------------------------------.......--....----------
gi|294101367|ref|YP_003553225.1|  -----------------------------PLLKMENIGKAY.......FG....NRVLKDVSFT
gi|294101893|ref|YP_003553751.1|  -----------------------------------------.......--....---VRQLAGK
gi|294101841|ref|YP_003553699.1|  -----------------------------------------.......--....----------
gi|294102070|ref|YP_003553928.1|  -----------------------------------------.......--....----------
gi|294102221|ref|YP_003554079.1|  -----------------------------------------.......--....----------
gi|294101356|ref|YP_003553214.1|  --------------------------------QLVNITHFY.......GE....QGLYNSLNWS
gi|294101345|ref|YP_003553203.1|  ------------------------------LLATQDLSIGYgpkk...GT....TLVAGPIATS
gi|294102145|ref|YP_003554003.1|  -----------------------------------------.......--....----------
gi|294101756|ref|YP_003553614.1|  -----------------------------------------.......--....----------
gi|294102549|ref|YP_003554407.1|  -------------------------------LEMTRLTVSG.......DRg...KDVVKNLTLT
gi|294101372|ref|YP_003553230.1|  -----------------------------------------.......--....-------GFL
gi|294101016|ref|YP_003552874.1|  -----------------------------------------.......--....----------
gi|294101780|ref|YP_003553638.1|  -----------------------------------------.......--....----------
gi|294101686|ref|YP_003553544.1|  -----------------------------------------.......--....----------
gi|294102507|ref|YP_003554365.1|  -----------------------------------------.......GQ....AGAKRALEIA
gi|294101471|ref|YP_003553329.1|  -----------------------------------------.......-Q....IVLFSHLSVS
gi|294101845|ref|YP_003553703.1|  -----------------------------------------.......--....----------
gi|294101553|ref|YP_003553411.1|  -----------------------------------------.......--....----------
gi|294101853|ref|YP_003553711.1|  -----------------------------------------.......--....----------
gi|294101780|ref|YP_003553638.1|  -----------------------------------------.......--....-HNLKEIDVA
gi|294102079|ref|YP_003553937.1|  -----------------------------------------.......--....----------
gi|294101472|ref|YP_003553330.1|  -------------------------------LSVENLSILD.......EEn...KPLVRNVSFS
gi|294102235|ref|YP_003554093.1|  -----------------------------------------.......--....----------
gi|294102390|ref|YP_003554248.1|  -----------------------------------------.......--....----------
gi|294101443|ref|YP_003553301.1|  -----------------------------------------.......--....----------
gi|294101748|ref|YP_003553606.1|  -----------------------------------------.......--....----------
gi|294101649|ref|YP_003553507.1|  -----------------------------------------.......--....----------
gi|294101715|ref|YP_003553573.1|  -----------------------------------------.......--....----------
gi|294101925|ref|YP_003553783.1|  -----------------------------------------.......--....----------
gi|294101367|ref|YP_003553225.1|  -------------------------------LKVEHLWVDM.......P-....GETVRDVSFT
gi|294101751|ref|YP_003553609.1|  -----------------------------------------.......--....----------
gi|294101046|ref|YP_003552904.1|  -----------------------------------------.......--....----------
gi|294101779|ref|YP_003553637.1|  -----------------------------------------.......--....----------
gi|294101226|ref|YP_003553084.1|  -----------------------------------------.......--....----------
gi|294101892|ref|YP_003553750.1|  -----------------------------------------.......--....----------
gi|294102315|ref|YP_003554173.1|  -----------------------------------------.......--....----------
gi|294102188|ref|YP_003554046.1|  -----------------------------------------.......--....----------
gi|294102320|ref|YP_003554178.1|  -----------------------------------------.......--....----------
gi|294102169|ref|YP_003554027.1|  -----------------------------------------.......--....----------
gi|294101254|ref|YP_003553112.1|  -----------------------------------------.......-G....IPVVKDLSID
gi|294102077|ref|YP_003553935.1|  -----------------------------------------.......--....----------
gi|294102510|ref|YP_003554368.1|  -----------------------------------------.......--....----------
gi|294101748|ref|YP_003553606.1|  -----------------------------------------.......--....----------
gi|294101141|ref|YP_003552999.1|  -----------------------------------------.......--....----------
gi|294101018|ref|YP_003552876.1|  -----------------------------------------.......--....----------
gi|294101692|ref|YP_003553550.1|  -----------------------------------------.......--....----------
gi|294101032|ref|YP_003552890.1|  -----------------------------------------.......--....----------
gi|294101031|ref|YP_003552889.1|  -----------------------------------------.......--....----------
gi|294101431|ref|YP_003553289.1|  -----------------------------------------.......--....----------
gi|294102167|ref|YP_003554025.1|  -----------------------------------------.......--....----------
gi|294101458|ref|YP_003553316.1|  -----------------------------------------.......--....----------
gi|294102320|ref|YP_003554178.1|  -----------------------------------------.......--....----------
gi|294101940|ref|YP_003553798.1|  -----------------------------------------.......--....----------
gi|294102120|ref|YP_003553978.1|  -----------------------------------------.......--....---------C
gi|294101791|ref|YP_003553649.1|  -----------------------------------------.......--....----------
gi|294102136|ref|YP_003553994.1|  -----------------------------------------.......--....------LSLV
gi|294101830|ref|YP_003553688.1|  -----------------------------------------.......--....----------
gi|294102042|ref|YP_003553900.1|  -----------------------------------------.......--....----------
gi|294102015|ref|YP_003553873.1|  -----------------------------------------.......--....----------
gi|294102787|ref|YP_003554645.1|  -----------------------------------------.......--....----------
gi|294102032|ref|YP_003553890.1|  --------------------------------------KFI.......GQ....ERAVQAISFG
gi|294102010|ref|YP_003553868.1|  -----------------------------------------.......--....----------
gi|294101586|ref|YP_003553444.1|  -----------------------------------------.......--....----------
gi|294101458|ref|YP_003553316.1|  -----------------------------------------.......--....----------
gi|294102625|ref|YP_003554483.1|  -----------------------------------------.......--....----------
gi|294102478|ref|YP_003554336.1|  -----------------------------------------.......--....----------
gi|294101874|ref|YP_003553732.1|  -----------------------------------------.......--....----------
gi|294102071|ref|YP_003553929.1|  -----------------------------------------.......--....----------


                                            170       180         190                     200       
                                              |         |           |                       |       
d1g6oa_                             I...AIGKNVIVCGGTGSGKT.TYIK.SIMEFIP.....KE.....ERII.SI...E.DTEEI.
gi|294102520|ref|YP_003554378.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102529|ref|YP_003554387.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102437|ref|YP_003554295.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102168|ref|YP_003554026.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294101779|ref|YP_003553637.1|  -...------TLLGVTGSGKTfTVAN.VLAQFDR.....P-.....----.--...-.-----.
gi|294102457|ref|YP_003554315.1|  -...-----------------.----.-------.....--.....----.--...E.-----.
gi|294101625|ref|YP_003553483.1|  -...-----------------.----.-------.....--.....----.--...-.-M---.
gi|294101185|ref|YP_003553043.1|  -...KTKNNPVLIGDPGVGKT.AIVE.GLAQ---.....--.....----.--...-.-----.
gi|294102626|ref|YP_003554484.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294101765|ref|YP_003553623.1|  S...QKEGLILVTGPTGSGKS.TTLH.ALIKQVN.....ALt....LNVT.TI...E.DPVER.
gi|294102479|ref|YP_003554337.1|  V...CPGERVAVVGETGGGKS.TLMD.LIPRFYD.....PS.....RGKV.SV...D.GCDVRt
gi|294101904|ref|YP_003553762.1|  I...DAGELITFLGPSGCGKT.TILR.MIAGFEK.....PT.....EGQV.LI...G.GRDITh
gi|294102557|ref|YP_003554415.1|  V...KEGELITLLGPSGCGKT.TLLR.MIAGFED.....PT.....EGDV.FF...G.DRRVNd
gi|294101807|ref|YP_003553665.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294101806|ref|YP_003553664.1|  I...AKGGTACVPGPFGSGKT.VIQH.QLAK---.....--.....----.--...-.-----.
gi|294102649|ref|YP_003554507.1|  I...QSGEIFGIIGLSGAGKS.TLLR.TLNRLEE.....PS.....SGSI.CI...G.DTDITr
gi|294101185|ref|YP_003553043.1|  R...RPVGSFIFLGPTGVGKT.ELAK.TLAEALF.....DS.....EDNM.IR...I.DMSEYm
gi|294102868|ref|YP_003554726.1|  I...NEGELVSLLGPSGCGKT.TTLR.MIGGFLQ.....PD.....EGSI.IL...E.GEDITh
gi|294102500|ref|YP_003554358.1|  -...--PKNILMVGPTGVGKT.EIAR.RLADLVL.....--.....----.--...-.-----.
gi|294102409|ref|YP_003554267.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102354|ref|YP_003554212.1|  -...-----VAIAAHGGAGKT.SLVE.AIL----.....--.....----.--...-.-----.
gi|294101565|ref|YP_003553423.1|  R...RPVGSFLFLGPTGVGKT.ELAR.RLADFLF.....GS.....EDAM.IR...L.DMSEFm
gi|294101424|ref|YP_003553282.1|  V...GEGEVVSVIGPSGSGKS.TLAR.CICRLED.....IN.....DGEI.YL...Y.GQRVDn
gi|294101976|ref|YP_003553834.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294101061|ref|YP_003552919.1|  V...RKGETKVFIGPSGTGKS.TLLR.CINQLTI.....PD.....SGQI.WL...H.GEEVTh
gi|294101048|ref|YP_003552906.1|  A...RQGEVFVIMGLSGSGKS.TLIR.CVIRLIE.....PT.....SGEI.WV...N.GQEVSs
gi|294101977|ref|YP_003553835.1|  I...AIGGAAVLPGGFGTGKT.VTQQ.SLAKWCN.....A-.....----.--...-.-----.
gi|294101084|ref|YP_003552942.1|  I...HEGDLVSIIGPSGCGKS.TFLR.CLNCLEY.....ID.....SGTI.TI...A.GVTVSr
gi|294101565|ref|YP_003553423.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294101786|ref|YP_003553644.1|  I...KEGETLGVVGESGCGKS.TLGR.AVLRLCE.....PT.....SGTV.FF...D.GEDVLk
gi|294101493|ref|YP_003553351.1|  V...KKGEFLSIMGASGSGKS.TLMN.IIGCLDT.....PT.....EGHY.YL...D.GTDVSt
gi|294101884|ref|YP_003553742.1|  -...---LVIGITGSPGAGKS.TLVD.KLILEFRkkk..KT.....VGII.AV...D.PSSPFs
gi|294101894|ref|YP_003553752.1|  -...-QKSNVLLIGPTGSGKT.LLAQ.SLAKKLN.....--.....----.--...-.-----.
gi|294101778|ref|YP_003553636.1|  V...PKG--VLLLGPPGTGKT.LLAR.AAAGEAD.....VP.....FFSV.SG...S.DFV--.
gi|294102313|ref|YP_003554171.1|  F...KKGEFCGLIGPSGSGKT.TLLN.IIGALDA.....PS.....EGSV.VV...I.DRNVEn
gi|294102640|ref|YP_003554498.1|  I...TKGQTLGLVGESGCGKS.TLGR.VVIGLIE.....AT.....GGEV.LF...K.GQDALk
gi|294101376|ref|YP_003553234.1|  V...QPPKGVLLYGPPGTGKT.VIAR.AVANETD.....VY.....FTH-.-I...S.GPEII.
gi|294102641|ref|YP_003554499.1|  L...RRGKALGFVGETGAGKT.TTAL.AVLQLIQsppgeIT.....NGEI.FF...D.GQDVMk
gi|294101359|ref|YP_003553217.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102459|ref|YP_003554317.1|  I...GKGQRALLVSPPKAGKT.TVLK.KIANAVT.....VN.....----.--...-.HPDI-.
gi|294101785|ref|YP_003553643.1|  L...DEGVTLGIVGETGAGKT.TLAK.SIMRIIPtppghIE.....SGTI.LY...K.NKDILg
gi|294101376|ref|YP_003553234.1|  I...TPPQGILLHGPSGTGKT.LLVR.ALAHESG.....--.....VNFI.PV...K.GPALM.
gi|294102074|ref|YP_003553932.1|  -...-----FVISGPSGAGKG.TVRK.ALFEQMP.....DL.....----.--...-.-----.
gi|294102442|ref|YP_003554300.1|  I...MQGEFVYLVGTTGSGKT.TLMR.LITRELI.....QT.....RGQV.TV...G.DQNLRk
gi|294101577|ref|YP_003553435.1|  V...HMGEIVGLLGPNGAGKT.TTFY.MIVGLIK.....PD.....SGRV.MI...D.SKDITp
gi|294101171|ref|YP_003553029.1|  L...NEKEIVGLIGPNGAGKT.TIFN.VVTGVYD.....PD.....GGRI.LF...D.GEDITp
gi|294102413|ref|YP_003554271.1|  V...PKGSIVGLIGPNGAGKT.TVFN.MITGFYK.....PT.....EGNI.FF...N.EDNITg
gi|294102187|ref|YP_003554045.1|  T...EARYNIIVTGGTGSGKT.TTLN.VLSSFIP.....NR.....ERIV.TI...E.DAAELs
gi|294102332|ref|YP_003554190.1|  V...APGEVVGLIGPSGSGKS.TLLK.CLGAVIE.....PT.....AGQM.ML...G.DDVIYh
gi|294102831|ref|YP_003554689.1|  -...------------GVGKT.TTCV.NLSAELG.....--.....----.--...-.-----.
gi|294101321|ref|YP_003553179.1|  -...--------IGHIDHGKT.TLTA.AITKCLS.....--.....----.--...-.-----.
gi|294101626|ref|YP_003553484.1|  -...--------IGHIDHGKT.TLTA.AITKCLS.....--.....----.--...-.-----.
gi|294101069|ref|YP_003552927.1|  V...KNQEMVMILGPNGSGKT.TLLR.CLNGINR.....PQ.....KGTI.TL...E.DKNMRr
gi|294102759|ref|YP_003554617.1|  I...PRGRITGLVGESGSGKS.SLLM.AIPGLLP.....SNtev..SGAV.IF...D.NLNLIs
gi|294101055|ref|YP_003552913.1|  I...YPHQITAIIGPSGCGKS.TFLK.SLNRLVE.....DErgvtlSGQI.RL...D.GEDTFt
gi|294101254|ref|YP_003553112.1|  V...NRGEVHALLGENGAGKS.TLMN.ILYGLYN.....PD.....RGHI.LI...D.GKKVSf
gi|294102760|ref|YP_003554618.1|  L...QQGESLALIGESGSGKT.SLLR.VLLGLIS.....PT.....EGNV.EL...F.GENIDk
gi|294101659|ref|YP_003553517.1|  V...REGEWLALLGSNGSGKS.TLAK.HLNALLL.....PS.....QGAC.FV...Y.GMDTRe
gi|294101172|ref|YP_003553030.1|  V...KEGEIVCVIGANGAGKS.TLMN.ALMSEVR.....RE.....KGLI.NF...S.GAPLAq
gi|294102017|ref|YP_003553875.1|  G...DEERIALITGPNMAGKS.TYLR.MAA----.....--.....----.--...-.-----.
gi|294101748|ref|YP_003553606.1|  -...------LLVGDVGFGKT.EI--.-------.....--.....----.--...-.-----.
gi|294102409|ref|YP_003554267.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102070|ref|YP_003553928.1|  -...-----VSIVGRPNVGKS.SLVN.ALAGS--.....--.....-DRV.LV...S.DIP--.
gi|294102390|ref|YP_003554248.1|  -...--PMHRLLQGDVGSGKT.----.-------.....--.....----.--...-.-----.
gi|294101403|ref|YP_003553261.1|  L...PKGRIVEIFGPEGSGKT.TVA-.-------.....--.....----.--...-.-----.
gi|294101730|ref|YP_003553588.1|  -...-----YLFSGPRGCGKT.TLAR.LLAKSLN.....CT.....GQKQ.SV...-.-----.
gi|294102602|ref|YP_003554460.1|  -...--------------GKT.TLID.SIFKAAQ.....IF.....RKGA.HI...E.ERV--.
gi|294102663|ref|YP_003554521.1|  I...FGKTVTALIGPSGCGKS.SFIR.CLNRMND.....FIpnvkvEGDI.YL...E.GKNIYs
gi|294101436|ref|YP_003553294.1|  -...------GIVGLPLCGKS.TVFN.VITR---.....--.....----.--...-.-----.
gi|294102150|ref|YP_003554008.1|  -...--------------GKS.TLAD.RLIEY--.....--.....----.--...-.-----.
gi|294101607|ref|YP_003553465.1|  -...------VTSGKGGVGKT.TTTA.NVSFALA.....KA.....GYKV.VA...I.DADIGl
gi|294102035|ref|YP_003553893.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102412|ref|YP_003554270.1|  I...PKGKIVTLIGANGAGKS.STIR.SIAGLVR.....SA.....KGKI.LYtsnE.GVEENi
gi|294101660|ref|YP_003553518.1|  T...EKGQWLSIVGHTGSGKS.TLAQ.HLNALIV.....PE.....KGEV.IV...E.GFVSRp
gi|294102549|ref|YP_003554407.1|  I...ASGTVHSLVGENGAGKS.TVVK.CVYGLYS.....PT.....AGKF.KI...D.NKILTi
gi|294102841|ref|YP_003554699.1|  V...PQGEFLVIIGPNGGGKT.TLLR.LILGLEK.....PA.....RGKI.EV...L.GTTPDr
gi|294101272|ref|YP_003553130.1|  I...EKGSFSVLIGPSGCGKS.TLFD.LLTGTIE.....RE.....YGTM.EW...I.GEAVPh
gi|294101433|ref|YP_003553291.1|  -...---------GKGGVGKS.SISC.LLAVALA.....KK.....GFSV.GI...L.DADITg
gi|294101963|ref|YP_003553821.1|  -...----IVTVMGHVDHGKT.TLLD.YI-----.....--.....----.--...-.-----.
gi|294101356|ref|YP_003553214.1|  V...HRGEKIALVGVNGAGKS.TLSR.LISQSEV.....PT.....EGNI.SY...G.YNV--.
gi|294102542|ref|YP_003554400.1|  I...GQGEILGLLGANGSGKS.TLLR.ILAFLET.....PT.....EGTV.YF...K.KERVEt
gi|294101861|ref|YP_003553719.1|  -...---DHILFYGPPGLGKT.TLAG.IIAHEMG.....G-.....----.--...-.-----.
gi|294102400|ref|YP_003554258.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102043|ref|YP_003553901.1|  -...---------GIDGCGKS.TQAA.FLKEQLQ.....--.....----.--...-.-----.
gi|294101077|ref|YP_003552935.1|  I...FEKEKIYIRGENGAGKT.TLFS.LIMGLLR.....PQ.....KGDI.IV...K.GKVIKn
gi|294102348|ref|YP_003554206.1|  V...ESGEVTGVLGRNGAGKS.SLAY.ALMGLPDyi...PV.....KGSI.SF...L.GEDITs
gi|294102040|ref|YP_003553898.1|  -...---KVIVLVGVNGSGKT.TTAA.KLAEQFH.....RQ.....GKKV.IL...G.AADTFr
gi|294101613|ref|YP_003553471.1|  -...--PGFTAIVGPNGSGKS.NILD.-------.....--.....----.--...-.-----.
gi|294101367|ref|YP_003553225.1|  L...EKGQILGLVGENGAGKS.TLMN.ILFGMPV.....IQetggyEGKF.FI...N.GQEAQf
gi|294101893|ref|YP_003553751.1|  E...AKGQVLCFVGPPGVGKT.SLAQ.SIARALG.....RR.....FVNF.SL...G.GVRDEa
gi|294101841|ref|YP_003553699.1|  -...-----VGLVGLPNAGKS.SLLA.AISNARP.....KI.....AG--.--...-.-----.
gi|294102070|ref|YP_003553928.1|  -...-----IAIVGRPNVGKS.SLFN.RILG---.....--.....RREA.IV...D.DMP--.
gi|294102221|ref|YP_003554079.1|  -...-KRQFVFFGGKGGTGKT.TCAA.AYAYALS.....RL.....----.GI...K.TLVVSt
gi|294101356|ref|YP_003553214.1|  I...THGSKTGLIGSNGTGKT.TLFK.IIMGLVE.....PR.....EGNV.YF...P.KGI--.
gi|294101345|ref|YP_003553203.1|  L...YEGELVCLIGPNGVGKT.TLLK.TLAGTQN.....PL.....GGEI.RV...L.ESSLAe
gi|294102145|ref|YP_003554003.1|  -...--------------GKT.TLVK.ALTGV--.....--.....----.--...-.-----.
gi|294101756|ref|YP_003553614.1|  -...-------IVGRPNVGKS.SLLN.NILAY--.....--.....----.--...-.-----.
gi|294102549|ref|YP_003554407.1|  V...HRGEIVGIAGITGNGQS.ELEE.AISGLRF.....VK.....EGQL.LM...G.KRDITh
gi|294101372|ref|YP_003553230.1|  L...REGIRVALVGRPNVGKS.SLLN.ALLKESR.....--.....----.--...-.-----.
gi|294101016|ref|YP_003552874.1|  -...-----LFIWGGVGLGKT.HLMH.AIGHYVL.....NK.....NNS-.--...-.-----.
gi|294101780|ref|YP_003553638.1|  -...------VITGPSGSGKS.SLA-.-------.....--.....FDTL.YA...E.GQRRY.
gi|294101686|ref|YP_003553544.1|  -...-SGGVVLLGGQPGIGKS.TLLL.QVCGAMA.....ARg....ERVL.YI...S.GEESAs
gi|294102507|ref|YP_003554365.1|  A...AGHHNLLFIGSPGSGKT.MLAR.AIRGIVP.....PL.....SHEE.LL...E.SLQIHs
gi|294101471|ref|YP_003553329.1|  F...KKGEVVGLVGPSGKGKT.TLGD.ILLGLIV.....PD.....RGKV.LW...K.GQDIRt
gi|294101845|ref|YP_003553703.1|  -...FKGRFIAITGESGAGKS.SIVR.AL-----.....--.....----.--...-.-----.
gi|294101553|ref|YP_003553411.1|  -...KPPTLCMMVGLQGSGKT.TSAV.KIAKRI-.....--.....----.--...-.-----.
gi|294101853|ref|YP_003553711.1|  -...----HLLVAGTTGSGKS.VFVNsCIAGL--.....--.....----.--...-.-----.
gi|294101780|ref|YP_003553638.1|  I...PSRVFSCISGVSGSGKS.SLLY.DVLY---.....--.....KGMK.RI...L.DKDFRe
gi|294102079|ref|YP_003553937.1|  -...----VVAIDGPAGAGKS.SVAK.KVAELLG.....LD.....----.--...-.-----.
gi|294101472|ref|YP_003553330.1|  I...PSESVFFLVGETGSGKT.PIAQ.AIAGTLA.....KRlsv..CGKV.FL...K.KQNLLs
gi|294102235|ref|YP_003554093.1|  -...-----LALAGNPNTGKT.SLFN.LLTGSRQ.....--.....----.--...-.-----.
gi|294102390|ref|YP_003554248.1|  -...-----------------.----.-------.....-Q.....----.--...-.-----.
gi|294101443|ref|YP_003553301.1|  -...-----CVLYGPPGVGKT.TLVR.LMAM---.....--.....----.--...-.-----.
gi|294101748|ref|YP_003553606.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294101649|ref|YP_003553507.1|  -...----RVILLGPPGAGKG.TQAA.EIKTKYK.....--.....----.--...-.-----.
gi|294101715|ref|YP_003553573.1|  -...---HVLVVTGPNTGGKT.VALK.TVG----.....--.....MGIIlAW...C.GFPLPa
gi|294101925|ref|YP_003553783.1|  -...----HCAILGSTGSGKS.NTTV.SILRAIL.....NDydg..SRVI.LI...D.PHGEYa
gi|294101367|ref|YP_003553225.1|  V...KEGEIFGIGGLAGQGKL.GIAN.GIMGMYP.....S-.....GGTV.TF...D.ETPIIl
gi|294101751|ref|YP_003553609.1|  M...RAHDIVFAIGPAGTGKT.YLA-.-------.....--.....----.--...-.-----.
gi|294101046|ref|YP_003552904.1|  -...-------LSAPTGAGKT.LVAY.LWAGLLT.....TE.....GKAQ.MP...E.GIS--.
gi|294101779|ref|YP_003553637.1|  -...-------LLGVTGSGKTfTVAN.VLAQFDR.....P-.....----.--...-.-----.
gi|294101226|ref|YP_003553084.1|  -...-------LIGNPNVGKS.VIFS.RLTGVRA.....IS.....SN--.--...-.-----.
gi|294101892|ref|YP_003553750.1|  -...-----VAFVGRSNVGKS.MLLN.ALME---.....--.....----.--...-.-----.
gi|294102315|ref|YP_003554173.1|  -...------MIIGMTGSGKT.GLGI.ALLE---.....--.....----.--...-.-----.
gi|294102188|ref|YP_003554046.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102320|ref|YP_003554178.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102169|ref|YP_003554027.1|  -...-----INIIGSPGAGKT.TLLE.A------.....--.....----.--...-.-----.
gi|294101254|ref|YP_003553112.1|  V...REREILGLAGIAGNGQQ.ELCE.ALAGLRP.....LK.....EGRI.MI...D.DEELTh
gi|294102077|ref|YP_003553935.1|  -...----TVALTGYTNSGKS.TLLQ.QLSH---.....--.....----.--...-.-----.
gi|294102510|ref|YP_003554368.1|  -...----RLAVVGIPNVGKS.LFLN.LLVGKKR.....--.....----.--...-.-----.
gi|294101748|ref|YP_003553606.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294101141|ref|YP_003552999.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294101018|ref|YP_003552876.1|  -...---GLNLLVGNNGSGKT.NALE.AIHILSGwgp..FRss...RKSF.LV...NwDTEEK.
gi|294101692|ref|YP_003553550.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294101032|ref|YP_003552890.1|  -...---------GKGGTGKT.CIAA.SLALSLS.....--.....KGTA.ID...L.DVDEP.
gi|294101031|ref|YP_003552889.1|  -...-PKEIVIISGKGGTGKT.CIMA.ALCSSF-.....--.....SGKA.VF...C.DVDVDa
gi|294101431|ref|YP_003553289.1|  -...--TKVIVIAGPSGSGKT.TTAK.RL-----.....--.....----.--...-.-----.
gi|294102167|ref|YP_003554025.1|  -...-----LGVTGDVGAGKS.TV--.-------.....--.....----.--...-.-----.
gi|294101458|ref|YP_003553316.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102320|ref|YP_003554178.1|  -...-----VFISDVVGLGKT.YISA.MLAGQLD.....--.....GRTL.VI...A.PPVLLe
gi|294101940|ref|YP_003553798.1|  V...YPGEMLNLAGAQGSLKT.SLA-.-------.....--.....----.--...-.-----.
gi|294102120|ref|YP_003553978.1|  V...EDGSSLILGGGTGVGKT.HLAI.AMIQELT.....AK.....GKSA.VF...V.PVVE-.
gi|294101791|ref|YP_003553649.1|  V...YSGLTILLYGDLGAGKT.VLVK.GL-----.....--.....----.--...-.-----.
gi|294102136|ref|YP_003553994.1|  F...SQG-INILSGTNGTCKT.SLLH.IVSNSFQe....VN.....KGCP.WV...T.DAS--.
gi|294101830|ref|YP_003553688.1|  -...-----LIITGMSGAGKS.TVLN.ILED---.....--.....QGLF.AV...D.NIPP-.
gi|294102042|ref|YP_003553900.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102015|ref|YP_003553873.1|  -...----ILAIIGPTAVGKT.KLSL.EIAETLK.....--.....AEVI.SV...D.SRQVYr
gi|294102787|ref|YP_003554645.1|  -...PA-GLSLILGDNESGKT.TLMS.FL-----.....--.....----.--...-.-----.
gi|294102032|ref|YP_003553890.1|  LsveSKGYNIFVLGNPGSGRT.S---.-------.....--.....----.--...-.-----.
gi|294102010|ref|YP_003553868.1|  -...---KAVAVTGALGSGKT.EWVL.NMALALL.....EA.....GEKV.TI...A.DIDIIn
gi|294101586|ref|YP_003553444.1|  -...-----FAVSGMKNSGKT.KLCL.LLLKYLK.....E-.....----.--...-.-----.
gi|294101458|ref|YP_003553316.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102625|ref|YP_003554483.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294102478|ref|YP_003554336.1|  -...-----------------.----.-------.....--.....----.--...-.-----.
gi|294101874|ref|YP_003553732.1|  -...----VIAFVGPAGTGKS.QRAQ.YVATDNN.....VDyiid.DGLV.IA...R.GRIMTg
gi|294102071|ref|YP_003553929.1|  -...-----------------.----.-------.....--.....----.--...-.-----.


                                                       210          220                             
                                                         |            |                             
d1g6oa_                             .................VFKHHKNYTQLFF...GGN..ITSADC....................
gi|294102520|ref|YP_003554378.1|  .................-------------...---..------....................
gi|294102529|ref|YP_003554387.1|  .................------------D...---..------....................
gi|294102437|ref|YP_003554295.1|  .................-------------...---..------....................
gi|294102168|ref|YP_003554026.1|  .................-------------...---..------....................
gi|294101779|ref|YP_003553637.1|  .................-------------...---..------....................
gi|294102457|ref|YP_003554315.1|  .................-------------...---..------....................
gi|294101625|ref|YP_003553483.1|  .................-------------...---..------....................
gi|294101185|ref|YP_003553043.1|  .................-------------...---..------....................
gi|294102626|ref|YP_003554484.1|  .................-------------...---..------....................
gi|294101765|ref|YP_003553623.1|  .................---FHEGINQVEVde.RAG..RTFEVV....................
gi|294102479|ref|YP_003554337.1|  ............ldlteLRKQIGIVPQDPV...LMK..GSLAFNisygfpqateedivkaaqia
gi|294101904|ref|YP_003553762.1|  ..............lavNKRDIGFVFQNYA...LFPh.MSIFDNvayglkvrglsrkeaelkvk
gi|294102557|ref|YP_003554415.1|  ..............vapNHRNATMVFQSYA...IFPh.LNVYENiafglrlkkmeeskirekme
gi|294101807|ref|YP_003553665.1|  .................-------------...---..------....................
gi|294101806|ref|YP_003553664.1|  .................-------------...---..------....................
gi|294102649|ref|YP_003554507.1|  .........lstpelrkLRRRVGMIFQHFN...LLTs.RTVFQNvafpleiekwetdaiskrvt
gi|294101185|ref|YP_003553043.1|  .................EKFSVSRLIGAPP...GYVg.YEEGGQ....................
gi|294102868|ref|YP_003554726.1|  ..............lppEKRPTATVFQSYA...LFPh.MTVLQNviyglkfkkidrkkamqmgd
gi|294102500|ref|YP_003554358.1|  .................-------------...---..------....................
gi|294102409|ref|YP_003554267.1|  .................-------------...---..------....................
gi|294102354|ref|YP_003554212.1|  .................-------------...---..------....................
gi|294101565|ref|YP_003553423.1|  .................ERHEVGKLIGAPP...GYVg.YDEGGK....................
gi|294101424|ref|YP_003553282.1|  ..........gkhsnkeVATLVGMIFQQFN...LFPh.LSVLDNitlcpiqakgmkkkeaedla
gi|294101976|ref|YP_003553834.1|  .................-------------...---..------....................
gi|294101061|ref|YP_003552919.1|  ..........skksinvLRQKMGMVFQNFY...LFDh.LTALRNveiallkvkgmdkkhareka
gi|294101048|ref|YP_003552906.1|  ........lpkkdltefRRKQIAMVFQHYG...LLPh.KTIIDNvefglklqgisekerrersn
gi|294101977|ref|YP_003553835.1|  .................-------------...---..------....................
gi|294101084|ref|YP_003552942.1|  tgkekeldksfleachhMRQEVGMVFQSFN...LFPh.RTVLENvmlapmvvkkaseeeaheia
gi|294101565|ref|YP_003553423.1|  .................-------------...---..------....................
gi|294101786|ref|YP_003553644.1|  .........fnkakmkkMRSQMQIIFQDPYas.LNPr.MTVSQSiaapliiqgvykssekdkiq
gi|294101493|ref|YP_003553351.1|  ........idenqladiRKNTIGFVFQGFN...LLPr.MTALENvelpmlysgisarkrheral
gi|294101884|ref|YP_003553742.1|  .............ggaiL------------...---..------....................
gi|294101894|ref|YP_003553752.1|  .................-------------...---..------....................
gi|294101778|ref|YP_003553636.1|  .................---------EMFV...GVGa.ARVRDL....................
gi|294102313|ref|YP_003554171.1|  ........lshkesaqlRNHHIGFIFQTYN...LFPv.YNVYENiefpllllkipqkerkekif
gi|294102640|ref|YP_003554498.1|  .........fnnaqkreFHKQAQIVFQDPFss.LNPr.MSVSQLiaepllinkacgsrkevdnk
gi|294101376|ref|YP_003553234.1|  .................---------GKFY...GESe.ERLRNV....................
gi|294102641|ref|YP_003554499.1|  ........mteaekrdiRGSKIAMIFQDPMts.LNPi.MTVEEQimemislhsdfkgeavrkra
gi|294101359|ref|YP_003553217.1|  .................-------------...---..------....................
gi|294102459|ref|YP_003554317.1|  .................-------------...---..------....................
gi|294101785|ref|YP_003553643.1|  ........mtsseirkvRGEQVSMIFQDPMts.LNPi.MIVGDQiaeaikthmhvssakatkka
gi|294101376|ref|YP_003553234.1|  .................---------SKYV...GESe.RAIREV....................
gi|294102074|ref|YP_003553932.1|  .................-------------...---..------....................
gi|294102442|ref|YP_003554300.1|  .........lrasqlpyYRRYLGVVFQDFK...LLPh.LTAWENvafvlesmgmprrmvqkrtn
gi|294101577|ref|YP_003553435.1|  ...........fpmfrrARIGVGYLPQEAS...IFRn.LTVKENieivlqelgkpqkeietmvs
gi|294101171|ref|YP_003553029.1|  ...........lktyevIRKGIARTFQNLR...LFPr.SSVLENvmtaaqqheaysfveavthf
gi|294102413|ref|YP_003554271.1|  ...........fppnkvCESGIARTFQNIR...LFSn.ETVLQNvmigchvrqkskwwmapfpv
gi|294102187|ref|YP_003554045.1|  ...............mqQDHVVRME-SRPVnieGTGa.ITIRML....................
gi|294102332|ref|YP_003554190.1|  ......dgwkvkdlralRRDHIGFVFQAPY...LIPf.LDVTDNvallpmlagkpnaearqqai
gi|294102831|ref|YP_003554689.1|  .................-------------...---..------....................
gi|294101321|ref|YP_003553179.1|  .................-------------...---..------....................
gi|294101626|ref|YP_003553484.1|  .................-------------...---..------....................
gi|294101069|ref|YP_003552927.1|  ............msgreIARRIGYVPQSSE...KVR..LTAFDAillgrrpyvgwrlaesdikk
gi|294102759|ref|YP_003554617.1|  ........lrpemlnaiRWKDIALIPQGAMns.FTPv.LTIGKHieevlaihlglsgearrhrc
gi|294101055|ref|YP_003552913.1|  ............lspeeVRRRIGMVFQSPT...PFP..FSIYDNmayplryygygskkksknld
gi|294101254|ref|YP_003553112.1|  ...........sspkdaIAAGIGMVHQHFM...LIPs.QTVWENmilgleglpqllpkkeihqq
gi|294102760|ref|YP_003554618.1|  .........cshsqlieLRRRCGYVPQDPYgs.LPPt.LTVLDAvaepwiivngrksrleaysk
gi|294101659|ref|YP_003553517.1|  ...........eknlwaIRSHVAMVFQNPDn..QIV..GTVVEDdtafgpeniglspleirqrv
gi|294101172|ref|YP_003553030.1|  ............rsydvVKQGISLVPEGRR...VFAp.LTVYENlmmgafprkepekvkqdlqw
gi|294102017|ref|YP_003553875.1|  .................-------------...---..------....................
gi|294101748|ref|YP_003553606.1|  .................-------------...---..------....................
gi|294102409|ref|YP_003554267.1|  .................-------------...---..------....................
gi|294102070|ref|YP_003553928.1|  .................-------------...---..------....................
gi|294102390|ref|YP_003554248.1|  .................-------------...---..------....................
gi|294101403|ref|YP_003553261.1|  .................-------------...---..------....................
gi|294101730|ref|YP_003553588.1|  .................-------------...---..------....................
gi|294102602|ref|YP_003554460.1|  .................-------------...---..------....................
gi|294102663|ref|YP_003554521.1|  ..........gatdviaLRRQVGMVFQKPN...PFP..MAIYDNvaygprlqgiksrekldeiv
gi|294101436|ref|YP_003553294.1|  .................-------------...---..------....................
gi|294102150|ref|YP_003554008.1|  .................-------------...---..------....................
gi|294101607|ref|YP_003553465.1|  .................RNLDVVMGLENRV...VYNf.IDVIEGtcrlpqalirdkrvdnlfll
gi|294102035|ref|YP_003553893.1|  .................-------------...---..------....................
gi|294102412|ref|YP_003554270.1|  .........lgktpefiVKKGIAMSPEGRR...ILPh.LTVEENlllgayirddkegiekdmdh
gi|294101660|ref|YP_003553518.1|  ..........ksqdlrkIRRLVGLVFQYPEqq.LFA..ETVFDEvafaprnwgvseedlekvvn
gi|294102549|ref|YP_003554407.1|  ...........ktprdaMKYGIGMVHQHFM...LVPs.LPVYKNvvlgdepttrglifnhhgai
gi|294102841|ref|YP_003554699.1|  .................AVTSVGYVPQEGVrdkIFP..VSVFDVvlmgrlgigrrkifteedkk
gi|294101272|ref|YP_003553130.1|  .................LGQIAAYMQQKDL...LLPw.LSLMQNamlpqvfskekhlrknkkak
gi|294101433|ref|YP_003553291.1|  ....psvpklmgvtdspYGSPQGIIPPASS...IFD..IKVMSV....................
gi|294101963|ref|YP_003553821.1|  .................-------------...---..------....................
gi|294101356|ref|YP_003553214.1|  .................---KMGFFSQESAqn.LNYn.RTIWEEisntgylgtdtekrgllgaf
gi|294102542|ref|YP_003554400.1|  .............vsvnYRRSVTLLLQNTY...LLK..RAVWENvafglkvrgvrgkelmksme
gi|294101861|ref|YP_003553719.1|  .................-------------...---..------....................
gi|294102400|ref|YP_003554258.1|  .................------R------...---..------....................
gi|294102043|ref|YP_003553901.1|  .................-------------...---..------....................
gi|294101077|ref|YP_003552935.1|  ...........qkdlryLRQTIGFLFQDPDdq.LFC..PTLLDDvlfgplngginkeeayeqai
gi|294102348|ref|YP_003554206.1|  ...........wsitdrAKAGLTLAWQMPA...RYEg.ISIRDYlrigpqnssernleeamdfv
gi|294102040|ref|YP_003553898.1|  ......aaaidqlkiwgERTGSRVIAQQQG...SDSa.AVAYDA....................
gi|294101613|ref|YP_003553471.1|  .................-------------...---..------....................
gi|294101367|ref|YP_003553225.1|  ...........kspfdaLDAGIGMVHQEFS...LIPg.FTAAENivlnrestqynflvesfgdr
gi|294101893|ref|YP_003553751.1|  ...............eiRGHRRTYVG----...---..------....................
gi|294101841|ref|YP_003553699.1|  .................-------------...---..------....................
gi|294102070|ref|YP_003553928.1|  .................-------------...---..------....................
gi|294102221|ref|YP_003554079.1|  ................dPAHSLADAFNRPI...GLDv.IPVAENlwgieidaeeeakkymkaiq
gi|294101356|ref|YP_003553214.1|  .................---RIGYLSQDLV...EIE..DTVLLHylkkqagialvekelratee
gi|294101345|ref|YP_003553203.1|  ............lshkkRAQLLSFVISGRPa..IQG..FSVFELvalgrhpytnwkgeledrdi
gi|294102145|ref|YP_003554003.1|  .................-------------...---..------....................
gi|294101756|ref|YP_003553614.1|  .................-------------...---..------....................
gi|294102549|ref|YP_003554407.1|  ...........lpplkrRKLGLAYIPEDRIktgLAPl.ASLKDNallgyqykppflkrnffqnf
gi|294101372|ref|YP_003553230.1|  .................-------------...---..------....................
gi|294101016|ref|YP_003552874.1|  .................-------------...---..------....................
gi|294101780|ref|YP_003553638.1|  .................VESLSAYARQFLG...IQKk.PDVDDIsglspaisieqkgtshnprs
gi|294101686|ref|YP_003553544.1|  ..............qvaL------------...---..------....................
gi|294102507|ref|YP_003554365.1|  ................sA------------...---..------....................
gi|294101471|ref|YP_003553329.1|  .........lsktkkknLRPYFQKIHQDPGs..SFPq.NRLIRTifedffrwgyhpalssekew
gi|294101845|ref|YP_003553703.1|  .................-------------...---..------....................
gi|294101553|ref|YP_003553411.1|  .................-------------...---..------....................
gi|294101853|ref|YP_003553711.1|  .................-------------...---..------....................
gi|294101780|ref|YP_003553638.1|  .....ragkhlsidgaeQFRNVVLVDQSPI...GR-..-TPRSNpatytglftlirelfaelpe
gi|294102079|ref|YP_003553937.1|  .................-------------...---..------....................
gi|294101472|ref|YP_003553330.1|  ........vkekelkklWGRYLFLMPQEPSta.LNPl.LSVFRQvrevfqhlrgmdrhtartat
gi|294102235|ref|YP_003554093.1|  .................-------------...---..------....................
gi|294102390|ref|YP_003554248.1|  .................-------------...---..------....................
gi|294101443|ref|YP_003553301.1|  .................-------------...---..------....................
gi|294101748|ref|YP_003553606.1|  .................-------------...---..------....................
gi|294101649|ref|YP_003553507.1|  .................-------------...---..------....................
gi|294101715|ref|YP_003553573.1|  ................kEGTVVG-------...---..-----Nldnvfadigdeqsieqnlst
gi|294101925|ref|YP_003553783.1|  ..............safP------------...---..------....................
gi|294101367|ref|YP_003553225.1|  .ndprsplsvgiasvseDRRGVGLLLEEPI...SWNviFTALQMqqkylkpvlgglfkirdeea
gi|294101751|ref|YP_003553609.1|  .................-------------...---..------....................
gi|294101046|ref|YP_003552904.1|  .................-------------...---..------....................
gi|294101779|ref|YP_003553637.1|  .................-------------...---..------....................
gi|294101226|ref|YP_003553084.1|  .................-------------...---..------....................
gi|294101892|ref|YP_003553750.1|  .................-------------...---..------....................
gi|294102315|ref|YP_003554173.1|  .................-------------...---..------....................
gi|294102188|ref|YP_003554046.1|  .................-------------...---..------....................
gi|294102320|ref|YP_003554178.1|  .................-------------...---..------....................
gi|294102169|ref|YP_003554027.1|  .................-------------...---..------....................
gi|294101254|ref|YP_003553112.1|  ...........qppkqfIARGVRYIPADRKgtgLVPn.MDIKENsilkkywnkpvargpmidwk
gi|294102077|ref|YP_003553935.1|  .................-------------...---..------....................
gi|294102510|ref|YP_003554368.1|  .................-------------...---..------....................
gi|294101748|ref|YP_003553606.1|  .................-------------...---..------....................
gi|294101141|ref|YP_003552999.1|  .................-------------...---..------....................
gi|294101018|ref|YP_003552876.1|  .................QAYLRGYFSGET-...---..-----Nldivatvgekniiqcdgkri
gi|294101692|ref|YP_003553550.1|  .................-------------...---..------....................
gi|294101032|ref|YP_003552890.1|  .................---DLGLVLQ---...---..------....................
gi|294101031|ref|YP_003552889.1|  .................PNLQLLLNPQDEQ...AF-..------....................
gi|294101431|ref|YP_003553289.1|  .................-------------...---..------....................
gi|294102167|ref|YP_003554025.1|  .................-------------...---..------....................
gi|294101458|ref|YP_003553316.1|  .................-------------...---..------....................
gi|294102320|ref|YP_003554178.1|  ............ktnpgSWPNVFSDFRVPA...DYEs.IGRLDN....................
gi|294101940|ref|YP_003553798.1|  .................-------------...---..------....................
gi|294102120|ref|YP_003553978.1|  .................-------------...---..------....................
gi|294101791|ref|YP_003553649.1|  .................-------------...---..------....................
gi|294102136|ref|YP_003553994.1|  .................-------------...---..-----Cltaikkvnklinpkietltk
gi|294101830|ref|YP_003553688.1|  .................-------------...---..------....................
gi|294102042|ref|YP_003553900.1|  .................-------------...---..------....................
gi|294102015|ref|YP_003553873.1|  .............ymnvGTDKVTFQTRQHI...LHHm.LDVVD-....................
gi|294102787|ref|YP_003554645.1|  .................-------------...---..------....................
gi|294102032|ref|YP_003553890.1|  .................-------------...---..------....................
gi|294102010|ref|YP_003553868.1|  ..............pyfCIRQVS-------...---..------....................
gi|294101586|ref|YP_003553444.1|  .................-------------...---..------....................
gi|294101458|ref|YP_003553316.1|  .................-------------...---..------....................
gi|294102625|ref|YP_003554483.1|  .................-------------...---..------....................
gi|294102478|ref|YP_003554336.1|  .................-------------...---..------....................
gi|294101874|ref|YP_003553732.1|  ............ksaksE------------...---..------....................
gi|294102071|ref|YP_003553929.1|  .................-------------...---..------....................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  gihtfitslpegydtevgergvtlsggqrqrva...............................
gi|294101904|ref|YP_003553762.1|  evlnlvgligvderfphqlsggeqqrva....................................
gi|294102557|ref|YP_003554415.1|  gvidlvgltglesrqpsqlsggqqqrva....................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  evldlvdlsdkaqsypsqlsggqkqrvg....................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  emlakvglpdsasksidqlsggeqqrva....................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  irllervglgdkvyakpsqlsggqqqrva...................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  mlelervgmaafadhyptqlsggqaqrvs...................................
gi|294101048|ref|YP_003552906.1|  valervglkgwenyypsslsggmrqrvg....................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  lrllekvglsehahkypatlsggqtqrga...................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  kkvdqtmdlvglakrfansypheldggrrqrig...............................
gi|294101493|ref|YP_003553351.1|  halqivdledranhqpqqlsggqqqrva....................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  dalewlgltdkidsrpsqlsggecqrva....................................
gi|294102640|ref|YP_003554498.1|  vkelmdtvglaerlttsfpheldggrrqrig.................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  hemlalvgirpergkeyphqfsggmrqrvg..................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  semmelvgidpvrmsdyphqfsggmkqrvv..................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  evvdqvglwrrrflyppqlsggeqqrva....................................
gi|294101577|ref|YP_003553435.1|  hileelgltslasipgyalsggerrrve....................................
gi|294101171|ref|YP_003553029.1|  gkwrmketsirdrsmellnrvgladralqpagtlpygyqrrle.....................
gi|294102413|ref|YP_003554271.1|  psmiqeekeireksmkllqsvslaqdanvlssslpygaqrrle.....................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ellkaldvehrakampsqlsggeqqrva....................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  vdaiihtlgldelalryldemsggelqkvt..................................
gi|294102759|ref|YP_003554617.1|  rslleeadlewslanryphelsggqkqraa..................................
gi|294101055|ref|YP_003552913.1|  viirnkledvglfeevkdslsmnatllsggqqqrlc............................
gi|294101254|ref|YP_003553112.1|  iidisrqyglevdpdakiwqlsigeqqrva..................................
gi|294102760|ref|YP_003554618.1|  arrllktlgieeerillsrvrsglsggqrqrvs...............................
gi|294101659|ref|YP_003553517.1|  dwalsvtglshkmqnptyslsggekqrla...................................
gi|294101172|ref|YP_003553030.1|  vfslfprleerrdqyagtlsggeqqmla....................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  krsligaalwsevkdnlkssglglsggqqqrlc...............................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  paaqtrtkdavspdqmve..............................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  vyslfprlrerawqkggtlsggeqqmla....................................
gi|294101660|ref|YP_003553518.1|  etllevgipldfldrnpfqlsggekrria...................................
gi|294102549|ref|YP_003554407.1|  eavrhlsaqyglnidplapvhslpvgiqqrve................................
gi|294102841|ref|YP_003554699.1|  iamdvlehmglagrrndpmgdlsqgqrqrvl.................................
gi|294101272|ref|YP_003553130.1|  glferfglngfedylpgavsggmkqrca....................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  lfsgddiyklisvlsggeksrva.........................................
gi|294102542|ref|YP_003554400.1|  ealyfvglapsqfarrkwyelsggeaqrva..................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  nvlktlnidnlahtppyalsggqkrlga....................................
gi|294102348|ref|YP_003554206.1|  qmsplfldraidkslsggerkrie........................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  lrtlnteemrqrgenaieklnvvispdtlvsempvghkqfte......................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  dkmlhivsaviveeikrqieiaymspgaeeaaifdkfie.........................
gi|294101356|ref|YP_003553214.1|  diaraakneeeyhsllkrhdhlshryeqlggyefaamaqkvmkglgfsdgdgqrytstfsggwk
gi|294101345|ref|YP_003553203.1|  kavekalvevnawhlsgrdfaklsdgesqrvl................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  rsirefalhlmerynimaaseniqagtlsggnmqrlv...........................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  tvgtvteiydylrllygrlgvpycpscgkavirysldeivdvifrnypdqrleilspqvrgkkg
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  wnalgegmekaslserllhrypcqlsggelqrfa..............................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  skirgyapgrfsfnvrggrceacsgagsvkvsmlflpdvyvdcevcggtrynretlevrykgrn
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  qnlfsalgitqeasrerpgklsggmaqral..................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  fsahlkn.........................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  irevtkkyidtleikctgdyqrvqelsggnqqkvc.............................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  avfshainlvkkysvstpsietpvknlsggnlqklm............................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  thgnvrslipalaflpgdlaivdgapsvrrqfldrlcallfplyvrkmsdcrralrhrvillre
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  gdktyndpanqvkgtlftveyydhpslefrkhnskannryaikpyygknrgdtlpfcpviylgl
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  mris............................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  efknlfaqnrekgfmrvrvdgtiywleeeialdknkrhtievvidrlkvlddrkgriseaveaa
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  iadvlnmtvddafeffkeipriasklaliqeaglgyirlgqsaltlsggeaqrvk.........
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  rkdpsltskvlaplvswiwstraaavdllkigiqefrillpsdivltferggaldlqdpmqdyw
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  grlfpfgefqndeairgvkgelpstyqdeiktfyedftgisiessspqqmgdfktradfisdve
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  lslsggyvllvteggkeqlltenyacpdcgislpeieprlfsfnnpygacpdcsglgshehfse
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  esvrkwrekehitgvpqvgpqrddmiittkgqsvsivmsrgqrrrtavalmlaagwa.......
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  gidsntisagednlfilltaiislkyyy....................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ehaidpvrsveegallpwkkkhymlrklytfsqskewdltqpygtlpknvqnfilygsderlpm
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ffsdrgerhqymgryegllpwlegrwnetesenvleelagyrvedicqtchgyrlrpealmvql
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  nhhtidelvempvdrllpvlkemefteneqkimgqvmielekrlsflvdvgvgylslmrradtl
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                             230              240        250                        
                                               |                |          |                        
d1g6oa_                             .........LKSCL..RMR...P..DRIILGEL.RSSEAY............D.......FYNV
gi|294102520|ref|YP_003554378.1|  .........-----..---...-..--------.------............-.......----
gi|294102529|ref|YP_003554387.1|  .........-----..---...-..--------.------............-.......----
gi|294102437|ref|YP_003554295.1|  .........-----..---...-..--------.------............-.......----
gi|294102168|ref|YP_003554026.1|  .........-----..---...-..-------Y.------............-.......----
gi|294101779|ref|YP_003553637.1|  .........-----..---...-..--------.------............-.......----
gi|294102457|ref|YP_003554315.1|  .........-----..---...-..--------.------............-.......----
gi|294101625|ref|YP_003553483.1|  .........-----..---...-..--------.------............-.......----
gi|294101185|ref|YP_003553043.1|  .........-----..---...-..--------.------............-.......----
gi|294102626|ref|YP_003554484.1|  .........-----..---...-..--------.------............-.......-I--
gi|294101765|ref|YP_003553623.1|  .........LRSLL..RQD...P..DIILVGEI.RDSETA............Hl......VMRA
gi|294102479|ref|YP_003554337.1|  .........IARAI..IRN...P..RILILDEA.TSSLDVaves........Q.......IQEA
gi|294101904|ref|YP_003553762.1|  .........LARVL..VID...P..RVLLMDEP.LSNLDAklriymra....E.......IRKI
gi|294102557|ref|YP_003554415.1|  .........LARAI..IME...P..ALLLFDEP.LSNLDAklre........Qmri....EIRH
gi|294101807|ref|YP_003553665.1|  .........-----..---...-..--------.------............-.......----
gi|294101806|ref|YP_003553664.1|  .........-----..---...-..--------.------............-.......----
gi|294102649|ref|YP_003554507.1|  .........IARAL..ANN...P..SLLLCDEA.TSALDPktt.........Qsila...LLDE
gi|294101185|ref|YP_003553043.1|  .........LTEAV..RRR...Py.SVILFDEI.EKAHHDvf..........Nv......LLQI
gi|294102868|ref|YP_003554726.1|  .........LARSL..VTE...P..KVLLLDEP.LSNLDAklrirmrr....E.......----
gi|294102500|ref|YP_003554358.1|  .........-----..---...-..--------.------............-.......----
gi|294102409|ref|YP_003554267.1|  .........----V..VKD...G..EIIIVDEF.TGRLMFgrrysdglh...Q.......AIEA
gi|294102354|ref|YP_003554212.1|  .........-----..---...-..--------.------............-.......----
gi|294101565|ref|YP_003553423.1|  .........LTEAI..RRR...Py.SVVLFDEIeKAHEDVf...........Ni......LLQI
gi|294101424|ref|YP_003553282.1|  .........IARAL..AMQ...P..KIMLFDEP.TSALDPelvgevl.....Ev......IAQL
gi|294101976|ref|YP_003553834.1|  .........-----..---...-..--------.------............-.......----
gi|294101061|ref|YP_003552919.1|  .........IARAL..AMD...P..DVMLFDEP.TSALDPelig........E.......VLEV
gi|294101048|ref|YP_003552906.1|  .........IARAL..VMD...T..PILLMDEP.FSGLDPlirr........E.......MQDE
gi|294101977|ref|YP_003553835.1|  .........-----..---...-..--------.------............-.......----
gi|294101084|ref|YP_003552942.1|  .........IARAL..AMN...P..KVMLYDEP.TSALDPelvg........E.......VLQV
gi|294101565|ref|YP_003553423.1|  .........-----..---...-..--------.------............-.......----
gi|294101786|ref|YP_003553644.1|  .........IARAL..TLN...P..KFIVCDEP.VSALDVsiqa........Q.......ILNL
gi|294101493|ref|YP_003553351.1|  .........IARAL..AND...A..PLILADEP.TGNLDSktgi........D.......VMKL
gi|294101884|ref|YP_003553742.1|  .........-----..---...-..--------.------............-.......----
gi|294101894|ref|YP_003553752.1|  .........-----..---...-..--------.------............-.......----
gi|294101778|ref|YP_003553636.1|  .........FEQAR..KYQ...P..CIIFIDEM.------............-.......----
gi|294102313|ref|YP_003554171.1|  .........VARAV..VKR...P..ELILADEP.TANLDS............Ensyn...ILEM
gi|294102640|ref|YP_003554498.1|  .........VARAL..ALD...P..EFIVLDEP.VSALDVciqa........Q.......ILNL
gi|294101376|ref|YP_003553234.1|  .........FDEAQ..AHA...P..AIIFIDEI.------............-.......----
gi|294102641|ref|YP_003554499.1|  .........IAIAL..ACE...P..TLLIADEP.TTALDVtiqaqvl.....D.......LIKN
gi|294101359|ref|YP_003553217.1|  .........-----..---...-..KIVVLDEG.DHMLDLgfk.........E.......----
gi|294102459|ref|YP_003554317.1|  .........-----..---...-..--------.------............-.......----
gi|294101785|ref|YP_003553643.1|  .........IAMAL..ACN...P..KVLIADEP.TTALDVtiqaqvl.....E.......MMNE
gi|294101376|ref|YP_003553234.1|  .........FKKAK..QAS...P..SILYFDEI.ESLVPIrgrdsgagasftErv.....ISQF
gi|294102074|ref|YP_003553932.1|  .........-----..---...-..--------.------............-.......----
gi|294102442|ref|YP_003554300.1|  .........IARAM..ANS...P..AIFIADEP.TGNLDIhtae........D.......VMRL
gi|294101577|ref|YP_003553435.1|  .........IARCL..SIM...P..DFLLLDEP.FSGIDPiavy........D.......IQQI
gi|294101171|ref|YP_003553029.1|  .........IARAL..ALD...P..RLLLLDEP.AAGMNP............Eevm....ALNE
gi|294102413|ref|YP_003554271.1|  .........IARAL..ATD...P..SFLLLDEP.AAGMNPletv........D.......LMSF
gi|294102187|ref|YP_003554045.1|  .........VRNSL..RMR...P..DRIIVGEC.RGEEAF............D.......MLQA
gi|294102332|ref|YP_003554190.1|  .........IARGL..VNR...P..PVILADEP.TAPLDS............Erala...VIRI
gi|294102831|ref|YP_003554689.1|  .........-----..---...-..--------.------............-.......----
gi|294101321|ref|YP_003553179.1|  .........-----..---...-..--------.------............-.......----
gi|294101626|ref|YP_003553484.1|  .........-----..---...-..--------.------............-.......----
gi|294101069|ref|YP_003552927.1|  .........IARAL..VQE...P..RILLLDEP.ISSLDVknqi........E.......IMET
gi|294102759|ref|YP_003554617.1|  .........IATAL..ACD...P..DFLLADEP.TTALDVitqk........Eiil....T---
gi|294101055|ref|YP_003552913.1|  .........IARAL..AVE...P..EILLLDEP.CSSLDVkntqni......Em......MLRA
gi|294101254|ref|YP_003553112.1|  .........ILQML..YRK...A..QVLILDEP.TAVLTPq...........E.......ALRL
gi|294102760|ref|YP_003554618.1|  .........IARSL..ILE...P..ALLLCDEP.TSMQDAstrs........E.......IIHV
gi|294101659|ref|YP_003553517.1|  .........VAGAL..ALD...P..PCLVLDEP.TAMLDPqgrr........D.......LLDV
gi|294101172|ref|YP_003553030.1|  .........IGRAL..MSR...P..RLLLLDEP.SLGLAPiiir........D.......IFKE
gi|294102017|ref|YP_003553875.1|  .........-----..---...-..--------.------............-.......----
gi|294101748|ref|YP_003553606.1|  .........-----..---...-..--------.------............-.......----
gi|294102409|ref|YP_003554267.1|  .........-A---..---...-..--------.------............-.......----
gi|294102070|ref|YP_003553928.1|  .........-----..---...-..--------.------............-.......----
gi|294102390|ref|YP_003554248.1|  .........-----..---...-..--------.------............-.......----
gi|294101403|ref|YP_003553261.1|  .........-----..---...-..--------.------............-.......----
gi|294101730|ref|YP_003553588.1|  .........-----..---...-..--------.------............-.......----
gi|294102602|ref|YP_003554460.1|  .........-----..---...-..--------.------............-.......----
gi|294102663|ref|YP_003554521.1|  .........IARAI..ATE...P..EVLLMDEP.TSALDPmatarie.....E.......LVRT
gi|294101436|ref|YP_003553294.1|  .........-----..---...-..--------.------............-.......----
gi|294102150|ref|YP_003554008.1|  .........-----..---...-..--------.------............-.......----
gi|294101607|ref|YP_003553465.1|  .........LCEML..KKE...Gf.DFILLDSP.AGIEGGf...........K.......NAAA
gi|294102035|ref|YP_003553893.1|  .........-----..---...-..DIVILDEI.NVALDYelveld......Q.......VIDI
gi|294102412|ref|YP_003554270.1|  .........VGRAL..MSR...P..DLVMMDEP.SLGLAPmlvk........E.......VFDI
gi|294101660|ref|YP_003553518.1|  .........LASVL..AAE...P..AYLVLDEP.TAGLDAtgrk........D.......LIKL
gi|294102549|ref|YP_003554407.1|  .........ILKLL..YRK...A..EILIFDEP.TAVLSPrei.........Eglfs...IIRE
gi|294102841|ref|YP_003554699.1|  .........IARAL..ASR...P..RILLMDEP.LASIDP............Eargv...LYED
gi|294101272|ref|YP_003553130.1|  .........LIRTL..MFE...R..EIVLLDEP.LSALDAitrr........S.......LQSL
gi|294101433|ref|YP_003553291.1|  .........-----..---...-..-NLLLDDP.TK----............-.......----
gi|294101963|ref|YP_003553821.1|  .........-----..---...-..--------.------............-.......----
gi|294101356|ref|YP_003553214.1|  .........LLKLL..LEE...T..NLLILDEP.TNHLDMrtr.........D.......IFQQ
gi|294102542|ref|YP_003554400.1|  .........LASRL..AIK...P..EVLLLDEP.TASVDRvsa.........E.......LIKQ
gi|294101861|ref|YP_003553719.1|  .........-----..---...-..--------.------............-.......----
gi|294102400|ref|YP_003554258.1|  .........-----..---...-..--------.------............-.......----
gi|294102043|ref|YP_003553901.1|  .........-----..---...-..--------.------............-.......----
gi|294101077|ref|YP_003552935.1|  .........LAAVL..AMK...P..DLLLLDEP.SSGLDEraw.........Qn......LVDV
gi|294102348|ref|YP_003554206.1|  .........LASIY..LMK...P..RLAILDEP.DSGVDLlalr........Evlg....LLRL
gi|294102040|ref|YP_003553898.1|  .........LQAAR..ASG...A..DVLIID--.------............-.......----
gi|294101613|ref|YP_003553471.1|  .........-----..---...-..--------.------............-.......----
gi|294101367|ref|YP_003553225.1|  .........IAREI..DKK...Kt.QLLVLDEP.TAVLTEsea.........Ei......LLAS
gi|294101893|ref|YP_003553751.1|  .........-----..---...-..--------.------............-.......----
gi|294101841|ref|YP_003553699.1|  .........-----..---...-..--------.------............-.......----
gi|294102070|ref|YP_003553928.1|  .........-----..---...-..--------.------............-.......----
gi|294102221|ref|YP_003554079.1|  .........LMESI..GNP...Y..DVIVFDTA.------............-.......----
gi|294101356|ref|YP_003553214.1|  .........LAAML..LSS...P..DILLLDEP.TNHLDT............E.......SMEW
gi|294101345|ref|YP_003553203.1|  .........IARAL..AQD...T..PILLLDEP.TAFLDLprkv........E.......LLSL
gi|294102145|ref|YP_003554003.1|  .........-----..---...-..--------.------............-.......----
gi|294101756|ref|YP_003553614.1|  .........-----..---...-..--------.------............-.......----
gi|294102549|ref|YP_003554407.1|  .........MAREL..EQQ...P..DFLLVSQP.TRGVDIggisfih.....Dr......LLSL
gi|294101372|ref|YP_003553230.1|  .........-----..---...-..--------.------............-.......----
gi|294101016|ref|YP_003552874.1|  .........-----..---...-..--------.------............-.......----
gi|294101780|ref|YP_003553638.1|  sggesqrirLATQI..GSK...LsgVLYVLDEP.TIGLHSrdt.........Dr......LLRT
gi|294101686|ref|YP_003553544.1|  .........-----..---...-..--------.------............-.......----
gi|294102507|ref|YP_003554365.1|  .........-----..---...-..--------.------............-.......----
gi|294101471|ref|YP_003553329.1|  .........LLRAL..LFS...P..LFLVADEP.TSRLDPsvqa........Kvahml..V---
gi|294101845|ref|YP_003553703.1|  .........-----..---...-..--------.------............-.......----
gi|294101553|ref|YP_003553411.1|  .........-----..---...-..--------.------............-.......----
gi|294101853|ref|YP_003553711.1|  .........-----..---...-..--------.------............-.......----
gi|294101780|ref|YP_003553638.1|  .........LAKEL..SKRftgP..TLYLLDEP.TTGLFYtdvk........K.......LLHI
gi|294102079|ref|YP_003553937.1|  .........-----..---...-..--------.------............-.......----
gi|294101472|ref|YP_003553330.1|  .........LAMAL..ASP...A..EFILLDEP.TKGLDSsrk.........Edata...LVKG
gi|294102235|ref|YP_003554093.1|  .........-----..---...-..--------.------............-.......----
gi|294102390|ref|YP_003554248.1|  .........-----..---...-..--------.------............-.......----
gi|294101443|ref|YP_003553301.1|  .........-----..---...-..--------.------............-.......----
gi|294101748|ref|YP_003553606.1|  .........-----..---...-..--------.------............-.......VLQE
gi|294101649|ref|YP_003553507.1|  .........-----..---...-..--------.------............-.......----
gi|294101715|ref|YP_003553573.1|  .........IIHILseATR...S..SLVLLDEL.GAGTDPq...........EgaalgiaLIDT
gi|294101925|ref|YP_003553783.1|  .........-----..---...-..--------.------............-.......----
gi|294101367|ref|YP_003553225.1|  .........LAKAF..ALH...P..KLLFVSEP.TRGIDVgak.........Rv......VLDT
gi|294101751|ref|YP_003553609.1|  .........-----..---...-..--------.------............-.......----
gi|294101046|ref|YP_003552904.1|  .........-----..---...-..--------.------............-.......----
gi|294101779|ref|YP_003553637.1|  .........-----..---...-..--------.------............-.......----
gi|294101226|ref|YP_003553084.1|  .........-----..---...-..--------.------............-.......----
gi|294101892|ref|YP_003553750.1|  .........-----..---...-..--------.------............-.......----
gi|294102315|ref|YP_003554173.1|  .........-----..---...-..--------.------............-.......----
gi|294102188|ref|YP_003554046.1|  .........-----..---...-..-----D--.------............-.......----
gi|294102320|ref|YP_003554178.1|  .........-----..---...-..--------.------............-.......----
gi|294102169|ref|YP_003554027.1|  .........-----..---...-..--------.------............-.......----
gi|294101254|ref|YP_003553112.1|  .........LGREL..CDA...P..KALIAVHP.TWGLDV............A.......ATQF
gi|294102077|ref|YP_003553935.1|  .........-----..--G...R..NLYVADQL.FSTLDT............Y.......VRKV
gi|294102510|ref|YP_003554368.1|  .........-----..---...-..--------.------............-.......----
gi|294101748|ref|YP_003553606.1|  .........-----..---...-..--------.------............-.......----
gi|294101141|ref|YP_003552999.1|  .........-----..---...-..--------.------............-.......----
gi|294101018|ref|YP_003552876.1|  .........VERKL..RRK...-..PLLILDEI.AAELDD............-.......----
gi|294101692|ref|YP_003553550.1|  .........-----..--D...F..DVLICDEA.HRMVDAarsissvrvsweD.......LVRL
gi|294101032|ref|YP_003552890.1|  .........-----..---...-..--------.------............-.......----
gi|294101031|ref|YP_003552889.1|  .........-----..---...-..--------.------............-.......----
gi|294101431|ref|YP_003553289.1|  .........-----..---...-..--------.------............-.......----
gi|294102167|ref|YP_003554025.1|  .........-----..---...-..--------.------............-.......----
gi|294101458|ref|YP_003553316.1|  .........-----..---...-..--------.------............-.......----
gi|294102320|ref|YP_003554178.1|  .........LIERG..TEK...Y..TNIIIDEA.HRFRTEttity.......E.......KLAE
gi|294101940|ref|YP_003553798.1|  .........-----..---...-..--------.------............-.......----
gi|294102120|ref|YP_003553978.1|  .........-----..---...-..---ILDEI.RAGFDEgtay........K.......IQQA
gi|294101791|ref|YP_003553649.1|  .........-----..---...-..--------.------............-.......----
gi|294102136|ref|YP_003553994.1|  .........EATAL..SHE...Vt.SILLVDEI.DATLHPsily........K.......LLKL
gi|294101830|ref|YP_003553688.1|  .........-----..---...-..--------.------............-.......----
gi|294102042|ref|YP_003553900.1|  .........-----..---...-..--------.------............-.......----
gi|294102015|ref|YP_003553873.1|  .........-----..---...-..----PDEV.FSAADFvdksm.......Aa......IERI
gi|294102787|ref|YP_003554645.1|  .........-----..---...-..--------.------............-.......----
gi|294102032|ref|YP_003553890.1|  .........-----..---...-..--------.------............-.......----
gi|294102010|ref|YP_003553868.1|  .........-----..---...-..--------.------............-.......----
gi|294101586|ref|YP_003553444.1|  .........-----..---...-..--------.------............-.......----
gi|294101458|ref|YP_003553316.1|  .........-----..---...-..--------.------............-.......----
gi|294102625|ref|YP_003554483.1|  .........-A---..---...-..--------.------............-.......----
gi|294102478|ref|YP_003554336.1|  .........-----..---...-..------D-.------............-.......----
gi|294101874|ref|YP_003553732.1|  .........-----..---...-..--------.------............-.......----
gi|294102071|ref|YP_003553929.1|  .........---AP..LPD...P..QLILVDE-.------............-.......----


                                              260       270       280       290       300       310 
                                                |         |         |         |         |         | 
d1g6oa_                             LCS........GHKGTLTTLHAGSSEEAFIRLANMSSSNSAARNIKFESLIEGFKDLIDMIVHI
gi|294102520|ref|YP_003554378.1|  ---........-----------------------------------------------------
gi|294102529|ref|YP_003554387.1|  ---........-----------------------------------------------------
gi|294102437|ref|YP_003554295.1|  ---........-----------------------------------------------------
gi|294102168|ref|YP_003554026.1|  ---........-----------------------------------------------------
gi|294101779|ref|YP_003553637.1|  ---........-----------------------------------------------------
gi|294102457|ref|YP_003554315.1|  ---........-----------------------------------------------------
gi|294101625|ref|YP_003553483.1|  ---........-----------------------------------------------------
gi|294101185|ref|YP_003553043.1|  ---........-----------------------------------------------------
gi|294102626|ref|YP_003554484.1|  ---........-----------------------------------------------------
gi|294101765|ref|YP_003553623.1|  ALT........GHL-VLSTLHTDDAANAPLRLIEMG------------VPPFLIVSSLKAVVSQ
gi|294102479|ref|YP_003554337.1|  MEKame.....GRTSFVIAHRLSTVRS-ADRILVLSKGHIVESGTHDELLEK------------
gi|294101904|ref|YP_003553762.1|  QKKl.......GITCIHVTHDQKEALTIADRIVVLNKGKIEQVAAPFELYANPATLFVA-----
gi|294102557|ref|YP_003554415.1|  LQKrl......GITSVYVTHDQAEAMSISDRVVVMNKGRIEQVGTPIELYARPSNSFVAAFI--
gi|294101807|ref|YP_003553665.1|  ---........-----------------------------------------------------
gi|294101806|ref|YP_003553664.1|  ---........-----------------------------------------------------
gi|294102649|ref|YP_003554507.1|  INRkl......GITIVLVTHEMGVIRQICHRVAVLEHGQVVELGAVKDVFMKPQS---------
gi|294101185|ref|YP_003553043.1|  LDD........-----------------------------------------------------
gi|294102868|ref|YP_003554726.1|  IRQlqkgi...GITAIYVTHDQEEALALSDRIVVMEKGEIIQIDTPRNIYFHAQNSF-------
gi|294102500|ref|YP_003554358.1|  ---........-----------------------------------------------------
gi|294102409|ref|YP_003554267.1|  KEKvrvg....RESQTLATITLQNYFRMYRKLAGMTG---------------------------
gi|294102354|ref|YP_003554212.1|  ---........-----------------------------------------------------
gi|294101565|ref|YP_003553423.1|  LEDgrltdgq.GHT--------------------------------------------------
gi|294101424|ref|YP_003553282.1|  AET........GMTMVIITHEMLFAKDVSDRIIFMADGNIVEQGSPQDIMVKPAHPRTQA----
gi|294101976|ref|YP_003553834.1|  ---........-----------------------------------------------------
gi|294101061|ref|YP_003552919.1|  MRNlakg....GMTMLVVTHEMGFACSVANEIMFMEEGRILESGSPDKLLNTPQYERT------
gi|294101048|ref|YP_003552906.1|  LIRlqkel...KKTIFFVTHDLDEAMRMGDRMAVMKNGTIVQMGAPAQILANPADEYVARFV--
gi|294101977|ref|YP_003553835.1|  ---........-----------------------------------------------------
gi|294101084|ref|YP_003552942.1|  MKDldne....GMTQIIVTHQMRFARNASDYIVFMDGGEIVEMADGDVLFETPQN---------
gi|294101565|ref|YP_003553423.1|  ---........-----------------------------------------------------
gi|294101786|ref|YP_003553644.1|  IQDlqvqf...GLTYLFITHDLSVVKHLSTNIMVMYLGQVVELADSKKLFKNPVHPYTK-----
gi|294101493|ref|YP_003553351.1|  FVRlnves...GKTIIQVTHERDMALF-GSRIITVKDGTIVHD---------------------
gi|294101884|ref|YP_003553742.1|  ---........-----------------------------------------------------
gi|294101894|ref|YP_003553752.1|  ---........-----------------------------------------------------
gi|294101778|ref|YP_003553636.1|  ---........-----------------------------------------------------
gi|294102313|ref|YP_003554171.1|  MVRlnkel...ETTFIFATHDEKVMKY-LRRKIHLFDGRVAQ----------------------
gi|294102640|ref|YP_003554498.1|  LGDlkker...GYTYLFISHNLSVVRYVSDEVAVMYLGQVVEKAGNTILFKDPLHPYTQA----
gi|294101376|ref|YP_003553234.1|  ---........-----------------------------------------------------
gi|294102641|ref|YP_003554499.1|  LQKiv......NTSLLLITHDLGIVAEICDEVAIMYAGRLVEYSDIRQLYSKPMHPYTQ-----
gi|294101359|ref|YP_003553217.1|  ---........-----------------------------------------------------
gi|294102459|ref|YP_003554317.1|  ---........-----------------------------------------------------
gi|294101785|ref|YP_003553643.1|  LKKkf......NMATILITHDLGIVAQTCEKAAVIYAGEIVEYGTVHEIFKNMRHPYT------
gi|294101376|ref|YP_003553234.1|  LAEmsgieelkGVTVLATTNRIDLID--------------------------------------
gi|294102074|ref|YP_003553932.1|  ---........-----------------------------------------------------
gi|294102442|ref|YP_003554300.1|  LVAlnaa....GATVIMATHDQYLVDAYRQRVVELQEGRIVR----------------------
gi|294101577|ref|YP_003553435.1|  ILSlrak....GYGILLTDHNVRDTLAITDRTYLIHQGEIVIEGSPDEVAQSE-----------
gi|294101171|ref|YP_003553029.1|  LIKsihmef..QLAILVIEHHMDLVMEICPRIICMNFGAKIAEGSPEEIQAN------------
gi|294102413|ref|YP_003554271.1|  IRRirdef...NLTILLIEHDMKVVMGICEYIWVLDYGKLIAEGNPDEIQSNP-----------
gi|294102187|ref|YP_003554045.1|  MNT........GHDGSLTTLHANSPRDVLSRLESMV--LMAGMELPVRAIREQISSGIDLIVHQ
gi|294102332|ref|YP_003554190.1|  LNDmaqrf...ETAVIVVTHDEKIIPT-FKRIYHIRDGVTYE----------------------
gi|294102831|ref|YP_003554689.1|  ---........-----------------------------------------------------
gi|294101321|ref|YP_003553179.1|  ---........-----------------------------------------------------
gi|294101626|ref|YP_003553484.1|  ---........-----------------------------------------------------
gi|294101069|ref|YP_003552927.1|  MKHiikgh...GLSAVMSLHDLTMALRYGDRFVFMKKGEIRYI---------------------
gi|294102759|ref|YP_003554617.1|  LERlargr...NMGLLLVTHDLPLAVQICDAIAVMHEGEIVEEGAPADIVTKPRH---------
gi|294101055|ref|YP_003552913.1|  LCQ........QYSIIIVTHNLFQARRISHRTFFILDGEIIEAGPTKDLFENP-----------
gi|294101254|ref|YP_003553112.1|  FSTiqqmtae.GHGIVFISHKLDEVLSLSDRISILRKGE-------------------------
gi|294102760|ref|YP_003554618.1|  LNErvke....GMAMVFVTHDLYLARGAAKRGIVLLEGECCEENSTEALLSAPKHAYTRALV--
gi|294101659|ref|YP_003553517.1|  LKTlhaq....GRTIIYITHRLEETVH-CDRALVLKSGKVQWDGTISELFRH------------
gi|294101172|ref|YP_003553030.1|  LRRinse....GVTILLVEQNARQALLLSHRGYVLQTGSIIMAGTSEDLLNS------------
gi|294102017|ref|YP_003553875.1|  ---........-----------------------------------------------------
gi|294101748|ref|YP_003553606.1|  ---........-----------------------------------------------------
gi|294102409|ref|YP_003554267.1|  ---........-----------------------------------------------------
gi|294102070|ref|YP_003553928.1|  ---........-----------GTTRDATDTVIEMKEGKFRF----------------------
gi|294102390|ref|YP_003554248.1|  ---........-----------------------------------------------------
gi|294101403|ref|YP_003553261.1|  ---........-----------------------------------------------------
gi|294101730|ref|YP_003553588.1|  ---........-----------------------------------------------------
gi|294102602|ref|YP_003554460.1|  ---........-----------------------------------------------------
gi|294102663|ref|YP_003554521.1|  LKE........RYTVIIVTHNMQQAARISDYTAFFLMGELIEYGKTPKLFTSP-----------
gi|294101436|ref|YP_003553294.1|  ---........-----------------------------------------------------
gi|294102150|ref|YP_003554008.1|  ---........-----------------------------------------------------
gi|294101607|ref|YP_003553465.1|  GAT........EAL-VVTTPEIPSVRD-ADRIIGL-----------------------------
gi|294102035|ref|YP_003553893.1|  LKK........-----------------------------------------------------
gi|294102412|ref|YP_003554270.1|  IREinaq....GKTVLLVEQNAFAALKVAHHAYILEVGSIVLSGPGEDLLKNP-----------
gi|294101660|ref|YP_003553518.1|  LSKqkkk....GRGIIFVTHDLETALMSSDSILVLEGGREVVQGAPGKIIEE------------
gi|294102549|ref|YP_003554407.1|  FRKa.......GKTIIFIAHNLNEVLAVSDVITVMRKGKHIAT---------------------
gi|294102841|ref|YP_003554699.1|  LASfag.....NVTIILVSHDLSVIANGAT----------------------------------
gi|294101272|ref|YP_003553130.1|  LLSlqkdf...KKTVLMITHDIDEALYLADTVLVLT----------------------------
gi|294101433|ref|YP_003553291.1|  ---........-----------------------------------------------------
gi|294101963|ref|YP_003553821.1|  ---........-----------------------------------------------------
gi|294101356|ref|YP_003553214.1|  ALTey......HGTIIIVSHDRYFLDKLVSRVIEIREGKILEYP--------------------
gi|294102542|ref|YP_003554400.1|  GVRmcrekw..GTTLVLVSHDVLWVKSLSDRHLILTEGEL------------------------
gi|294101861|ref|YP_003553719.1|  ---........-----------------------------------------------------
gi|294102400|ref|YP_003554258.1|  ---........-----------------------------------------------------
gi|294102043|ref|YP_003553901.1|  ---........-----------------------------------------------------
gi|294101077|ref|YP_003552935.1|  LNQl.......DMALIIASHDIPFLEHVTRRGYELS----------------------------
gi|294102348|ref|YP_003554206.1|  LADq.......GSGVMVITHREDVAAG-CDRSYLMCDGRIILEGSAAAVKR-------------
gi|294102040|ref|YP_003553898.1|  ---........-----------------------------------------------------
gi|294101613|ref|YP_003553471.1|  ---........-----------------------------------------------------
gi|294101367|ref|YP_003553225.1|  MRKlaal....GIAIVFISHRLHEVIDVCDKIVVLRDGQVVHETTPA-----------------
gi|294101893|ref|YP_003553751.1|  ---........-----------------------------------------------------
gi|294101841|ref|YP_003553699.1|  ---........-----------------------------------------------------
gi|294102070|ref|YP_003553928.1|  ---........-----------------------------------------------------
gi|294102221|ref|YP_003554079.1|  -PT........GHT--------------------------------------------------
gi|294101356|ref|YP_003553214.1|  LEDwllnf...NGTLIAISHDRHFLDKICTSTAELSQGAI------------------------
gi|294101345|ref|YP_003553203.1|  LRQyawkm...NKGVLMSVHDIDLALRFADRIWVMSPSHSFTVGIPEDL---------------
gi|294102145|ref|YP_003554003.1|  ---........-----------------------------------------------------
gi|294101756|ref|YP_003553614.1|  ---........-----------------------------------------------------
gi|294102549|ref|YP_003554407.1|  RRA........GKAILMISADLDEILSLSDRIAVMNRGEIVAVLPR------------------
gi|294101372|ref|YP_003553230.1|  ---........-----------------------------------------------------
gi|294101016|ref|YP_003552874.1|  ---........-----------------------------------------------------
gi|294101780|ref|YP_003553638.1|  LRSirdl....GNTVVVVEHDRETMLA-ADAIVEMGPG--------------------------
gi|294101686|ref|YP_003553544.1|  ---........-----------------------------------------------------
gi|294102507|ref|YP_003554365.1|  ---........-----------------------------------------------------
gi|294101471|ref|YP_003553329.1|  --Eeahvk...SIAVLFISHDEVLLNALCSRIIR------------------------------
gi|294101845|ref|YP_003553703.1|  ---........-----------------------------------------------------
gi|294101553|ref|YP_003553411.1|  ---........-----------------------------------------------------
gi|294101853|ref|YP_003553711.1|  ---........-----------------------------------------------------
gi|294101780|ref|YP_003553638.1|  LHRivdq....GNTVVTIEHNLDVLLS-SDYIIDLGP---------------------------
gi|294102079|ref|YP_003553937.1|  ---........-----------------------------------------------------
gi|294101472|ref|YP_003553330.1|  IINa.......GKTLLCITHDFSLPKQIGGQTGVLFSGLLVESGDSQIVLQHPSHPYTQG----
gi|294102235|ref|YP_003554093.1|  ---........-----------------------------------------------------
gi|294102390|ref|YP_003554248.1|  ---........-----------------------------------------------------
gi|294101443|ref|YP_003553301.1|  ---........-----------------------------------------------------
gi|294101748|ref|YP_003553606.1|  LNR........GGQVFFVSNRINRLKGKYEELKIMFP---------------------------
gi|294101649|ref|YP_003553507.1|  ---........-----------------------------------------------------
gi|294101715|ref|YP_003553573.1|  LRE........KKSITLATTHHNPIKSY------------------------------------
gi|294101925|ref|YP_003553783.1|  ---........-----------------------------------------------------
gi|294101367|ref|YP_003553225.1|  LREynqkr...GTTIVMISSELEELRSICDRIAIVNEGKIA-----------------------
gi|294101751|ref|YP_003553609.1|  ---........-----------------------------------------------------
gi|294101046|ref|YP_003552904.1|  ---........-----------------------------------------------------
gi|294101779|ref|YP_003553637.1|  ---........-----------------------------------------------------
gi|294101226|ref|YP_003553084.1|  ---........-----------------------------------------------------
gi|294101892|ref|YP_003553750.1|  ---........-----------------------------------------------------
gi|294102315|ref|YP_003554173.1|  ---........-----------------------------------------------------
gi|294102188|ref|YP_003554046.1|  ---........-----------------------------------------------------
gi|294102320|ref|YP_003554178.1|  ---........-----------------------------------------------------
gi|294102169|ref|YP_003554027.1|  ---........-----------------------------------------------------
gi|294101254|ref|YP_003553112.1|  VREqlllerdrGAAVFLVSEDLEELLSLSDRLAVIFKGEIMGI---------------------
gi|294102077|ref|YP_003553935.1|  ELSd.......GHD--------------------------------------------------
gi|294102510|ref|YP_003554368.1|  ---........-----------------------------------------------------
gi|294101748|ref|YP_003553606.1|  ---........-----------------------------------------------------
gi|294101141|ref|YP_003552999.1|  ---........-----------------------------------------------------
gi|294101018|ref|YP_003552876.1|  ---........-----------------------------------------------------
gi|294101692|ref|YP_003553550.1|  LRS........-----------------------------------------------------
gi|294101032|ref|YP_003552890.1|  ---........-----------------------------------------------------
gi|294101031|ref|YP_003552889.1|  ---........-----------------------------------------------------
gi|294101431|ref|YP_003553289.1|  ---........-----------------------------------------------------
gi|294102167|ref|YP_003554025.1|  ---........-----------------------------------------------------
gi|294101458|ref|YP_003553316.1|  ---........-----------------------------------------------------
gi|294102320|ref|YP_003554178.1|  ICR........GKRVILVTA--------------------------------------------
gi|294101940|ref|YP_003553798.1|  ---........-----------------------------------------------------
gi|294102120|ref|YP_003553978.1|  VKD........-----------------------------------------------------
gi|294101791|ref|YP_003553649.1|  ---........-----------------------------------------------------
gi|294102136|ref|YP_003553994.1|  FEDysnry...KIQIICTSHSLSLIEFALARKY-------------------------------
gi|294101830|ref|YP_003553688.1|  ---........-----------------------------------------------------
gi|294102042|ref|YP_003553900.1|  ---........-------------I---------------------------------------
gi|294102015|ref|YP_003553873.1|  MNR........GKIP-------------------------------------------------
gi|294102787|ref|YP_003554645.1|  ---........-----------------------------------------------------
gi|294102032|ref|YP_003553890.1|  ---........-----------------------------------------------------
gi|294102010|ref|YP_003553868.1|  ---........-----------------------------------------------------
gi|294101586|ref|YP_003553444.1|  ---........-----------------------------------------------------
gi|294101458|ref|YP_003553316.1|  ---........-----------------------------------------------------
gi|294102625|ref|YP_003554483.1|  ---........-----------------------------------------------------
gi|294102478|ref|YP_003554336.1|  ---........-----------------------------------------------------
gi|294101874|ref|YP_003553732.1|  ---........-----------------------------------------------------
gi|294102071|ref|YP_003553929.1|  ---........-----------------------------------------------------


                                          320                                                       
                                            |                                                       
d1g6oa_                             NHHKQCDE----fyik................................................
gi|294102520|ref|YP_003554378.1|  ------------lkerlaqivvaytydgtavtagdlnaqgsmavvlkdalkpnlvqtlehvpaf
gi|294102529|ref|YP_003554387.1|  ------------gvpresgfditvasevmailclsanikelkerlskivvgytyngtvvtagdl
gi|294102437|ref|YP_003554295.1|  ------------nllltkvynaepvafddiyaqarawgkalepyvadvslalreamlegkgilf
gi|294102168|ref|YP_003554026.1|  ------------qdvnkpqyfllrrligtkgnimvvgdpdqsiygwrgadmtmilnfekdfpaa
gi|294101779|ref|YP_003553637.1|  ------------vlvlahnktlaaqlytefktffphnavhyfvsyydyyqpeayipssdtyiek
gi|294102457|ref|YP_003554315.1|  ------------gqpfleairqmatrvgrqnvlychvtlvpyleaarelktkptqhsvqelrri
gi|294101625|ref|YP_003553483.1|  ------------eqerergitissaattciwrdcfvniidtpghvdftveversmrvldgavav
gi|294101185|ref|YP_003553043.1|  ------------rivrgdvpeglkdrsifaldmgslvagakyrgefeerlkavlneiktsegri
gi|294102626|ref|YP_003554484.1|  ------------qavrshsqrlfivgdlkqsiyrfrhadlslfgsyikkakyghgdyilldtsf
gi|294101765|ref|YP_003553623.1|  RLIRLLCPLCK-kpdsnspvgcsycggrgfhgrvgvfeylpitervqelllhkapvqkirtqar
gi|294102479|ref|YP_003554337.1|  ------------ggiyrhlyelqf........................................
gi|294101904|ref|YP_003553762.1|  ------------dfigqanifkg.........................................
gi|294102557|ref|YP_003554415.1|  ------------gkvnfmpak...........................................
gi|294101807|ref|YP_003553665.1|  ------------fmedfrrtgaiqrtvmfvnladdpaierittprlaltaaeylafeqdmhvvv
gi|294101806|ref|YP_003553664.1|  ------------waesdivvyvgcgergnemtdvllefpeledprsgeplmkrtvliantsnmp
gi|294102649|ref|YP_003554507.1|  ------------ktaref..............................................
gi|294101185|ref|YP_003553043.1|  ------------grvtdsqghvvdfkntviimtsnigaplllegitgdgqikedareavmkelr
gi|294102868|ref|YP_003554726.1|  ------------vadfigrsniit........................................
gi|294102500|ref|YP_003554358.1|  ------------apfvkveatkftevgyvgrdvdsmirdlvetavamvkrvkieevqgpaeera
gi|294102409|ref|YP_003554267.1|  ------------tavteseefkeiygldvivvptn.............................
gi|294102354|ref|YP_003554212.1|  ------------fsngdinrmgnvvdgntvadfgaeeqkrqisintalvtlerngkrlylldtp
gi|294101565|ref|YP_003553423.1|  ------------vdfrnaviimtsnigakdwvkgtslgfsisgeadgyfdwdktksdildavqk
gi|294101424|ref|YP_003553282.1|  ------------f...................................................
gi|294101976|ref|YP_003553834.1|  ------------mlyyceslreisaareevpgrrgypgymysdlaeiyeragcvencqgsitqi
gi|294101061|ref|YP_003552919.1|  ------------rqf.................................................
gi|294101048|ref|YP_003552906.1|  ------------qdk.................................................
gi|294101977|ref|YP_003553835.1|  ------------eiiiyigcgergnemtevleefpelsdpfhnaplmermvliantsnmpvaar
gi|294101084|ref|YP_003552942.1|  ------------krtkaf..............................................
gi|294101565|ref|YP_003553423.1|  ------------eipanlkdiehdleevrkekeaavtsqefekaarlrdterkiseeleekkkd
gi|294101786|ref|YP_003553644.1|  ------------tl..................................................
gi|294101493|ref|YP_003553351.1|  ------------erv.................................................
gi|294101884|ref|YP_003553742.1|  ------------adrirmqrhandpdvyirsmgtrgslggvsrstreavkildacgkdvviiet
gi|294101894|ref|YP_003553752.1|  ------------vpfamadattlteagyvgedvenilvrllqaadydiqaaergiiyideldki
gi|294101778|ref|YP_003553636.1|  ------------davgrhrgaglggghdereqtlnqllveldgfdestgiiliaatnrpdildp
gi|294102313|ref|YP_003554171.1|  ------------de..................................................
gi|294102640|ref|YP_003554498.1|  ------------l...................................................
gi|294101376|ref|YP_003553234.1|  ------------daiapkreemggekqverrvvaqllalmdglesrgqvivigatnipntldpa
gi|294102641|ref|YP_003554499.1|  ------------g...................................................
gi|294101359|ref|YP_003553217.1|  ------------eleaildslpncqrvwlfsatmpaeiknlakrylktpvfislteegeahedi
gi|294102459|ref|YP_003554317.1|  ------------ilmvlliderpeevtdmarsvdgeiiastfdrpaeehlrvanlalekakrlv
gi|294101785|ref|YP_003553643.1|  ------------i...................................................
gi|294101376|ref|YP_003553234.1|  ------------pallssgrfdvvlelpmpdakarleifqihlqkkplaedvhleelvrstegh
gi|294102074|ref|YP_003553932.1|  ------------vysiscttrqprdgerdgvdyrflseeefkklveekkflewavvhehlygtl
gi|294102442|ref|YP_003554300.1|  ------------deekg...............................................
gi|294101577|ref|YP_003553435.1|  ------------varkfy..............................................
gi|294101171|ref|YP_003553029.1|  ------------sevlkaylge..........................................
gi|294102413|ref|YP_003554271.1|  ------------rvieaylge...........................................
gi|294102187|ref|YP_003554045.1|  ERLKDGTR----r...................................................
gi|294102332|ref|YP_003554190.1|  ------------eegq................................................
gi|294102831|ref|YP_003554689.1|  ------------rlgysvlavdmdpqgnctsglgiearaievslydvllggasaqdalmatswq
gi|294101321|ref|YP_003553179.1|  ------------tkgwsnfeaydmidkapeerergitinishveyqtenrhyahidcpghadyi
gi|294101626|ref|YP_003553484.1|  ------------tkgwsnfeaydmidkapeerergitinishveyqtenrhyahidcpghadyi
gi|294101069|ref|YP_003552927.1|  ------------lardeis.............................................
gi|294102759|ref|YP_003554617.1|  ------------rhttq...............................................
gi|294101055|ref|YP_003552913.1|  ------------....................................................
gi|294101254|ref|YP_003553112.1|  ------------kt..................................................
gi|294102760|ref|YP_003554618.1|  ------------....................................................
gi|294101659|ref|YP_003553517.1|  ------------te..................................................
gi|294101172|ref|YP_003553030.1|  ------------adirnaylg...........................................
gi|294102017|ref|YP_003553875.1|  ------------llvimaqmgafipaaeasmglmdrvftrigardelsrgnstfmvemietani
gi|294101748|ref|YP_003553606.1|  ------------amraafkaseagkqvvvlvpttilaqqhyhtfrsrmagfpirvevlsrfvst
gi|294102409|ref|YP_003554267.1|  ------------ketlrkegnvedldpskyqqlleeyrqicakerdevldkgglkiigterhes
gi|294102070|ref|YP_003553928.1|  ------------idtaglrkksridsdieyysfvrtlqavdrsdvallvmdasepttdqdkkma
gi|294102390|ref|YP_003554248.1|  ------------avavlallqaveggyqgafmapteilaqqhyyrlhsfleplgvsvvlligsl
gi|294101403|ref|YP_003553261.1|  ------------lhgiaeaqkaggiaafidaehaldprlaaslgvdvqslyvaqpdsgeqalyv
gi|294101730|ref|YP_003553588.1|  ------------epcndcpnclainggesldvieidgasnnsvdevrelkahvslsafsslykv
gi|294102602|ref|YP_003554460.1|  ------------mdsnelerergitirakhctvewngyliniidtpghadfsgevervlstvds
gi|294102663|ref|YP_003554521.1|  ------------g...................................................
gi|294101436|ref|YP_003553294.1|  ------------agaevkpyasgktdpnramvsvpdprfehlvtifepkkqtpatvefvdlagl
gi|294102150|ref|YP_003554008.1|  ------------tgtveirkmkaqlldsldlerergitiklvpvrmsykskdgneyilnlidtp
gi|294101607|ref|YP_003553465.1|  ------------lesmekkpirlvinrvkpsmvkegemldvqdvldvlaieligivpdddsvvk
gi|294102035|ref|YP_003553893.1|  ------------rppfvevvltgrnppvalleyadlitemkeirhpfqkgitgrrgiey.....
gi|294102412|ref|YP_003554270.1|  ------------rvkeayl.............................................
gi|294101660|ref|YP_003553518.1|  ------------ls..................................................
gi|294102549|ref|YP_003554407.1|  ------------lprseat.............................................
gi|294102841|ref|YP_003554699.1|  ------------avacv...............................................
gi|294101272|ref|YP_003553130.1|  ------------qapmkirdritlpsekprnldsseyiaik.......................
gi|294101433|ref|YP_003553291.1|  ------------pvvwrgpiiasvikqfwedvawdktdfiivdlppgtadapltvmqtidldgf
gi|294101963|ref|YP_003553821.1|  ------------rqtnitareaggitqhigastvtyegknivfldtpgheaftamrargaqatd
gi|294101356|ref|YP_003553214.1|  ------------gnysyfiq............................................
gi|294102542|ref|YP_003554400.1|  ------------stss................................................
gi|294101861|ref|YP_003553719.1|  ------------qlrvttgpalekagdiaailsnlepfdvlfideihrlpanveeilypsmedf
gi|294102400|ref|YP_003554258.1|  ------------lsqaplfiddssmlstlefrararrfksrfenlglivvdylqlmsfarrids
gi|294102043|ref|YP_003553901.1|  ------------qkkkepvlwtrepggwvhgdfvrtlllekdlrhelselflfvidrcehvsqv
gi|294101077|ref|YP_003552935.1|  ------------sg..................................................
gi|294102348|ref|YP_003554206.1|  ------------y...................................................
gi|294102040|ref|YP_003553898.1|  ------------tagrlhskhnlmeeltkivrvierevgrdsmenllvldavmgqngfaqaesf
gi|294101613|ref|YP_003553471.1|  ------------glrwvlgegspnclritrqsdllfqgsislptatetevslciredpkictik
gi|294101367|ref|YP_003553225.1|  ------------k...................................................
gi|294101893|ref|YP_003553751.1|  ------------aqpgriiqkmrqagtknpimlmdeidkigqdfrgdpasallevldpaqnsnf
gi|294101841|ref|YP_003553699.1|  ------------ypfttlspnlgilavdddrivvadvpgliegahenkglgiyflrhiertrvl
gi|294102070|ref|YP_003553928.1|  ------------gvtrdriygetewkgrqfyivdtggllvrdehplvegirkqatlaieeshvi
gi|294102221|ref|YP_003554079.1|  ------------lrlitlpeilgiwiehliekranamelmkvaakydkdlqekikedpiidtlq
gi|294101356|ref|YP_003553214.1|  ------------slykg...............................................
gi|294101345|ref|YP_003553203.1|  ------------....................................................
gi|294102145|ref|YP_003554003.1|  ------------scdrlneekkrgitielgfaplklhdgrvvsivdvpghekfirqmvagasgi
gi|294101756|ref|YP_003553614.1|  ------------kvsivsekpqttrnaihgiynepemqivftdtpgihrprhklgealvkaavr
gi|294102549|ref|YP_003554407.1|  ------------keasr...............................................
gi|294101372|ref|YP_003553230.1|  ------------aivtaipgttrdlieevltyrgipirlvdtagigapgdeieamgiaraekam
gi|294101016|ref|YP_003552874.1|  ------------lkvtyvssekfinefiqsiknnrtqefkskyrsvdilliddiqflgnkgssq
gi|294101780|ref|YP_003553638.1|  ------------ageqgg..............................................
gi|294101686|ref|YP_003553544.1|  ------------rarrllalhnnldlfcdtdldgalshveghgfvvldsvqamrssledgwpgt
gi|294102507|ref|YP_003554365.1|  ------------rpdykpsleppfhivhptastvaicgggaslrpgeislahrgilfldeftef
gi|294101471|ref|YP_003553329.1|  ------------l...................................................
gi|294101845|ref|YP_003553703.1|  ------------efasgkraqselirageeeaevialffcprtlqlpeeisseegnlflkrvft
gi|294101553|ref|YP_003553411.1|  ------------qnahnplvvacdlrrpaaieqlkvlaqqskvafygpsggtqdvikvakeala
gi|294101853|ref|YP_003553711.1|  ------------cycrkpeelrllmidpkrvelsiyehlphmlakpvtspkkaiqalawavrem
gi|294101780|ref|YP_003553638.1|  ------------eggmeggs............................................
gi|294102079|ref|YP_003553937.1|  ------------yldtgaiyralafylnamgfepvespylteilskikvslsdgcvyingadvt
gi|294101472|ref|YP_003553330.1|  ------------l...................................................
gi|294102235|ref|YP_003554093.1|  ------------hvgnwpgvtverkeghfsyegmnftlvdlpgiyslgaasideqvaseflike
gi|294102390|ref|YP_003554248.1|  ------------atvmviedadrfglsqlhqlrgrvgrggnqsycvllsnpttregverlkvmc
gi|294101443|ref|YP_003553301.1|  ------------vterslleinavsakvselrdlveeaknlkilsgsaaiafvdeiyhfnksqq
gi|294101748|ref|YP_003553606.1|  ------------earismahgqmaekdlertmldfyngnldilvcttivesgldiprantlivd
gi|294101649|ref|YP_003553507.1|  ------------vahistgdilrqnvkektklgcqaqefmnggklvpdeiivgmmgerlkekdc
gi|294101715|ref|YP_003553573.1|  ------------alttphvetasmefnvetlaptyhllmgipgrsnaiyiaerygmpsevlqka
gi|294101925|ref|YP_003553783.1|  ------------sakvfrinapsnplyipfwlmnfdelafflvgakptddqrveyrllrelitt
gi|294101367|ref|YP_003553225.1|  ------------gt..................................................
gi|294101751|ref|YP_003553609.1|  ------------vchgvamlkagaisrivlvrpaveageslgylpgdlrekvepyvrplydafy
gi|294101046|ref|YP_003552904.1|  ------------riiftapikalsnerymdlrrmgfdvgietgdfkrneeapiicctqeiytlk
gi|294101779|ref|YP_003553637.1|  ------------vlvlahnktlaaqlytefktffphnavhyfvsyydyyqpeayipssdtyiek
gi|294101226|ref|YP_003553084.1|  ------------ypgttvgflegwlrynsevyriidvpgaytldptneaeqvarrmvdegadla
gi|294101892|ref|YP_003553750.1|  ------------rklahvgstpgktrsvnfykieaevdfflvdlpgygyaargfkekekwakli
gi|294102315|ref|YP_003554173.1|  ------------ealmdnipviaidpkgditnlllsfpeqrsedflpwinienataegfppsey
gi|294102188|ref|YP_003554046.1|  ------------lhrnfgditielaegcqriwlvtdcsctgvknlhlvtglldqlriswiergv
gi|294102320|ref|YP_003554178.1|  ------------rrtraeieeyfsrdikeqglkfpkvakpvplfyelnekedfifnrtiehian
gi|294102169|ref|YP_003554027.1|  ------------tkkaasfrfaviegdiatsrdaerlsklgvpaiqinthggchleanlvskaf
gi|294101254|ref|YP_003553112.1|  ------------ldhpe...............................................
gi|294102077|ref|YP_003553935.1|  ------------vlvsdtvgfirdlppaliaafrttleeisvsslillvldgsmpdvmetldvv
gi|294102510|ref|YP_003554368.1|  ------------apvggvpgitrgvswykgqdilavdspgildprshnevhrrl..........
gi|294101748|ref|YP_003553606.1|  ------------ervdlvwtpgqyvvrgfivdiydpayalpirieffdeivesirsfhpqsqms
gi|294101141|ref|YP_003552999.1|  ------------rlfsatvdqflgfmrhdyrsscllplladsavvfdeihsfdqtlfsallgfl
gi|294101018|ref|YP_003552876.1|  ------------rgrnilidalvesswqvfaata..............................
gi|294101692|ref|YP_003553550.1|  ------------kgaataesflsnreeeqgvlrdelssvqeegrklfellevsiadgvlipvrn
gi|294101032|ref|YP_003552890.1|  ------------iknpkkenvykvvpqieaarckgcgvcadncafgalnqfgthapvvnmqlch
gi|294101031|ref|YP_003552889.1|  ------------sftgrkipeidterctvcggcvgfcrfnalekanngitllpwkcegcggcal
gi|294101431|ref|YP_003553289.1|  ------------kiqlqvcglnptvisldnyfvdrektpldeqgnydfevleaidldllesqla
gi|294102167|ref|YP_003554025.1|  ------------sqiwkslgatiidadalaheawkdttvlrraserwgtqvllgnghinpsvva
gi|294101458|ref|YP_003553316.1|  ------------lrellnnrtsggiifttiqkfapftnetngevidfnrwgrvaensspytant
gi|294102320|ref|YP_003554178.1|  ------------tpynnspkdilsllklfqkgqkstipnlpnlesffnsldkklkqldrkkdyd
gi|294101940|ref|YP_003553798.1|  ------------lhgavnflqgnperrvlffsldmskeettqrlfmrelevstnalhglikvns
gi|294102120|ref|YP_003553978.1|  ------------adcvaiddlgaqrkdkswvderlfslidaryrsgkqtiittnacsmsqlkem
gi|294101791|ref|YP_003553649.1|  ------------gdglgargvrspsftlineyegrlplahvdlyrlergdeyelglceyaddgf
gi|294102136|ref|YP_003553994.1|  ------------nviylldn............................................
gi|294101830|ref|YP_003553688.1|  ------------allpqllellsqhraavqeglaavvdvrggrllndlfsvvdslkgtiplvqv
gi|294102042|ref|YP_003553900.1|  ------------qsadtlllpaansmlkiveeppehgvilfllendkflptlksrcwnlal...
gi|294102015|ref|YP_003553873.1|  ------------lfvggtpfyyhalfegvltkdlprdrkltdelekfaskhgnqalhdqlsaid
gi|294102787|ref|YP_003554645.1|  ------------ryslfgcpdgrssrnlyapphggkqkgsliieslkgerfslvmngrnstfsg
gi|294102032|ref|YP_003553890.1|  ------------yslqrlhesakekpapddwiyaynfsdpsrplainlpagkgkemgsafeell
gi|294102010|ref|YP_003553868.1|  ------------dvlekkglsvitmpeqakwldmslvtpkvdwalhdestrllmdiggdaegal
gi|294101586|ref|YP_003553444.1|  ------------agihvgyikhshekvlspmdtdtgkvlsqgipalywgvdgcryekpgeisiy
gi|294101458|ref|YP_003553316.1|  ------------ivehfekrdlaqeneggkgmivamsrriaidlykeivalrpdwhsddlmsgk
gi|294102625|ref|YP_003554483.1|  ------------rriwnagehgwplgetwdilrepclagreiatsppadiftlnekgwigfleh
gi|294102478|ref|YP_003554336.1|  ------------afqhrrlgrdvdivlvdaccpfgngrlvpagilreppkaiqrahivvitkad
gi|294101874|ref|YP_003553732.1|  ------------knlvrairralfefpehreevvsflekqapctvmiiatstamalkivrilnl
gi|294102071|ref|YP_003553929.1|  ------------esspayrmqaapllhi....................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  vhggpfaniahgcnsiqatkyglklsdyfiteagfgadlgaekffdikcregnlhpsavvivat
gi|294102529|ref|YP_003554387.1|  nahgsmaallkdalkpnlvqtlehvpafvhggpfaniahgcnslqatkyglkladyfiteagfg
gi|294102437|ref|YP_003554295.1|  egaqgtlldvdhgtypfvtssspiaaggcvglgvgpsdvdrvigvvkayctrvgegpfptedlg
gi|294102168|ref|YP_003554026.1|  kvvvldqnyrstgnilkaanaviisnerrrkknlwtardmgekiyvllapneyqeadfilsemh
gi|294101779|ref|YP_003553637.1|  dasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavgekwdrrgfmer
gi|294102457|ref|YP_003554315.1|  gilpdiiicrshypicdemkekialfcnvpkeaviealdeptiyqvplslqaqefdrlvmrlls
gi|294101625|ref|YP_003553483.1|  fcavggvepqsetvwrqadkyhvpriafvnkmdrvgadfyqvvngirtrlgarsvplqlpigse
gi|294101185|ref|YP_003553043.1|  ilfidelhtivgagaaegaidagnmlkpmlargelhcigattideyrkriekdaalarrfqpvl
gi|294102626|ref|YP_003554484.1|  rskeilvhevndlfssvwkdglgqelplpfeslevphylsthelrqqctvdpfltyleggkege
gi|294101765|ref|YP_003553623.1|  kegmrtlvengmlkverglttyeeil......................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  iltdltnycealreisaarkevpgrrgypgylytdlatmyeragrlkgkkgsitqipiltmped
gi|294101806|ref|YP_003553664.1|  vaareasiytaitmaeyyrdmgysvalmadstsrwaealremsgrleempgeegypaylgtrla
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  qafrpeflnrvddvvlfkplqrheirqivkllaqelqkrlkdhridlelseeavdyiadagydp
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ewrlvdallprperktsmpdfmkifsgkeaeetppqeedtirestrnkvyallkagkldereve
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  gfadfigemrsamrvsdsalavvsglhgvevqtgkayeyaedfsipvafvvskldrensdyart
gi|294101565|ref|YP_003553423.1|  tfrpefinrvdemvvfrplskkemlvivdimlsdvrerlryqdidikvseeakafilekgynpr
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  piitmpdddmthpvvdlsgyitegqivldrgihdrgayppinvlpslsrlmnk...........
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  easvylgmtlaeyfrdmgyntaimadstsrwaealreiggrleempgeegypaylgtrlaqyye
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  wqsrryqekplvsfddiativsewtnipvtqlteeetqrllrm.....................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  vgvgqseidivkladtvclvlvpgmgddiqimkagimeiadifvvnkadrpgaekietevklml
gi|294101894|ref|YP_003553752.1|  trksesasitrdvsgegvqqallkilegtlsnvppkggrkhpyqdfiqmdtsnilficggafag
gi|294101778|ref|YP_003553636.1|  allrpgrfdrhivvdrpdvkgreeilavhvrnkkiaddvdlgvvarrtpgfvgadlanlvneaa
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  lrrpgrfdreisipipdrngrfeilqihtrgmplaedvdlmrlsdithgfvgadlealakeaam
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  thevylvptrhkeeglinvllwekpsraivfchtraetveltrrlhdenfqamclhgemsqrer
gi|294102459|ref|YP_003554317.1|  etgkdvvllldsitrlarasnlvvppsgrtlsggmdpaalyfpkrffgaarnieeggsltvigt
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  sggdihficrkasalairdflkigekgapciekhhfeials.......................
gi|294102074|ref|YP_003553932.1|  ksdvekvleagvdvvleidvqgalqvknafddsvlifimppskeelerrlrnrgteeedtvqlr
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  gvsllpatidlagaevelasvisretclrrhmanlnqfdvaiidcppslglltinalvaahklv
gi|294101321|ref|YP_003553179.1|  knmitgaaqmdgailvvsaadgpmpqtrehvllarqvnvpavvvfmnktdqvdddelldlveme
gi|294101626|ref|YP_003553484.1|  knmitgaaqmdgailvvsaadgpmpqtrehvllarqvnvpavvvfmnktdqvdddelldlveme
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  lhnvtdrsivvldeigrgtstydgmsiawavleyldhgcgskpkvlfathyhelvaledhlngl
gi|294101748|ref|YP_003553606.1|  srqkriledtkkglvdiligtqrllqkdiefkdlglliideehrfgvmhkeklkdtregldvlt
gi|294102409|ref|YP_003554267.1|  rridnqlrgrsgrqgdpgssrfylsleddllrlfgseriqgimeklgmeegeai..........
gi|294102070|ref|YP_003553928.1|  aqviekgkglillinkwdtleaadklgdemrkrvrdempflshapllfvsaltkrglnkltqti
gi|294102390|ref|YP_003554248.1|  knrareltlqkistgeahvvvgthalfsdpvtfsnlgfavideqhrfgvlqknalrakganegq
gi|294101403|ref|YP_003553261.1|  ldtlvrsgavdlvvvdsvaaltpqaeidgkigdsqlglqarlmsyalrrltsaisrsncvvvfi
gi|294101730|ref|YP_003553588.1|  yiidevhmlslsafnallktleeppshvvfilattephkvpvtirsrcqhipfrkidvqnivks
gi|294102602|ref|YP_003554460.1|  vlllvdanegpmpqtryvlmralamglrpivfinkvdrphanpmsalnqtfdlfielgaaeeql
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  srdaskgaglgnaflsfvaesdalvhvvrtfdnpevphpednidpardwnivemeliyrdlgvi
gi|294102150|ref|YP_003554008.1|  ghvdftyevsrsiascegallvvdasqgveaqtvanaymavdqgleiipvinkidlpsahpesv
gi|294101607|ref|YP_003553465.1|  sanrgepltsgdtslasmafsniadrllgkev................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  lvvtspqelsvmvvekalnmtkmmevpllgavenmsyvtcpdcgkaievfgpshvkeieekfsl
gi|294101963|ref|YP_003553821.1|  iailvvaaddglmpqtkeainharaagvpivvavnkidkpaarpdrvrqqlsdvglvpeewggd
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  slhiivgkgplannicltlppftlvgattrlglltsplrarfgiveqlalynvdetseivqrga
gi|294102400|ref|YP_003554258.1|  kqqevaeisralkgvareldvpvialsqlsraveqrnekmpqlsdlrdsgaieqdadlvmllyr
gi|294102043|ref|YP_003553901.1|  ispalscgqivlcerytdstrayqiwgrglpeekvedlfawcsfpepdltlwidtplpvainri
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  hkalslngvilskydntakggvilaiahrlalpiryiglgesvddlrlfepqefvralle....
gi|294101613|ref|YP_003553471.1|  refspetgtslfvdgmrirlqdlddvkrqwhmegeqfafigqgevaeaihhrpqqrrsilealf
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  tdhyiesafdlsnvifittanvthtipaplldrmevirlpgyvaeekihiakkhllpklfkehg
gi|294101841|ref|YP_003553699.1|  ihvldlsvgtpedvlyqwevicsefkaykesllerpymvvgnkidierghenapaiesfmkarn
gi|294102070|ref|YP_003553928.1|  lfvidgfngpnwmdedvahilrrsgkpvivvanklddgihedrvydayslgfehvvgisalhkr
gi|294102221|ref|YP_003554079.1|  arrdkfalarkiltdkkntafyfvlnaeklpiietkraieilqkhdigiggvivnkvipeeagp
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  davmlvvaadegvmpqtrehlailnllgvhdgviviskadlvdeellelaiadvtdfvqgtfle
gi|294101756|ref|YP_003553614.1|  slenadlilyvvevddisispeddriieilqevstpiflvvnkidqvqqserrlmavaslfkek
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  meadvriwvidgsepltpadlalvqkisatnhivtinkadlplviseemingllpqspvfvisa
gi|294101016|ref|YP_003552874.1|  eeffhtfnqlhvskkqivicsdrppkeiqniedrlvsrfewglvtdiqmpdletriailqkkaq
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  psqvravaqqcidsakktgipfvvvghitkegriagpmllehmvdavllfsgedtsayrmirgt
gi|294102507|ref|YP_003554365.1|  rrdllealrqpledgsivvsraagrvefpcrvlllaacnpcpcgwagdpvescscsayekerys
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  rngrgktfiqgklfplslfnevaapllriqsqfaqlelldsdrqrdildsyggeeiiclknelr
gi|294101553|ref|YP_003553411.1|  yaedhlndviifdtagrlhvdedlmeelsrlkdlvnpheillvvdamtgqeavkvatsfhekls
gi|294101853|ref|YP_003553711.1|  eqrydifakarvrnlagynekaipkdrlphiviivdeladlmftaqkdvedyicrlaqmaratg
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ehirsprvdsivssyaalptvrrcllsiqreqaeegglvadgrdmgtvvfpdatikiyltasds
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  kpelaitvvdasnlerslylvvqmleagqpliialnmadvaenkgirihreklekalgvpvvpt
gi|294102390|ref|YP_003554248.1|  attdgfkiaeadlrlrgpgevcgvrqhgitdfrvadllkd........................
gi|294101443|ref|YP_003553301.1|  nallpsvekgdiilvgtttenpwfeinktllsrlvvfqlkplaeedlvqilykalkdeekglga
gi|294101748|ref|YP_003553606.1|  daqelglaqmyqlrgrvgrreegayayflypetmplqketmerfeaisafsdigsgyslalqdl
gi|294101649|ref|YP_003553507.1|  ekgflldgfprtvpqaealdqllatmnlsldavilldvddevvvkrlcgrrmcrqcgeiyhvtf
gi|294101715|ref|YP_003553573.1|  ratlkeq.........................................................
gi|294101925|ref|YP_003553783.1|  fkkencklksgdvtqefitadspipfsarklwyemnwwlnasfestkkdeqkretkyeinkgdy
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  dlfsperflryidknvieiaplaymrgrtlndsfiildeaqnttpeqmkmfltrlgfgskavvt
gi|294101046|ref|YP_003552904.1|  ytkephqkliidefhyifedpdrartyidgirgtapttsilvmsatfsqpgvigryletiters
gi|294101779|ref|YP_003553637.1|  dasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavgekwdrrgfmer
gi|294101226|ref|YP_003553084.1|  iivldatalernlylafqamergihtivalnmvdearhrgisidveklekllgvpvvptvalsg
gi|294101892|ref|YP_003553750.1|  eqyitqretlqllvhlvdfrhgllkndqelqewisqigipslvvftkadkiskgrhkgmlhsyi
gi|294102315|ref|YP_003554173.1|  aareaekwkkglagwgidgdrikkmresvsfsiytpgsnsgikvnvlgsfrcpsekiindhdlf
gi|294102188|ref|YP_003554046.1|  ivnkaeredrsivekiqreygvkgllpfdeklekgwlkgeplilsqprspyskvireiaselvg
gi|294102320|ref|YP_003554178.1|  qfkyarympmlyyknelnqlerqsqrnmgrfmkillvkrlessffafrntgqrflnsynmflke
gi|294102169|ref|YP_003554027.1|  kelpledldvifienvgnlvcpaefdigedmkvavssvpegadkplkyphlfseakavlltkmd
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  eetlsdigagaiprlivlnkidkidlslipflqtrlqgrskakvlpicalsgvgvtellqevey
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  aatldeieihsitaarekkleemipdschtvlfepsqienkaesy...................
gi|294101141|ref|YP_003552999.1|  refnvpalcmtaslpinrldqlreaglkifpesiasfpdlkekasamryrvkqckkeealeeal
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  eelyrcgllvsshietalkmlrsieelcnekpydvddgplalalawieevrlfshslqwclavg
gi|294101032|ref|YP_003552890.1|  gcgvcelvcpqkaikdskasigimniknqesfwflegildigepnpvplihavlkkadslpfpq
gi|294101031|ref|YP_003552889.1|  vcphqaismhsyeqgqywrgtttygplwharlhageensgmlvarlkkesrkealkegvpfivi
gi|294101431|ref|YP_003553289.1|  kllkgeevrvpefdfikgkkfpgatlrlnkhdvliiegihglnekvtavvpeemkfgifvsplt
gi|294102167|ref|YP_003554025.1|  sivfsdmteyewvcdmihpfvriemerkvaslqgwviaeipllfenripwwvdlsvyvtapldl
gi|294101458|ref|YP_003553316.1|  mltdrrnvvviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltd
gi|294102320|ref|YP_003554178.1|  kyietvkenareirnkvlkylmvrrtraeie.................................
gi|294101940|ref|YP_003553798.1|  prirearegmkkhlnrlevvgeesgqrwtidrlekhvalripslvvidyltllkrpgqsdleav
gi|294102120|ref|YP_003553978.1|  lgehgtrivsrltema................................................
gi|294101791|ref|YP_003553649.1|  vlviewpdrlaeqpt.................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  lfldssdeslvrrfettrrrhplgdhipvlegiqkerallapvreyadvvldtsglsirglkdr
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  pkrasqlhvndvr...................................................
gi|294102787|ref|YP_003554645.1|  arngtsledllgyvdremyerifsvgledmqkirplndrgiqsrffsagaglgtaslptflasl
gi|294102032|ref|YP_003553890.1|  selkiaiskafeksqyedakaqlvknfqeqvnglmeevrawagekgfalkrtpqgfvnipmiee
gi|294102010|ref|YP_003553868.1|  alkqfepiikkvgyrlilvvnafrpqtasvtriqkmmkkmesicglevgalisnshlmh.....
gi|294101586|ref|YP_003553444.1|  diqnrigsnfdillleggksfpchkiw.....................................
gi|294101458|ref|YP_003553316.1|  ikvvitgsssdpsdwqafigskadretlakrmkdrndelklvivrdmwltgfdvpsmhsmyvdk
gi|294102625|ref|YP_003554483.1|  aapergldsfkkmclfvktikkggtpveilsalyslaaenpswgkelslwamdhpefdesirrl
gi|294102478|ref|YP_003554336.1|  qvs.............................................................
gi|294101874|ref|YP_003553732.1|  pqperfi.........................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  vralkmhggvakseltgenlealskgipnlekhienmqgfgvpvvvainrfptdteaelklvhe
gi|294102529|ref|YP_003554387.1|  adlgaekffdikcrignltpsavvivatvralkmhggvakneltgenlealskgipnlekhien
gi|294102437|ref|YP_003554295.1|  dhgqtlrdrggeygattgrprrcgwldmvalkyavrvngmssialtkldvltgfekikicthye
gi|294102168|ref|YP_003554026.1|  rlhnfcgyrygdmavlyrinamsriyeqkciekgvpyrvvrgtafydrkeikdvlsfmrlavnp
gi|294101779|ref|YP_003553637.1|  lidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidpvsghtlkqlpk
gi|294102457|ref|YP_003554315.1|  f...............................................................
gi|294101625|ref|YP_003553483.1|  drfsgivdliqmkavffqddlgtapvvgeipgelmadvkkardllienladfdesvmesylegq
gi|294101185|ref|YP_003553043.1|  veqpdvedtisilrglkerlevhhgvrirdnalvgaavlsnryitdrflpdkaidlvdeacami
gi|294102626|ref|YP_003554484.1|  kirearlrqirrlallfsqyyeekrtvwdkqkeclrpvqwkdmailvpsrtswfpllekiffee
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  dkthpipdltgyitegqiilsrglhrkgiyppvdvmpslsrlkdk...................
gi|294101806|ref|YP_003553664.1|  sfyeragraiclgsdgregsvtaigavsppggdlsepvsqntlrvtkvfwgldaslayqrhfpa
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  vfgarplkrfivkqletrmarslvagevregskvyvtvkdkalaf...................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  levaesasmgipilggagmdsmgmninemlsgllpkktkkrrmkvsdgkkllqaeeaeklidme
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  lddikkqlsdkavpfflpigkeasfkgvvdilnqkayeyvtdgsgsfkeisipaemvdevsaar
gi|294101565|ref|YP_003553423.1|  ygarplrrkiqqliedrmadmllegkikkgslvsidedk.........................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ragrakllglperegsvtvinavspaggdfsepvtqaslrlsgafwaldkrlaqqrhfpainwq
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  dligktdwfppihmtvaekgdgvaelvegiekhgaflkqsihgikkqkrklaeeikdilsrdia
gi|294101894|ref|YP_003553752.1|  ieevigrrvnkkmigfggdilsvkehrnyelmrqvqpedlmafgfipeligrlpvvvpleeldd
gi|294101778|ref|YP_003553636.1|  llaaragkslitmaefeegidr..........................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  sslrellpcidyeqavipyekllsmnvtmenfldalkevepsa.....................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  nmalsqfrsgrtpllvatnvaargldvegvshviqmglpdnretfvhrsgrtgraghegrnllv
gi|294102459|ref|YP_003554317.1|  alvdtgsrmddviyeefkgtgnmelhlsrklaeqrifpavditksgtrreell...........
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  lsnalkemekmhmydyvvvndsvlraaleikriiasynl.........................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  vpiqceyyalegvgqlahtiglvrdclnpdlavdgvlltmydsrtrlandvveevrrqfgeivf
gi|294101321|ref|YP_003553179.1|  irellskydfpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapqretdkpfl
gi|294101626|ref|YP_003553484.1|  irellskydfpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapqretdkpfl
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  knlsmavhegergisflykvvdgpadrsygievarlagippavlkrafhlletfe.........
gi|294101748|ref|YP_003553606.1|  lsatpiprtlslslrglrsfsiistpp.....................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  knvqenrsrrigttelnrlirdvlafqtlptsrkgrvlkiyyctqtsiepptfvffvndpeivs
gi|294102390|ref|YP_003554248.1|  aphilvmtatpiprtltlsvygdlsvsvidempp..............................
gi|294101403|ref|YP_003553261.1|  nqlrakistgyssgpqetttggralkfyssvrvevkrgksinkgedaighelwmkvvknkqapp
gi|294101730|ref|YP_003553588.1|  lsmvahnenrnaeeealweiarqadgamrdalslleqvma........................
gi|294102602|ref|YP_003554460.1|  dfpvlygsgldgwavrdlnkyahegmkhlfetiaeyvpapkvnlhap.................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  dnrlsrlaakkrllpeeeeekkllercqaflmeekplrelglsedeqrklsgfafltlkpemiv
gi|294102150|ref|YP_003554008.1|  qkeieevvgidadgailasakegigiqdilerivaqvpapegdteaplqalifdsvynnyrg..
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  pvlgkfpldlelshlgdqgr............................................
gi|294101963|ref|YP_003553821.1|  simvdvsaktgegiphllemvllvaemeelradp..............................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  kvlgieieeeaayeiarrsrgtprvairllkrvrdvaevrqspsintavasvalnm........
gi|294102400|ref|YP_003554258.1|  pgyydtaaspeeednratiriakhrngptgdvnlvfl...........................
gi|294102043|ref|YP_003553901.1|  kttrghfdriesetdgflnrvcegykelskrfphrivridgsqpteevsaqiwkvvevhls...
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  gidqyrkkredanqklkfaseelarletlvseltsrrdeiaamvtiaekarrlldeldekrrgy
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ltdkmisitsktvektirdytreagvrnlqrslatlcrkv........................
gi|294101841|ref|YP_003553699.1|  ipyyntsaitgegiaefmgnivalcrehtrphsei.............................
gi|294102070|ref|YP_003553928.1|  yiddlmdmavsllpsdeee.............................................
gi|294102221|ref|YP_003554079.1|  ffekrrvdqeqylkqidemfggfgvariplldsdikgieql.......................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  gkvvvpvssvtnknipllmeelaklidrvqprtrrgpffmpidrafpisgfgt...........
gi|294101756|ref|YP_003553614.1|  lpivgalgvsakkgynidklvqilkdklpagfpwydeeiltdrperflageiirekvlllth..
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ekregiealkdai...................................................
gi|294101016|ref|YP_003552874.1|  irnyevpedvisflaqnvpsnirelegalnri................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  knrygntdelgifemtekgl............................................
gi|294102507|ref|YP_003554365.1|  krlsgpildridlhvsvprllpkelisfedqsgedsetvrqrvcearekqrlrwrkygfhcnae
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  svfsnallkekelrsvekkqkevidryenansilqsfksispesnseaiwegrlerisksideh
gi|294101553|ref|YP_003553411.1|  ltgvvlskldgdarggaalairattqvpikfagvgegidaielfdakrmaqriigmgdvmglae
gi|294101853|ref|YP_003553711.1|  ihlllatqrpsvnvvtglikaniparvaftlpsqadsrtiidvsgaekllgkgdmlfvsprfpk
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  vrakrrhlqllergekvsfdevlrqiqnrdqfdsnreiaplcqasdaifvdtssmtedevvdyl
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  varerkgledlvkrvkdrfengvsl.......................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  lklavsedvitvlakmaggdarqaltrlellassvaasgaaeltmah.................
gi|294101748|ref|YP_003553606.1|  qirgsgdiigvsqhgqdervgyrfyykmleeeiar.............................
gi|294101649|ref|YP_003553507.1|  kpssqgmrcekcggelfqrdddketvirsrlkvyhdqtaplisyydekgllrkvnagtssssvm
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  enligaeftshlttannqpphvsqhkdfysyekkllarlkdsrfnfmfhpgdykdassskdlhn
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  gditqidlpsgkksgliqvreilegikg....................................
gi|294101046|ref|YP_003552904.1|  ftvyesqervtdlvyvpkkpaqlfsvhdalvfvfsqrgtmdlaytiartrrrlpreqrsrlyel
gi|294101779|ref|YP_003553637.1|  lidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidpvsghtlkqlpk
gi|294101226|ref|YP_003553084.1|  qginriiqripearkghippl...........................................
gi|294101892|ref|YP_003553750.1|  rkglksievpfivsaqdksgvgefrqfltqyl................................
gi|294102315|ref|YP_003554173.1|  lekvqnttstllsllniesdplsgrehlliskifeqswrngkdvdlpmiingiqtppfaqigvm
gi|294102188|ref|YP_003554046.1|  ke..............................................................
gi|294102320|ref|YP_003554178.1|  lddgfiyvskkysnkifellesdddealqklidegkaeryssedfkdelrtdlehdrailmeik
gi|294102169|ref|YP_003554027.1|  lapyvpfdmdlykndlqhlnprvecieiealngkgidrwvslvetwlke...............
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  kaykngekvlwvvntvkrcqeiamelqesfaenllcyhsrfrlkdrqkwhkkliekfrdpepmi
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  hfpewaywregdalvseptlcsdkvsegilsqkaekiiaisatmtvegsfdfwkretgiiptdt
gi|294101032|ref|YP_003552890.1|  ivdgppgnacpmvaaveqsnfvilvteptpfglsdlalatetvrelhipagvvinrsdlgniee
gi|294101031|ref|YP_003552889.1|  dgppgiscpaisaltgatlavavtepslsglhdllrlsklcasldvplaivlnksdlseakgee
gi|294101431|ref|YP_003553289.1|  ginldehnrtsttdnrllrrmirdyrtrghsaertldlwpsvikgareyifpyqssavamfnss
gi|294102167|ref|YP_003554025.1|  rlarnevrgwnkeeierrerflrnaeekraeadlvirndssidtleqslsr.............
gi|294101458|ref|YP_003553316.1|  kntrvvfgdyidiydmtravedgttvkifyesriakldlpeemkp...................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  eevmprlktltqrlkirtlilsqlgraskldqrkgatgghakgggiveelvhseieiqkdgldk
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  liae............................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  snqekalyriqggarssaeinvflkkiqetkeqikllqqqkdeylqkkeelektghqiesarkn
gi|294102032|ref|YP_003553890.1|  ttesgdvskrelqqeefeslseekqkelqgkseeisqrtldtlrkirdlekalkeeigkleaei
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  pmsghnlmqaiarvnrvfkekqgglvvdyi..................................
gi|294102625|ref|YP_003554483.1|  qaalretehkveslgelqdrigpagqvrfsgseavsflhhwtsmatiwlppaikgalslfigtp
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  rcaafgvpvalseiwakggeggielaerileavekpnsfhplydvaqspkekiekiakeiygak
gi|294102529|ref|YP_003554387.1|  mkrfgipvvvainrfptdteaelelvkehcvalgvqqvlsevwakggeggielaervleavekp
gi|294102437|ref|YP_003554295.1|  vngekhenyltntsllakaspvyttldgwkedisgcrdfeklpeaarryveyieketgvpvqli
gi|294102168|ref|YP_003554026.1|  ldgaslgrianvptrgigkksqeklmeglgaipemeaeqlwravadgkdlgltgkakigamelg
gi|294101779|ref|YP_003553637.1|  asifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtrydmemlaevgycs
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  dvpeetlrrairentiqqrivpvlcgsafknkgiqllldavvdylps.................
gi|294101185|ref|YP_003553043.1|  rteidslpaeldaasrkvmqleieeaalkkekdaaslerlsvlqkelqeareeadalraqyese
gi|294102626|ref|YP_003554484.1|  fqlpiyfegstsyfsrseiqdliallnflddpgkelylmsflssplsslsleevrdlaldapkg
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  inwllsyslytdt...................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  svarealdkaqeegiifideidkvvargtssgpdvsregvqrdllpivegstvqtkygtvktdh
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  esliesvveaddevmmmylegdeisheeivkvarkairerqifpvlpasgtanigvhqvldflg
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  qsytlyegs.......................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  knv.............................................................
gi|294101894|ref|YP_003553752.1|  dalarilvepknalirqyqktfeiegvklffeqdaikaiakearkkntgarglrsimeylmldl
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  lspkea..........................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  stivprnvklseapshampiayyeptctgakaymnfsmevaerwl...................
gi|294101321|ref|YP_003553179.1|  mpiedvftitgrgt..................................................
gi|294101626|ref|YP_003553484.1|  mpiedvftitgrgt..................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  qsfnkhienkiremdtfdgtplrlywr.....................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  frtahasliygkgv..................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  lnldetqteghvpgldaimsiakerglglvqvfgrmememadlsedeqrefmadlgikeagrer
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  yfsrraflerelysfqsrihalerrknraaewetiwkeglsfyqslfnsyeqqkkvheertesl
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  lperiikrelnlgtdvrpflirmadnlrlsgrgisrvlkvartiadldnssrvrvphisealay
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  tkleqilarltggktgegiadsienlcleltqiispdtekgskyqelgnnalvflqklsqsltv
gi|294101553|ref|YP_003553411.1|  kvqqvtsqedvakitkslkkdkltmedlllqfeqieklgpldkvidml................
gi|294101853|ref|YP_003553711.1|  pvrlqspyiedgksle................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  vrlvke..........................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  aeiealv.........................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  llnewigsenklaildlsgvpfevldiaiglitrfvydsmywgkyesytgknrplllayeeaht
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  atildvpkvqmpllcgigiyhgsmlpkekllvesafrerildvvvgtnalalgvnlpaesvifa
gi|294101779|ref|YP_003553637.1|  asifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtrydmemlaevgycs
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ptdtfyppserfklalalnqilaspafnqwmtgvpleigsflhspegkprasiftvshlsdner
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  rlweqidrdpkllkfkkelstnatlqknhliiftesketanylfeeinkeypkkvllftgdske
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  aittqvcemsldlsasllisefapvtsliqrmgrcnryleiceggrilly..............
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  yvlespfdlekqmkilvvdlglkviekgydervcrvverlcndnggsslvllssmrlvkkvgnw
gi|294101032|ref|YP_003552890.1|  aeifcknlalpilarlpfskevarayakgiapilidkqwqeaasdilnhvkevl..........
gi|294101031|ref|YP_003552889.1|  ikneakkenwhflgsipfrpnvveaiskkeiplea.............................
gi|294101431|ref|YP_003553289.1|  lpyelavlrgyaqpllqtvpesssmhgearrllsmlkfvpplpsenvpsnsilrefigggc...
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ngqprliatitkarhgtkgsfeleyig.....................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  leairydlslmewvekarspwvemteaqrkleeigevlffpdegllrfkkiheeegarerelee
gi|294102032|ref|YP_003553890.1|  crsaitpylqdvkekygtteilckwidalaediisnfnifvaaakdesteidfsrytinvfvan
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  pvleknslwimpnitasiwpgkmsessllpdrhklalhdltgterghlpllkekrdqrealfrr
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  gvtytaqaekdleeihrlgkdnlvicmaktqasisdnpaligrpegfeltvrevrlsagagfii
gi|294102529|ref|YP_003554387.1|  ntfhklydaslspkekiekiakeiygaksvaymaqaekdleeihrlgkdnllvcmgktqasisd
gi|294102437|ref|YP_003554295.1|  gvgpgrsqtilr....................................................
gi|294102168|ref|YP_003554026.1|  rhmfniikrsgsfhdvllyildsieyedqlkkddpegweervenirelgslvtsggdlaevlae
gi|294101779|ref|YP_003553637.1|  gienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdrarkttlvengfrl
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  keviskvrkmreeidavkreiekaereydlnkaaelkhgrlpelqqqlkkeegahaagqegdql
gi|294102626|ref|YP_003554484.1|  yrlqafqekwphlarqiddwrlmahflgpsavlasfleksdsflrafpawkrrgvaanmrkaid
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ilfiaagafssvkpsdlvpelqgrfpirvelqplgreelarilvepenslikqyqallsterie
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  dmfps...........................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  myeipsrsnevekiiitkevvek.........................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  liqeaysllglisffttgkdevkawtlkkdata...............................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  gfqretlrrqcfataltvksarerliaqkeekrhveevlskvdeeatlargtsysltqnlhkkk
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  llseqslsdlyaeqeeienklgtlrklkrlagvrtleeltnyckeaemnltwlnesyrrseqsg
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ylnkndnnsysknaverifkegrkfgvgalvisqrpseisetilaqvgtlialrltnsgdqsiv
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  qlvqfhdnapiskneflqmagragrkglfdtgyvtwl...........................
gi|294101779|ref|YP_003553637.1|  gienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdrarkttlvengfrl
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  mffismvlneivgwmrtqtgtpslrailyidevfgymppvkeppskkplitllkqarafgigvv
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  avrdkvianfdararskkgdyrilistevlsegvnlhrsnvvvnydipwnptrmmqrvgrinrv
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  lkgsqhpytvyvqnelprtellerfrsdlssvligsvsfregvdvpgegltqviidripfphpk
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  lvfqcrnldkqlqafhipsiqkvleqkgairalaqnrnriekeeeiiqnlsldilsmkqrldre
gi|294102032|ref|YP_003553890.1|  dpengvpviwetnptyynltgkveyesrqgylytdfhkivsgafqkanggylvldaekvllnfm
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  lvacgedllilsspstdalgkplppspflg..................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  aitgsimtmpglpkvpaamkidvdndgnitg.................................
gi|294102529|ref|YP_003554387.1|  npaligrpegfeltvrevrlsagagfivpitgsimtmpglpkvpaamkidvdddgnitg.....
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  valftdlettdmddleavnfltlhaakglefpvvflvgleeaifphfkclevqesleeerrlcy
gi|294101779|ref|YP_003553637.1|  pscldnrplnwrefkkylrqvifisatpgdwerevstcvaeqiirp..................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  lreevtedeiaeivsrwtg.............................................
gi|294102626|ref|YP_003554484.1|  marefeeaigtslpgcasylreamerqekfaepdvsnekenvirvmtvhgskglefpvlavlgl
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  vrfsedaieeiaamaekmnaemenigarrlhtmveqlleeisftaperqgevvdinaqfvkerl
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  eevsalwqklsnlrsslraerqrrqeygneyarvegecvkilsrlqarsealdknekeleeakn
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  aeakklrreasrlalelrkkrertarsleeavnhslrdmameditfsitlsdlgkikstgadei
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  kssspdnlnslidllpslrigeavivgesikipsrirvklnnprp...................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  pscldnrplnwrefkkylrqvifisatpgdwerevstcvaeqiirptgvvdpevvvspatgqvd
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  latqnpvdldykglsnigtwfigrlqtqrdkdrvleglerlenasgydrqfldkaitglkkref
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  dtpfdvihtfnffpttqsndqiklkeaaegkinafltllggdaellt.................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  dpvvqsrnelegrkafvtvilpqakmflrqalgrlirsksdqgrvvil................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  vreihqswtiddlesldlsfgvsqkagdlekqkedfrnqhvirnetceqarkardearsllktr
gi|294102032|ref|YP_003553890.1|  swealkralrtgeatienlgeqygaipisslrpqpipinvkvvmvgtpylyallqyydpeflkm
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  vgmtraeeklymsgarsrrlfgtvfrnglsrflweipd..........................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ertssagekgslmpspkmgvalsripgernsgqaplawslsrlfeeqeeyeewqrlfyvactra
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  splmedt.........................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  kvfvaeketetykkefeythlsykkiierhgeiyvqcqrlatslsqlkknvdvlenqletvlen
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  sflmasgmmppgpvmkiasggelsrlllalqlalpdsqlpgtlvfdeveaglggkaavlagykl
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  dlvdrlrgitargeralvttltkkssedlaeyladlqfkvkyihselnaferaelirdlrsgev
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  llnnvhenspsif...................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  kehvekmernvsplsvqtlrekcgslrqfftrwhqiqnqikenemnldlfrqkkelqwggaaag
gi|294102032|ref|YP_003553890.1|  fkikaefdrdmprtfeseqqmaqficgfvrnegkipftvkavaeviewagrlaehqnrvttefn
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  rdslilcghlpwrrdg................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  teqrlypepvrvilaaqklgklpiqiklaaeafkceeklaapleaylggrqfwlfvksleeaql
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  kqlaekcrvilitheatiaalaeqhfvvarqenksfikeiek......................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  silvginllregmdlpevslvaildadregflrshrsliqimgraarntrgqvvlyadvetesi
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  tlglaflgagyrtgdifflktgitaiaaslgfiivdffqkrkffnekeellcrlrknlveteee
gi|294102032|ref|YP_003553890.1|  kiieviveatawalsenatlvedrhvykaieekrfrsnliqeriqraye...............
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1g6oa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  gielvkqkragritflpleqchprnpdygfplpcqgtvgwatdliaseqlwspavnhllgdlli
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................