SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

P-loop containing nucleoside triphosphate hydrolases alignments in Aminobacterium colombiense DSM 12261

These alignments are sequences aligned to the 0038720 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1htwa_                             mesltqyipde.....................................................
gi|294102520|ref|YP_003554378.1|  dieiarsakmkpivevaaqlgideeelelygkykakvtyglwnrikdrpdgklvlvtaitpt..
gi|294102529|ref|YP_003554387.1|  dieiaqnaelkpivevaaqlginedeleyygkykakvtyglwnrikdrpdgklvlvtaitptp.
gi|294102437|ref|YP_003554295.1|  veiiigaqwgdegkgrvvdalgnrvevfaryqgganaghtvivedekyvfhllpsgmlypcklc
gi|294102168|ref|YP_003554026.1|  dsildklnprqqeavrycdgpllvlagagsgktrvlahkiayliekgyaspkgilavtftnkaa
gi|294101779|ref|YP_003553637.1|  adwgpsgdqpeaieklveslkngtrf......................................
gi|294102457|ref|YP_003554315.1|  tkfifvtggvvsslgkgitaaslgvllkkrgfrvsiikldpylnvdagtmnpfqhgevfvtddg
gi|294101625|ref|YP_003553483.1|  emkkirnigiaa....................................................
gi|294101185|ref|YP_003553043.1|  tyealdkygrdlvkmarlgkldpvigrdeevrrvirilsrktknnp..................
gi|294102626|ref|YP_003554484.1|  tqpgqfkaitadaplvavsagagtgktwtlawrfiwilvtgradtneiltltftekaalemaer
gi|294101765|ref|YP_003553623.1|  ydaafpakdivdfvdriineaakngasdihieglsawsrvrfridgycravysfsldfhpaiis
gi|294102479|ref|YP_003554337.1|  hpvplgviqg......................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  yikkivkdfgsyddps................................................
gi|294101807|ref|YP_003553665.1|  tlpvsrdmlgrifngrgepidggapilpdakldingmpmnpfsrdypsefiqtgistidgmnpm
gi|294101806|ref|YP_003553664.1|  vietiaviknesgeeknvvmlqrwpvrkprpvarrlppiiplttgqrvvdaf............
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ipvtrlmegerekllkldeilhqrvigqdeavelvadavirarsgikdprrpvgs.........
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ltprmivecldryivgqekakravaialrnrmrrrnlprdlaneva..................
gi|294102409|ref|YP_003554267.1|  pneralkryrqiaddinglepeysaksdedlrslvadfkrranegesldnllvevfalvrevsr
gi|294102354|ref|YP_003554212.1|  kpedirs.........................................................
gi|294101565|ref|YP_003553423.1|  ipvtqlteeetqrllrmeeeihcrligqeeavsavarairrarsgmkdprrpvgs.........
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  kmpvglslvgqvlngrgrsidgtplsfidkdlpitgmpinpvrrtspnayvetgissidmmntl
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  dkse............................................................
gi|294101977|ref|YP_003553835.1|  engveltmkqrwevrrprpvlsrlsfdaplltgqrildtlfpiaigg.................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ptldqlgidlseksrkdeldpvigrdkeiqrviqilarrtknnp....................
gi|294101786|ref|YP_003553644.1|  l...............................................................
gi|294101493|ref|YP_003553351.1|  l...............................................................
gi|294101884|ref|YP_003553742.1|  aekalhgdiralariislveneapeseeimkylypht...........................
gi|294101894|ref|YP_003553752.1|  dtpkpaevkkfldqyvigqedakkilsvavynhfkristmseenddielqk.............
gi|294101778|ref|YP_003553636.1|  dnrpkvtfddvagcdeskeelseviqflrdpgkfralga.........................
gi|294102313|ref|YP_003554171.1|  i...............................................................
gi|294102640|ref|YP_003554498.1|  l...............................................................
gi|294101376|ref|YP_003553234.1|  isyedigglgpqiqrvremielplrfpqvfdr................................
gi|294102641|ref|YP_003554499.1|  l...............................................................
gi|294101359|ref|YP_003553217.1|  skvlilsptrelsqqiwkeakwfgnyinvsaaslvggmdmsqqirslrdgsavvtgtpgrvldh
gi|294102459|ref|YP_003554317.1|  lrngdviwgmvrppkdqehyeallrvemvnfadpeaarkrphfgtltpifpdsrltletdpdei
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  pdvtwsdiggleaikeelieavqwplkynsvyek..............................
gi|294102074|ref|YP_003553932.1|  m...............................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  einrlhddllnevfgygpiqplldddtvteimvngceqvfverwgkieptdvffnndnhirrii
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  mlsiavtnqkg.....................................................
gi|294101321|ref|YP_003553179.1|  akphlnvgt.......................................................
gi|294101626|ref|YP_003553484.1|  akphlnvgt.......................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  p...............................................................
gi|294102760|ref|YP_003554618.1|  tdkvsvfypsrdgkn.................................................
gi|294101659|ref|YP_003553517.1|  t...............................................................
gi|294101172|ref|YP_003553030.1|  n...............................................................
gi|294102017|ref|YP_003553875.1|  yirpqinnglnlkieggrhpvieatfldlpfvpn..............................
gi|294101748|ref|YP_003553606.1|  vldslrgtrwkkavektrervreevknlvrlyarrellkgyafpvaseiyrhfveafpyvetpd
gi|294102409|ref|YP_003554267.1|  pmvrsdfpdviyrtslekfhavaeeveetysngqpvlvgttsienseriskllkarkiphqvln
gi|294102070|ref|YP_003553928.1|  fehvvgisalhkryiddlmdmavsllpsdeeeerdpeei.........................
gi|294102390|ref|YP_003554248.1|  dplpdflrlkhafpplydsilemhypqgreswkkardrlayqelfvlqtgmalrrgersrlaek
gi|294101403|ref|YP_003553261.1|  redilelaiddirskfgegsimrlgdpfkvqvevistgilpldvalgigg..............
gi|294101730|ref|YP_003553588.1|  ekrvsha.........................................................
gi|294102602|ref|YP_003554460.1|  vqaekirnlaiiahid................................................
gi|294102663|ref|YP_003554521.1|  i...............................................................
gi|294101436|ref|YP_003553294.1|  lkc.............................................................
gi|294102150|ref|YP_003554008.1|  slsrirnfciiahid.................................................
gi|294101607|ref|YP_003553465.1|  prvi............................................................
gi|294102035|ref|YP_003553893.1|  rrfvqvymgd......................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ms..............................................................
gi|294102549|ref|YP_003554407.1|  l...............................................................
gi|294102841|ref|YP_003554699.1|  p...............................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  kkdvgkviavg.....................................................
gi|294101963|ref|YP_003553821.1|  khmep...........................................................
gi|294101356|ref|YP_003553214.1|  dssekavaihfpqcprs...............................................
gi|294102542|ref|YP_003554400.1|  r...............................................................
gi|294101861|ref|YP_003553719.1|  lrpsslqdfvgqqklkdklsiyvqaarqrkeal...............................
gi|294102400|ref|YP_003554258.1|  vtgfstgf........................................................
gi|294102043|ref|YP_003553901.1|  m...............................................................
gi|294101077|ref|YP_003552935.1|  m...............................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  k...............................................................
gi|294101613|ref|YP_003553471.1|  mfierlrlkgfksfggshelt...........................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  pwntyteenlditkaqrildedhyglvkvkerilefl...........................
gi|294101841|ref|YP_003553699.1|  d...............................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  mvhhv...........................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  p...............................................................
gi|294102145|ref|YP_003554003.1|  eislvlgtaghid...................................................
gi|294101756|ref|YP_003553614.1|  p...............................................................
gi|294102549|ref|YP_003554407.1|  p...............................................................
gi|294101372|ref|YP_003553230.1|  ytgeemveisthggtlvaqkclesligkgarlaepgeftrraflngkidlsqaeavlgiirsks
gi|294101016|ref|YP_003552874.1|  lnpnyifnsfvvgksnrlahaaslavaetpgeaynp............................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  idesgcekprssdlmavniidvrppqrftsgipeldrvlgggwv....................
gi|294102507|ref|YP_003554365.1|  pnpdladikgqagakraleiaaagh.......................................
gi|294101471|ref|YP_003553329.1|  flrkgg..........................................................
gi|294101845|ref|YP_003553703.1|  mleelslrniggldsahlhf............................................
gi|294101553|ref|YP_003553411.1|  dvdykvvkslvdsirgrcigqevldsitpgqqvvaivyeelvslmgedvvpfiiss........
gi|294101853|ref|YP_003553711.1|  lrveapipgkpyvgieipnpkrrgvllrrilesqafeqadynlplpmgvrvdsrpliigledlp
gi|294101780|ref|YP_003553638.1|  ahh.............................................................
gi|294102079|ref|YP_003553937.1|  m...............................................................
gi|294101472|ref|YP_003553330.1|  f...............................................................
gi|294102235|ref|YP_003554093.1|  it..............................................................
gi|294102390|ref|YP_003554248.1|  ppgrtpiqtrwlkkkeegrlwafirercsareriywvcplidesetlsvasvteryeylkklfp
gi|294101443|ref|YP_003553301.1|  qwerpladrmrpsslddfvgqnhllapgtplrqilqsgkvpsc.....................
gi|294101748|ref|YP_003553606.1|  ppynrvpvltmvgprkknlihravlq......................................
gi|294101649|ref|YP_003553507.1|  m...............................................................
gi|294101715|ref|YP_003553573.1|  wtlpelskkpffvfydllhpllgekgipltiecgrsfh..........................
gi|294101925|ref|YP_003553783.1|  sieigkhsssdnlsvyvdihklilrh......................................
gi|294101367|ref|YP_003553225.1|  lagn............................................................
gi|294101751|ref|YP_003553609.1|  pvrpktggqklyieam................................................
gi|294101046|ref|YP_003552904.1|  na..............................................................
gi|294101779|ref|YP_003553637.1|  t...............................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ppqtlpe.........................................................
gi|294102315|ref|YP_003554173.1|  sdnlvlydskdltthg................................................
gi|294102188|ref|YP_003554046.1|  eriavlscrggaggssfsislalqlasmgkrtalidgdlymgdvafllntpyelnwtswanecl
gi|294102320|ref|YP_003554178.1|  ekytniiideahrfrtettityeklaeicrgkrvilvtatpynnspkdilsllklfqkgqksti
gi|294102169|ref|YP_003554027.1|  svmaadeefarrmrdeshhrgil.........................................
gi|294101254|ref|YP_003553112.1|  kkitvlgd........................................................
gi|294102077|ref|YP_003553935.1|  ryrrekagip......................................................
gi|294102510|ref|YP_003554368.1|  hmakgkrkleelvqkldlilevrdaraphltsspmsdqlsricpvyivlsradlaeegatkawl
gi|294101748|ref|YP_003553606.1|  qvhlpvdggarawilggasvpllvvfsdqrqaedfvsdfenlwegeivrllyelplsvegvrnk
gi|294101141|ref|YP_003552999.1|  dr..............................................................
gi|294101018|ref|YP_003552876.1|  lewaagln........................................................
gi|294101692|ref|YP_003553550.1|  iwdsfmqqrntvfvaeaptgigktfallapalkwalpqekrilfltagitlqeqlirkdlprlk
gi|294101032|ref|YP_003552890.1|  mfrltva.........................................................
gi|294101031|ref|YP_003552889.1|  p...............................................................
gi|294101431|ref|YP_003553289.1|  e...............................................................
gi|294102167|ref|YP_003554025.1|  l...............................................................
gi|294101458|ref|YP_003553316.1|  aplcipqlevlikgmflkdrfldiirhfvlfqsdgkeikkilagyhqyhavnkalqstqratme
gi|294102320|ref|YP_003554178.1|  fkrleyqeqavlnakkivle............................................
gi|294101940|ref|YP_003553798.1|  rlgirrldtafd....................................................
gi|294102120|ref|YP_003553978.1|  rtakglamac......................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  mvkqidirkyrk....................................................
gi|294101830|ref|YP_003553688.1|  r...............................................................
gi|294102042|ref|YP_003553900.1|  iaidiarlllcekknacgqclsccswhekthpdlvlsgslekaptisecreiavelslypvvas
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  mrfiefkir.......................................................
gi|294102032|ref|YP_003553890.1|  le..............................................................
gi|294102010|ref|YP_003553868.1|  tllaslirlye.....................................................
gi|294101586|ref|YP_003553444.1|  y...............................................................
gi|294101458|ref|YP_003553316.1|  vviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltd........
gi|294102625|ref|YP_003554483.1|  ivagsprmemetlarelvlwknkkgylsgqeilpaetpw.........................
gi|294102478|ref|YP_003554336.1|  ipvisvgnitlggtnktpfvemlsrhfynmgvrvgi............................
gi|294101874|ref|YP_003553732.1|  h...............................................................
gi|294102071|ref|YP_003553929.1|  lqehpgpaillfperalaeffysfletegveniflwpsvggkklweawnrt.............


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  vvgngvvvdpeqllkelhtlqeqgkdrarlmisgsahvvmpyhkildkadeqfrskdkkigttg
gi|294102168|ref|YP_003554026.1|  remgervqalvgakasamqvstfhsfglhflfrnsdqleflglrkgfaifdrndsrslvkkime
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  aetdldlghyerfideslsadnnvttgkiystviskerhgcylggtvqviphitneiqdrilka
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  iknlllqlamelpsqkvffqkaadridegyistihsfsmrvlkecg..................
gi|294101765|ref|YP_003553623.1|  rikimasmdisdkrrpqdgqfniktgsqdfldvrvsslptvdgekialrlldsskipdniyqlg
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  vrgqklpifsgsglphnrmaaqiarqatvisghedfavvfaamgitfeeasffmedfrrtgaiq
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  rtlglrhfdvqlmggmalhegkitemktgegktlvatlavvlnalsgngvhvvtvndylakrda
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  vrgqklpifsgsglpaneiaaqivqqaavpgretdflvifaamgitrrearyfidtfestgain
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  irrgtldtsgikivvldegdhmldlgfkeeleaildslpncqrvwlfsatmpaeiknlakrylk
gi|294102459|ref|YP_003554317.1|  strlidlfap......................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  dkivaplgrrideaspmvdarlpdgsrvnavippvsidgptltvrkfrrepftaqdlialgtls
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  qlraeqeilqdmesshpmdr............................................
gi|294102409|ref|YP_003554267.1|  akyhekeaqivaqagrfgavtvatnmagrgtdivlggnpdflaketlrkegn............
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  apilpesgrlkerflkeifpyplteaqkkvsleisqdmal........................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  eealraatrtlrgelssfakdiynemltisssievgldfpeedipfienegvesalytlkqgle
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  h...............................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  dlnvgllhgqlps...................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  sgtvdgerylalgpkdlmimptak........................................
gi|294102320|ref|YP_003554178.1|  pnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylmvrrtraeieeyfsrd
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  qffssikqkawafnflegriqllrrdlaklrpahr.............................
gi|294101748|ref|YP_003553606.1|  slllqrgetlskwkqekgilatspggllspfltgegvfplrremgeergrllrwlevagyervd
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ellgydvsfgllkgrgnyvcvrralelehegflsfgdsgaasiylsewlkktqtgdlselklps
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  qgdrrvgviwhtqgsgkslsmvfyagklvideelenptivvitdrndlddqlfstflkseellr
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  crlvviqsadtlllpaa...............................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  rgigpcyvdkfnrcgiriedlfdpdilreklsfnlelknllltkvynaepvafddiyaqarawg
gi|294102168|ref|YP_003554026.1|  dlkldpkqidptnvldhiskaktegnhktlepvglegiehevyrkyhdelrrqnavdfddllil
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  addndiviaeiggtvgdiegqpfleairqm..................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  feqrdlellekllsq.................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  rtvmfvnladdpaier................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ewmgpiyrflglsvkciyaymdqkerkeaylsdvty............................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ngiffmnlasdsaverlltp............................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  tpvfislteegea...................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  desvsflrvat.....................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  dlldrcnt........................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ikeqglkfpkvakpvplfyelnekedfifnrtiehianqfkyarympmlyyknelnqlerqsqr
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  lvw.............................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  d...............................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ntpvqaqdrvhlrellnnrtsggiifttiqkfapftnet.........................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                10                 20        30     
                                                                 |                  |         |     
d1htwa_                             ....................-----------FSMLRF....G.....KKFAEILLKLHT...EK
gi|294102520|ref|YP_003554378.1|  ....................-----------------....-.....------------...--
gi|294102529|ref|YP_003554387.1|  ....................-----------------....-.....------------...--
gi|294102437|ref|YP_003554295.1|  ...............kalep-----------------....-.....------------...--
gi|294102168|ref|YP_003554026.1|  ........plhllmvdeklr-----------------....-.....------------...--
gi|294101779|ref|YP_003553637.1|  ....................-----------------....-.....------------...--
gi|294102457|ref|YP_003554315.1|  ....................-----------------....-.....------------...--
gi|294101625|ref|YP_003553483.1|  ....................-----------------....-.....------------...--
gi|294101185|ref|YP_003553043.1|  ....................-----------------....-.....------------...--
gi|294102626|ref|YP_003554484.1|  ....................-----------------....-.....------------...--
gi|294101765|ref|YP_003553623.1|  ....................-----------------....-.....------------...-K
gi|294102479|ref|YP_003554337.1|  ....................------AIKMEDVWFAYk...D.....EQWVLKGVALEV...CP
gi|294101904|ref|YP_003553762.1|  ....................-------ISLTHLTKIFtkgkE.....SFKAVDDVHLDI...DA
gi|294102557|ref|YP_003554415.1|  ....................-----------------....N.....RVRAVDRVDLHV...KE
gi|294101807|ref|YP_003553665.1|  ....................-----------------....-.....------------...--
gi|294101806|ref|YP_003553664.1|  ....................-----------------....-.....---------FPI...AK
gi|294102649|ref|YP_003554507.1|  ....................------MISIQNLYKTYpcegG.....DFEALRNVSINI...QS
gi|294101185|ref|YP_003553043.1|  ....................-----------------....-.....------------...--
gi|294102868|ref|YP_003554726.1|  ....................-------LQLKQLNKKF....G.....HSYAVRDFSFDI...NE
gi|294102500|ref|YP_003554358.1|  ....................-----------------....-.....------------...--
gi|294102409|ref|YP_003554267.1|  ....................-----------------....-.....------------...--
gi|294102354|ref|YP_003554212.1|  ....................-----------------....-.....------------...--
gi|294101565|ref|YP_003553423.1|  ....................-----------------....-.....------------...--
gi|294101424|ref|YP_003553282.1|  ....................-------IEVKNLHKSF....G.....NLHVLQGVSMTV...GE
gi|294101976|ref|YP_003553834.1|  ....................-----------------....-.....------------...--
gi|294101061|ref|YP_003552919.1|  ....................------ILRVEDIHKSY....G.....GVEVLRGISFTV...RK
gi|294101048|ref|YP_003552906.1|  ....................-----------------....D.....AVVAVRGVSLAA...RQ
gi|294101977|ref|YP_003553835.1|  ....................-----------------....-.....------------...--
gi|294101084|ref|YP_003552942.1|  ....................------LIHVENLYKSF....E.....DGEVLNGISIDI...HE
gi|294101565|ref|YP_003553423.1|  ....................-----------------....-.....------------...--
gi|294101786|ref|YP_003553644.1|  ....................-------LKVDHLKKHFytpyG.....TLFAVDDVSFSI...KE
gi|294101493|ref|YP_003553351.1|  ....................-------VRVDNIYKTYsm..Gev...DVTALQGVSFSV...KK
gi|294101884|ref|YP_003553742.1|  ....................-----------------....-.....------------...GK
gi|294101894|ref|YP_003553752.1|  ....................-----------------....-.....------------...--
gi|294101778|ref|YP_003553636.1|  ....................-----------------....-.....----------KV...PK
gi|294102313|ref|YP_003554171.1|  ....................-------VNIKELTKRYpmgdH.....TFTALSSVDLEF...KK
gi|294102640|ref|YP_003554498.1|  ....................-------LDIRNLKKYFnvskG.....LLHAVDDITLTI...TK
gi|294101376|ref|YP_003553234.1|  ....................-----------------....-.....---------LGV...QP
gi|294102641|ref|YP_003554499.1|  ....................-------LDIRNLSVRFntdsG.....IVHAVNNLNLSL...RR
gi|294101359|ref|YP_003553217.1|  ....................-----------------....-.....------------...--
gi|294102459|ref|YP_003554317.1|  ....................-----------------....-.....-----------I...GK
gi|294101785|ref|YP_003553643.1|  ....................------ILEIRNLRVSYetedG.....TVEALNGIDLDL...DE
gi|294101376|ref|YP_003553234.1|  ....................-----------------....-.....---------FNI...TP
gi|294102074|ref|YP_003553932.1|  ....................-----------------....-.....------------...--
gi|294102442|ref|YP_003554300.1|  ....................-------IRLAGVTKIFq...P.....DIVALEDVYLSI...MQ
gi|294101577|ref|YP_003553435.1|  ....................-------LKARKVCKAF....K.....GRTVVSSVDLDV...HM
gi|294101171|ref|YP_003553029.1|  ....................------LLELNGVDKFF....G.....GVHAVQSMSFAL...NE
gi|294102413|ref|YP_003554271.1|  ....................------VLETKGLTMCF....G.....GLTAVNSFNMAV...PK
gi|294102187|ref|YP_003554045.1|  ....................-----------------....-.....------------...EA
gi|294102332|ref|YP_003554190.1|  ....................-------IRISGLRKRYgsgdT.....AVDALKMVNMHV...AP
gi|294102831|ref|YP_003554689.1|  ....................-----------------....-.....------------...--
gi|294101321|ref|YP_003553179.1|  ....................-----------------....-.....------------...--
gi|294101626|ref|YP_003553484.1|  ....................-----------------....-.....------------...--
gi|294101069|ref|YP_003552927.1|  ....................------ILSVDDLHFSY....G.....ETPILKNISLSV...KN
gi|294102759|ref|YP_003554617.1|  ....................------MIEIVDLSITYktesH.....DVSAVKNAFLSI...PR
gi|294101055|ref|YP_003552913.1|  ....................------ILEIHQLAVAF....N.....NKKILKNINANI...YP
gi|294101254|ref|YP_003553112.1|  ....................------LVQMQEITKEF....A.....GIVANHNIDFDV...NR
gi|294102760|ref|YP_003554618.1|  ....................-----------------....S.....GQWALRNISLSL...QQ
gi|294101659|ref|YP_003553517.1|  ....................---------LQGVGFSYpe..A.....DSSALDQVSFQV...RE
gi|294101172|ref|YP_003553030.1|  ....................-----ILLDVQNLQVSY....G.....AIRALRGISLQV...KE
gi|294102017|ref|YP_003553875.1|  ....................-----------------....-.....------DIVLDG...DE
gi|294101748|ref|YP_003553606.1|  ....................-----------------....-.....------------...--
gi|294102409|ref|YP_003554267.1|  ....................-----------------....-.....------------...--
gi|294102070|ref|YP_003553928.1|  ....................-----------------....-.....------------...--
gi|294102390|ref|YP_003554248.1|  ....................-----------------....-.....------------...NI
gi|294101403|ref|YP_003553261.1|  ....................-----------------....-.....-----------L...PK
gi|294101730|ref|YP_003553588.1|  ....................-----------------....-.....------------...--
gi|294102602|ref|YP_003554460.1|  ....................-----------------....-.....------------...--
gi|294102663|ref|YP_003554521.1|  ....................---------VSNLNLFY....G.....KNQVLHNINMDI...FG
gi|294101436|ref|YP_003553294.1|  ....................-----------------....-.....------------...--
gi|294102150|ref|YP_003554008.1|  ....................-----------------....-.....------------...--
gi|294101607|ref|YP_003553465.1|  ....................-----------------....-.....------------...--
gi|294102035|ref|YP_003553893.1|  ....................-----------------....-.....------------...--
gi|294102412|ref|YP_003554270.1|  ....................-------LKIEELHVYY....G.....GIHAVKGISLHI...PK
gi|294101660|ref|YP_003553518.1|  ....................-------IIIKNLTHTY....HpstplETVALEGINLTT...EK
gi|294102549|ref|YP_003554407.1|  ....................--------WISRLTKTF....G.....TLRAVDDFSLEI...AS
gi|294102841|ref|YP_003554699.1|  ....................------AVVFEDVSFGYe...N.....GTMVLDQASFQV...PQ
gi|294101272|ref|YP_003553130.1|  ....................------MLRLSHLGKKY....N.....GLPVIDQFDLDI...EK
gi|294101433|ref|YP_003553291.1|  ....................-----------------....-.....------------...--
gi|294101963|ref|YP_003553821.1|  ....................-----------------....-.....------------...-R
gi|294101356|ref|YP_003553214.1|  ....................---GQEVISVKDVKKTY....G.....DNLIFKDISFSV...HR
gi|294102542|ref|YP_003554400.1|  ....................---------LKNIKHFY....S.....QRCVLQIPSLEI...GQ
gi|294101861|ref|YP_003553719.1|  ....................-----------------....-.....------------...--
gi|294102400|ref|YP_003554258.1|  ....................-----------------....-.....--YQFDRMTGGL...QP
gi|294102043|ref|YP_003553901.1|  ....................-----------------....-.....------------...--
gi|294101077|ref|YP_003552935.1|  ....................-----PLLRLKSIAFAYp...R.....SSPLFTHLSFEI...FE
gi|294102348|ref|YP_003554206.1|  ....................------LLKVDSITVRR....D.....NATILKDISLRV...ES
gi|294102040|ref|YP_003553898.1|  ....................-----------------....-.....------------...-S
gi|294101613|ref|YP_003553471.1|  ....................-----------------....-.....-----------F...SP
gi|294101367|ref|YP_003553225.1|  ....................----EPLLKMENIGKAY....F.....GNRVLKDVSFTL...EK
gi|294101893|ref|YP_003553751.1|  ....................-----------------....-.....---AVRQLAGKE...AK
gi|294101841|ref|YP_003553699.1|  ....................-----------------....-.....------------...--
gi|294102070|ref|YP_003553928.1|  ....................-----------------....-.....------------...--
gi|294102221|ref|YP_003554079.1|  ....................-----------------....-.....------------...-K
gi|294101356|ref|YP_003553214.1|  ....................-------IQLVNITHFY....G.....EQGLYNSLNWSI...TH
gi|294101345|ref|YP_003553203.1|  ....................------LLATQDLSIGYgpkkG.....TTLVAGPIATSL...YE
gi|294102145|ref|YP_003554003.1|  ....................-----------------....-.....------------...--
gi|294101756|ref|YP_003553614.1|  ....................-----------------....-.....------------...--
gi|294102549|ref|YP_003554407.1|  ....................------FLEMTRLTVSGd...R.....GKDVVKNLTLTV...HR
gi|294101372|ref|YP_003553230.1|  ....................-----------------....-.....--------GFLL...RE
gi|294101016|ref|YP_003552874.1|  ....................-----------------....-.....------------...--
gi|294101780|ref|YP_003553638.1|  ....................-----------------....-.....------------...--
gi|294101686|ref|YP_003553544.1|  ....................-----------------....-.....------------...-S
gi|294102507|ref|YP_003554365.1|  ....................-----------------....-.....------------...--
gi|294101471|ref|YP_003553329.1|  ....................-----------------....S.....QIVLFSHLSVSF...KK
gi|294101845|ref|YP_003553703.1|  ....................-----------------....-.....------------...-K
gi|294101553|ref|YP_003553411.1|  ....................-----------------....-.....------------...KP
gi|294101853|ref|YP_003553711.1|  ....................-----------------....-.....------------...--
gi|294101780|ref|YP_003553638.1|  ....................-----------------....-.....---NLKEIDVAI...PS
gi|294102079|ref|YP_003553937.1|  ....................-----------------....-.....------------...-K
gi|294101472|ref|YP_003553330.1|  ....................-------LSVENLSILDe...E.....NKPLVRNVSFSI...PS
gi|294102235|ref|YP_003554093.1|  ....................-----------------....-.....------------...--
gi|294102390|ref|YP_003554248.1|  ....................-----------------....-.....------------...--
gi|294101443|ref|YP_003553301.1|  ....................-----------------....-.....------------...--
gi|294101748|ref|YP_003553606.1|  ....................-----------------....-.....------------...--
gi|294101649|ref|YP_003553507.1|  ....................-----------------....-.....------------...--
gi|294101715|ref|YP_003553573.1|  ....................-----------------....-.....------------...--
gi|294101925|ref|YP_003553783.1|  ....................-----------------....-.....------------...--
gi|294101367|ref|YP_003553225.1|  ....................------ILKVEHLWVDM....P.....GE-TVRDVSFTV...KE
gi|294101751|ref|YP_003553609.1|  ....................-----------------....-.....------------...RA
gi|294101046|ref|YP_003552904.1|  ....................-----------------....-.....------------...--
gi|294101779|ref|YP_003553637.1|  ....................-----------------....-.....------------...--
gi|294101226|ref|YP_003553084.1|  ....................-----------------....-.....------------...--
gi|294101892|ref|YP_003553750.1|  ....................-----------------....-.....------------...--
gi|294102315|ref|YP_003554173.1|  ....................-----------------....-.....------------...--
gi|294102188|ref|YP_003554046.1|  ....................-----------------....-.....------------...--
gi|294102320|ref|YP_003554178.1|  nmgrfmkillvkrlessffa-----------------....-.....------------...--
gi|294102169|ref|YP_003554027.1|  ....................-----------------....-.....------------...--
gi|294101254|ref|YP_003553112.1|  ....................-----------------....R.....GIPVVKDLSIDV...RE
gi|294102077|ref|YP_003553935.1|  ....................-----------------....-.....------------...--
gi|294102510|ref|YP_003554368.1|  ....................-----------------....-.....------------...--
gi|294101748|ref|YP_003553606.1|  ....................-----------------....-.....------------...--
gi|294101141|ref|YP_003552999.1|  ....................-----------------....-.....------------...--
gi|294101018|ref|YP_003552876.1|  ....................-----------------....-.....------------...--
gi|294101692|ref|YP_003553550.1|  ....................-----------------....-.....------------...--
gi|294101032|ref|YP_003552890.1|  ....................-----------------....-.....------------...--
gi|294101031|ref|YP_003552889.1|  ....................-----------------....-.....------------...--
gi|294101431|ref|YP_003553289.1|  ....................-----------------....-.....------------...-K
gi|294102167|ref|YP_003554025.1|  ....................-----------------....-.....------------...--
gi|294101458|ref|YP_003553316.1|  ....................-----------------....-.....------------...--
gi|294102320|ref|YP_003554178.1|  ....................----------------Y....G.....------------...--
gi|294101940|ref|YP_003553798.1|  ....................-----------------....-.....----------GV...YP
gi|294102120|ref|YP_003553978.1|  ....................-----------------....-.....-----------V...ED
gi|294101791|ref|YP_003553649.1|  ....................-----------------....-.....----------HV...YS
gi|294102136|ref|YP_003553994.1|  ....................-----------------....-.....----MEDLSLVF...SQ
gi|294101830|ref|YP_003553688.1|  ....................-----------------....-.....------------...--
gi|294102042|ref|YP_003553900.1|  ....................-----------------....-.....------------...--
gi|294102015|ref|YP_003553873.1|  ....................-----------------....-.....------------...--
gi|294102787|ref|YP_003554645.1|  ....................-----------------....-.....SFGLLENMEGHF...PA
gi|294102032|ref|YP_003553890.1|  ....................--------------KFI....G.....QERAVQAISFGLsveSK
gi|294102010|ref|YP_003553868.1|  ....................-----------------....-.....------------...-W
gi|294101586|ref|YP_003553444.1|  ....................-----------------....-.....------------...--
gi|294101458|ref|YP_003553316.1|  ....................----------KNTRVVF....G.....DYIDIYDMTRAV...ED
gi|294102625|ref|YP_003554483.1|  ....................-----------------....-.....------------...--
gi|294102478|ref|YP_003554336.1|  ....................-----------------....-.....------------...--
gi|294101874|ref|YP_003553732.1|  ....................-----------------....-.....------------...--
gi|294102071|ref|YP_003553929.1|  ....................-----------------....-.....------------...RS


                                          40         50              60         70          80      
                                           |          |               |          |           |      
d1htwa_                             AIMVYLNGDLGAGKT.TLT.RGMLQGIG.....HQG.NVKSPTYTLVEEYNI..AGKMIYHFDL
gi|294102520|ref|YP_003554378.1|  --------PAGEGKT.TTT.VGLAQGLA.....KLG.---------------..KKV-------
gi|294102529|ref|YP_003554387.1|  ---------AGEGKT.TTT.VGLGQGLA.....KLG.---------------..----------
gi|294102437|ref|YP_003554295.1|  ---------------.---.--------.....---.---------------..----------
gi|294102168|ref|YP_003554026.1|  ---------------.---.--------.....---.---------------..----------
gi|294101779|ref|YP_003553637.1|  ---QTLLGVTGSGKTfTVA.NVLAQFDR.....PV-.LVLAHNKTLAA----..----------
gi|294102457|ref|YP_003554315.1|  ---------------.---.--------.....---.---------------..----------
gi|294101625|ref|YP_003553483.1|  --------HIDAGKT.TTT.ERILFYTG.....RNY.---------------..----------
gi|294101185|ref|YP_003553043.1|  ----VLIGDPGVGKT.AIV.EGLAQRI-.....---.---------------..----------
gi|294102626|ref|YP_003554484.1|  ---------------.---.--LATELD.....PES.---------------..GTIAPPQESL
gi|294101765|ref|YP_003553623.1|  EGLILVTGPTGSGKS.TTL.HALIKQVN.....ALT.-LNVTTIED------..----------
gi|294102479|ref|YP_003554337.1|  GERVAVVGETGGGKS.TLM.DLIPRFYD.....PSR.---------------..GKVSVDGCDV
gi|294101904|ref|YP_003553762.1|  GELITFLGPSGCGKT.TIL.RMIAGFEK.....PTE.---------------..GQVLIGGRDI
gi|294102557|ref|YP_003554415.1|  GELITLLGPSGCGKT.TLL.RMIAGFED.....PTE.---------------..GDVFFGDRRV
gi|294101807|ref|YP_003553665.1|  ---------------.---.--------.....---.---------------..----------
gi|294101806|ref|YP_003553664.1|  GGTACVPGPFGSGKT.VIQ.HQLAKWAE.....SD-.---------------..----------
gi|294102649|ref|YP_003554507.1|  GEIFGIIGLSGAGKS.TLL.RTLNRLEE.....PSS.---------------..GSICIGDTDI
gi|294101185|ref|YP_003553043.1|  ---FIFLGPTGVGKT.ELA.KTLAEALF.....DSE.---------------..DNMIRIDMSE
gi|294102868|ref|YP_003554726.1|  GELVSLLGPSGCGKT.TTL.RMIGGFLQ.....PDE.---------------..GSIILEGEDI
gi|294102500|ref|YP_003554358.1|  PKNILMVGPTGVGKT.EIA.RRLADLVL.....AP-.FVKVEATKFTEVGYV..----------
gi|294102409|ref|YP_003554267.1|  ---------------.---.--------.....---.---------------..G---------
gi|294102354|ref|YP_003554212.1|  ---VAIAAHGGAGKT.SLV.EAILF---.....-SN.---------------..GDINRMGNVV
gi|294101565|ref|YP_003553423.1|  ---FLFLGPTGVGKT.ELA.RRLADFLF.....GSE.---------------..DAMIRLDM--
gi|294101424|ref|YP_003553282.1|  GEVVSVIGPSGSGKS.TLA.RCICRLED.....IND.---------------..GEIYLYGQRV
gi|294101976|ref|YP_003553834.1|  ---------------.---.--------.....---.---------------..----------
gi|294101061|ref|YP_003552919.1|  GETKVFIGPSGTGKS.TLL.RCINQLTI.....PDS.---------------..GQIWLHGEEV
gi|294101048|ref|YP_003552906.1|  GEVFVIMGLSGSGKS.TLI.RCVIRLIE.....PTS.---------------..GEIWVNGQEV
gi|294101977|ref|YP_003553835.1|  --AAVLPGGFGTGKT.VTQ.QSLAKWCN.....AEI.-II------------..----------
gi|294101084|ref|YP_003552942.1|  GDLVSIIGPSGCGKS.TFL.RCLNCLEY.....IDS.---------------..GTITIAGVTV
gi|294101565|ref|YP_003553423.1|  ----VLLGDPGVGKT.AIV.EGLAQKIQ.....DGN.---------------..----------
gi|294101786|ref|YP_003553644.1|  GETLGVVGESGCGKS.TLG.RAVLRLCE.....PTS.---------------..GTVFFDGEDV
gi|294101493|ref|YP_003553351.1|  GEFLSIMGASGSGKS.TLM.NIIGCLDT.....PTE.---------------..GHYYLDGTDV
gi|294101884|ref|YP_003553742.1|  ALVIGITGSPGAGKS.TLV.DKLILEFR.....KKK.---------------..----------
gi|294101894|ref|YP_003553752.1|  -SNVLLIGPTGSGKT.LLA.QSLAKKLN.....VP-.FAMADATTLTEAGYV..GE--------
gi|294101778|ref|YP_003553636.1|  --GVLLLGPPGTGKT.LLA.RAAAGEAD.....VP-.FFSVSGSDFVEMFV-..GVGAARVRDL
gi|294102313|ref|YP_003554171.1|  GEFCGLIGPSGSGKT.TLL.NIIGALDA.....PSE.---------------..GSVVVIDRNV
gi|294102640|ref|YP_003554498.1|  GQTLGLVGESGCGKS.TLG.RVVIGLIE.....ATG.---------------..GEVLFKGQDA
gi|294101376|ref|YP_003553234.1|  PKGVLLYGPPGTGKT.VIA.RAVANETD.....VY-.FTHISGPEIIGKFY-..GESEERLRNV
gi|294102641|ref|YP_003554499.1|  GKALGFVGETGAGKT.TTA.LAVLQLIQsppgeITN.---------------..GEIFFDGQDV
gi|294101359|ref|YP_003553217.1|  ---------------.---.--------.....---.---------------..----------
gi|294102459|ref|YP_003554317.1|  GQRALLVSPPKAGKT.TVL.KKIANAVT.....VNH.---------------..PDIILM----
gi|294101785|ref|YP_003553643.1|  GVTLGIVGETGAGKT.TLA.KSIMRIIP.....TPPgHIES-----------..GTILYKNKDI
gi|294101376|ref|YP_003553234.1|  PQGILLHGPSGTGKT.LLV.RALAHESG.....VN-.FIPVKGPALMSKYV-..GESERAIREV
gi|294102074|ref|YP_003553932.1|  ---FVISGPSGAGKG.TVR.KALFEQMP.....DLV.YSISCTTRQPRDGER..-----DGVDY
gi|294102442|ref|YP_003554300.1|  GEFVYLVGTTGSGKT.TLM.RLITRELI.....QTR.---------------..GQVTVGDQNL
gi|294101577|ref|YP_003553435.1|  GEIVGLLGPNGAGKT.TTF.YMIVGLIK.....PDS.---------------..GRVMIDSKDI
gi|294101171|ref|YP_003553029.1|  KEIVGLIGPNGAGKT.TIF.NVVTGVYD.....PDG.---------------..GRILFDGEDI
gi|294102413|ref|YP_003554271.1|  GSIVGLIGPNGAGKT.TVF.NMITGFYK.....PTE.---------------..GNIFFNEDNI
gi|294102187|ref|YP_003554045.1|  RYNIIVTGGTGSGKT.TTL.NVLSSFIP.....NRE.---------------..RIVTIE----
gi|294102332|ref|YP_003554190.1|  GEVVGLIGPSGSGKS.TLL.KCLGAVIE.....PTA.---------------..GQMMLGDDVI
gi|294102831|ref|YP_003554689.1|  ----------GVGKT.TTC.VNLSAELG.....RLG.---------------..YS--------
gi|294101321|ref|YP_003553179.1|  ------IGHIDHGKT.TLT.AAITKCLS.....TK-.---------------..GWSNFEAYDM
gi|294101626|ref|YP_003553484.1|  ------IGHIDHGKT.TLT.AAITKCLS.....TK-.---------------..GWSNFEAYDM
gi|294101069|ref|YP_003552927.1|  QEMVMILGPNGSGKT.TLL.RCLNGINR.....PQK.---------------..GTITLEDKNM
gi|294102759|ref|YP_003554617.1|  GRITGLVGESGSGKS.SLL.MAIPGLLP.....SNT.EVS------------..GAVIFDNLNL
gi|294101055|ref|YP_003552913.1|  HQITAIIGPSGCGKS.TFL.KSLNRLVE.....DER.GVTLS----------..GQIRLDGEDT
gi|294101254|ref|YP_003553112.1|  GEVHALLGENGAGKS.TLM.NILYGLYN.....PDR.---------------..GHILIDGKKV
gi|294102760|ref|YP_003554618.1|  GESLALIGESGSGKT.SLL.RVLLGLIS.....PTE.---------------..GNVELFGENI
gi|294101659|ref|YP_003553517.1|  GEWLALLGSNGSGKS.TLA.KHLNALLL.....PSQ.---------------..GACFVYGMDT
gi|294101172|ref|YP_003553030.1|  GEIVCVIGANGAGKS.TLM.NALMSEVR.....REK.---------------..GLINFSGAPL
gi|294102017|ref|YP_003553875.1|  ERIALITGPNMAGKS.TYL.RMAALLV-.....---.---------------..----------
gi|294101748|ref|YP_003553606.1|  ----LLVGDVGFGKT.EIA.M-------.....---.---------------..----------
gi|294102409|ref|YP_003554267.1|  ---------------.---.--------.....---.---------------..----------
gi|294102070|ref|YP_003553928.1|  --RVSIVGRPNVGKS.SLV.NALAGSDR.....VL-.---------------..----------
gi|294102390|ref|YP_003554248.1|  PMHRLLQGDVGSGKT.AV-.--------.....---.---------------..----------
gi|294101403|ref|YP_003553261.1|  GRIVEIFGPEGSGKT.TVA.--------.....---.---------------..----------
gi|294101730|ref|YP_003553588.1|  ---YLFSGPRGCGKT.TLA.RLLAKSLN.....CTG.---------------..----------
gi|294102602|ref|YP_003554460.1|  -----------HGKT.TLI.DSIFKAAQ.....IFR.---------------..----------
gi|294102663|ref|YP_003554521.1|  KTVTALIGPSGCGKS.SFI.RCLNRMND.....FIP.NVKVE----------..GDIYLEGKNI
gi|294101436|ref|YP_003553294.1|  ----GIVGLPLCGKS.TVF.NVITRA--.....---.---------------..----------
gi|294102150|ref|YP_003554008.1|  -----------HGKS.TLA.DRLIEYTG.....TVE.---------------..----------
gi|294101607|ref|YP_003553465.1|  ---VVTSGKGGVGKT.TTT.ANVSFALA.....KAG.---------------..YKVVAIDADI
gi|294102035|ref|YP_003553893.1|  ----------GKGKT.TAA.LGL-----.....---.---------------..----------
gi|294102412|ref|YP_003554270.1|  GKIVTLIGANGAGKS.STI.RSIAGLVR.....SAK.---------------..GKILYTSNEG
gi|294101660|ref|YP_003553518.1|  GQWLSIVGHTGSGKS.TLA.QHLNALIV.....PEK.---------------..GEVIVEGFVS
gi|294102549|ref|YP_003554407.1|  GTVHSLVGENGAGKS.TVV.KCVYGLYS.....PTA.---------------..GKFKIDNKIL
gi|294102841|ref|YP_003554699.1|  GEFLVIIGPNGGGKT.TLL.RLILGLEK.....PAR.---------------..GKIEVLGTTP
gi|294101272|ref|YP_003553130.1|  GSFSVLIGPSGCGKS.TLF.DLLTGTIE.....REY.---------------..GTMEWIGEAV
gi|294101433|ref|YP_003553291.1|  ------SGKGGVGKS.SIS.CLLAVALA.....KKG.---------------..FSVGILDADI
gi|294101963|ref|YP_003553821.1|  PPIVTVMGHVDHGKT.TLL.DYIRQTNI.....TAR.----EAGGITQHIGA..STVTYEGKNI
gi|294101356|ref|YP_003553214.1|  GEKIALVGVNGAGKS.TLS.RLISQSEV.....PTE.---------------..GNISYG----
gi|294102542|ref|YP_003554400.1|  GEILGLLGANGSGKS.TLL.RILAFLET.....PTE.---------------..GTVYFKKERV
gi|294101861|ref|YP_003553719.1|  -DHILFYGPPGLGKT.TLA.GIIAHEMG.....GQ-.LRVTTGPAL------..----------
gi|294102400|ref|YP_003554258.1|  GSLNIIAARPSMGKT.ALA.LNIAQYGG.....VER.---------------..----------
gi|294102043|ref|YP_003553901.1|  --FITLEGIDGCGKS.TQA.AFLKEQLQ.....QKK.---------------..KEPVLW----
gi|294101077|ref|YP_003552935.1|  KEKIYIRGENGAGKT.TLF.SLIMGLLR.....PQK.---------------..GDIIVKGKVI
gi|294102348|ref|YP_003554206.1|  GEVTGVLGRNGAGKS.SLA.YALMGLPD.....YI-.PVK------------..GSISFLGEDI
gi|294102040|ref|YP_003553898.1|  PKVIVLVGVNGSGKT.TTA.AKLAEQFH.....RQG.---------------..KKVILGAADT
gi|294101613|ref|YP_003553471.1|  G-FTAIVGPNGSGKS.NIL.DGLRWVLG.....EGS.---------------..----------
gi|294101367|ref|YP_003553225.1|  GQILGLVGENGAGKS.TLM.NILFGMPV.....IQE.---------TGGYE-..GKFFINGQEA
gi|294101893|ref|YP_003553751.1|  GQVLCFVGPPGVGKT.SLA.QSIARALG.....RRF.VNFSLGGV------R..DEAEIRGHRR
gi|294101841|ref|YP_003553699.1|  ---VGLVGLPNAGKS.SLL.AAISNARP.....KIA.---------------..----------
gi|294102070|ref|YP_003553928.1|  ---IAIVGRPNVGKS.SLF.NRILGRRE.....AI-.VDDMPGVTRDRIY--..GETEWKGRQF
gi|294102221|ref|YP_003554079.1|  RQFVFFGGKGGTGKT.TCA.AAYAYALS.....RL-.---------------..----------
gi|294101356|ref|YP_003553214.1|  GSKTGLIGSNGTGKT.TLF.KIIMGLVE.....PRE.---------------..GNVYFP----
gi|294101345|ref|YP_003553203.1|  GELVCLIGPNGVGKT.TLL.KTLAGTQN.....PLG.---------------..GEIRVLESSL
gi|294102145|ref|YP_003554003.1|  -----------HGKT.TLV.KALTGVS-.....---.---------------..----------
gi|294101756|ref|YP_003553614.1|  -----IVGRPNVGKS.SLL.NNILA---.....---.---------------..----------
gi|294102549|ref|YP_003554407.1|  GEIVGIAGITGNGQS.ELE.EAISGLRF.....VKE.---------------..GQLLMGKRDI
gi|294101372|ref|YP_003553230.1|  GIRVALVGRPNVGKS.SLL.NALLKESR.....AIV.---------------..----------
gi|294101016|ref|YP_003552874.1|  ---LFIWGGVGLGKT.HLM.HAIGHYVL.....NKN.NSLKVTYVSSEKFINefIQSIKNNRTQ
gi|294101780|ref|YP_003553638.1|  ----VITGPSGSGKS.SLA.--------.....---.---------------..----------
gi|294101686|ref|YP_003553544.1|  GGVVLLGGQPGIGKS.TLL.LQVCGAMA.....ARG.---------------..ERVLYISGEE
gi|294102507|ref|YP_003554365.1|  -HNLLFIGSPGSGKT.MLA.RAIRGIVP.....PLS.---------------..HEELLESLQI
gi|294101471|ref|YP_003553329.1|  GEVVGLVGPSGKGKT.TLG.DILLGLIV.....PDR.---------------..GKVLWKGQDI
gi|294101845|ref|YP_003553703.1|  GRFIAITGESGAGKS.SIV.RALE----.....---.---------------..----------
gi|294101553|ref|YP_003553411.1|  PTLCMMVGLQGSGKT.TSA.VKIAKRIQ.....NAH.---------------..-NPLVVACDL
gi|294101853|ref|YP_003553711.1|  ---LLVAGTTGSGKS.VFV.NSCIAGLC.....YC-.---------------..----------
gi|294101780|ref|YP_003553638.1|  RVFSCISGVSGSGKS.SLL.Y-------.....---.---------------..----------
gi|294102079|ref|YP_003553937.1|  NLVVAIDGPAGAGKS.SVA.KKVAELLG.....LDY.L--------------..----------
gi|294101472|ref|YP_003553330.1|  ESVFFLVGETGSGKT.PIA.QAIAGTLA.....KRL.-SVC-----------..GKVFLKKQNL
gi|294102235|ref|YP_003554093.1|  ---LALAGNPNTGKT.SLF.NLLTGSRQ.....HVG.NWPGVTVERKE----..GHFSYEGMNF
gi|294102390|ref|YP_003554248.1|  ---------------.---.--------.....-S-.---------------..----------
gi|294101443|ref|YP_003553301.1|  ----VLYGPPGVGKT.TLV.RLMAMVTE.....---.---------------..----------
gi|294101748|ref|YP_003553606.1|  ---------------.---.-----ELN.....RG-.---------------..GQVFFVSNRI
gi|294101649|ref|YP_003553507.1|  --RVILLGPPGAGKG.TQA.AEIKTKYK.....VAH.---------------..----------
gi|294101715|ref|YP_003553573.1|  --VLVVTGPNTGGKT.VAL.KTV-----.....---.---------------..----------
gi|294101925|ref|YP_003553783.1|  ---CAILGSTGSGKS.NTT.VSILRAIL.....NDY.---------------..DGSRVILIDP
gi|294101367|ref|YP_003553225.1|  GEIFGIGGLAGQGKL.GIA.NGIMGMYP.....SG-.---------------..GTVTFDETPI
gi|294101751|ref|YP_003553609.1|  HDIVFAIGPAGTGKT.YLA.--------.....---.---------------..----------
gi|294101046|ref|YP_003552904.1|  ----VLSAPTGAGKT.LVA.YLWAGLLT.....TEG.---------------..----------
gi|294101779|ref|YP_003553637.1|  -----LLGVTGSGKTfTVA.NVLAQFDR.....PV-.LVLAHNKTLA-----..----------
gi|294101226|ref|YP_003553084.1|  ----LLIGNPNVGKS.VIF.SRLTGVRA.....ISS.NYPGTTVGFLE----..GWLRYNSEVY
gi|294101892|ref|YP_003553750.1|  ---VAFVGRSNVGKS.MLL.NALMERKL.....AHV.---------------..GSTPGKTRSV
gi|294102315|ref|YP_003554173.1|  ----MIIGMTGSGKT.GLG.IALLEEAL.....MD-.---------------..----------
gi|294102188|ref|YP_003554046.1|  ---------------.---.--------.....---.---------------..----------
gi|294102320|ref|YP_003554178.1|  ---------------.---.--------.....---.---------------..----------
gi|294102169|ref|YP_003554027.1|  --VINIIGSPGAGKT.TLL.EA------.....---.---------------..----------
gi|294101254|ref|YP_003553112.1|  REILGLAGIAGNGQQ.ELC.EALAGLRP.....LKE.---------------..GRIMIDDEEL
gi|294102077|ref|YP_003553935.1|  --TVALTGYTNSGKS.TLL.QQLSHGRN.....LYV.---------------..----------
gi|294102510|ref|YP_003554368.1|  ELRLAVVGIPNVGKS.LFL.NLLVGKKR.....APV.-GGVPGITR------..GVSWYKGQDI
gi|294101748|ref|YP_003553606.1|  ---------------.---.--------.....---.---T-----------..----------
gi|294101141|ref|YP_003552999.1|  ---TCLLAPCGSGKT.L--.--------.....---.---------------..----------
gi|294101018|ref|YP_003552876.1|  ----LLVGNNGSGKT.NAL.EAIHILSG.....WGP.FRSS-----------..----------
gi|294101692|ref|YP_003553550.1|  ---------------.---.--------.....---.---------------..----------
gi|294101032|ref|YP_003552890.1|  ------SGKGGTGKT.CIA.ASLALSL-.....---.---------------..----------
gi|294101031|ref|YP_003552889.1|  KEIVIISGKGGTGKT.CIM.AALCSSFS.....G--.---------------..-KAVF-----
gi|294101431|ref|YP_003553289.1|  TKVIVIAGPSGSGKT.TTA.KRLKIQLQ.....VCG.---------------..LNPTVISLDN
gi|294102167|ref|YP_003554025.1|  --VLGVTGDVGAGKS.TVS.Q-------.....---.---------------..----------
gi|294101458|ref|YP_003553316.1|  ---------------.---.--------.....---.---------------..----------
gi|294102320|ref|YP_003554178.1|  --GVFISDVVGLGKT.YIS.AMLAGQLD.....GRT.LVIAPPVLLE-----..----------
gi|294101940|ref|YP_003553798.1|  GEMLNLAGAQGSLKT.SLA.--------.....---.---------------..----------
gi|294102120|ref|YP_003553978.1|  GSSLILGGGTGVGKT.HLA.IAMIQELT.....AKG.---------------..----------
gi|294101791|ref|YP_003553649.1|  GLTILLYGDLGAGKT.VLV.KGLGDGLG.....AR-.GVRSPSFTLINEYE-..GRLPLAHVDL
gi|294102136|ref|YP_003553994.1|  G-INILSGTNGTCKT.SLL.HIVSNSFQ.....---.---------------..----------
gi|294101830|ref|YP_003553688.1|  --CLIITGMSGAGKS.TVL.NILED---.....---.---------------..----------
gi|294102042|ref|YP_003553900.1|  ---------------.---.---N----.....---.---------------..----------
gi|294102015|ref|YP_003553873.1|  --ILAIIGPTAVGKT.KLS.LEIAETLK.....AE-.VISVDSRQVYRYMNV..GTDK------
gi|294102787|ref|YP_003554645.1|  G-LSLILGDNESGKT.TLM.SFL-----.....---.---------------..----------
gi|294102032|ref|YP_003553890.1|  GYNIFVLGNPGSGRT.S--.--------.....---.---------------..----------
gi|294102010|ref|YP_003553868.1|  PKAVAVTGALGSGKT.EWVlNMALALLE.....AGE.KVTIADIDIINPYFC..----------
gi|294101586|ref|YP_003553444.1|  --IFAVSGMKNSGKT.KLC.LLLLKYLK.....EAG.IHV------------..GYIKHSHE--
gi|294101458|ref|YP_003553316.1|  GTTV-----------.---.--------.....---.---------------..----------
gi|294102625|ref|YP_003554483.1|  ---------------.---.--------.....---.---------------..----------
gi|294102478|ref|YP_003554336.1|  ---------------.---.--------.....---.---------------..--V-------
gi|294101874|ref|YP_003553732.1|  --VIAFVGPAGTGKS.QRA.QYVATDNN.....VDY.IID-D----------..GLVIARG---
gi|294102071|ref|YP_003553929.1|  GEHKIIIGGPGA---.---.--------.....---.---------------..----------


                                      90       100       110       120            130       140     
                                       |         |         |         |              |         |     
d1htwa_                             YRLADPEELEFMGIRDYFNTDSICLIEWSEKGQGILPEA.....DILVNIDYYDDARNIELIAQ
gi|294102520|ref|YP_003554378.1|  ---------------------------------------.....--------------------
gi|294102529|ref|YP_003554387.1|  ---------------------------------------.....--------------------
gi|294102437|ref|YP_003554295.1|  --------------------------------------Y.....--------------------
gi|294102168|ref|YP_003554026.1|  --E------------------------------------.....--------------------
gi|294101779|ref|YP_003553637.1|  ---------------------------------------.....--------------------
gi|294102457|ref|YP_003554315.1|  -------------------------------A-------.....--------------------
gi|294101625|ref|YP_003553483.1|  ---------------------------------------.....--------------------
gi|294101185|ref|YP_003553043.1|  ---------------------------------------.....--------------------
gi|294102626|ref|YP_003554484.1|  FWKEAEEALDRWDGNWFAKSSSHL---WAQRIAKLFSDP.....LFMDS---------------
gi|294101765|ref|YP_003553623.1|  ---------------------------------------.....--------------------
gi|294102479|ref|YP_003554337.1|  RTLDLTE--------------------LRKQIGIVPQDP.....VLMKG-SLAFNISYGFPQAT
gi|294101904|ref|YP_003553762.1|  THLAVN----------------------KRDIGFVFQNY.....ALFPHMSIFDNVAYGLKVRG
gi|294102557|ref|YP_003554415.1|  NDVAPN----------------------HRNATMVFQSY.....AIFPHLNVYENIAFGLRLKK
gi|294101807|ref|YP_003553665.1|  -------------------I-------------------.....--------------------
gi|294101806|ref|YP_003553664.1|  ---------------------------------------.....--------------------
gi|294102649|ref|YP_003554507.1|  TRLSTPELRK-----------------LRRRVGMIFQHF.....NLLTSRTVFQNVAFPLEIEK
gi|294101185|ref|YP_003553043.1|  ---------------------------------------.....--------------------
gi|294102868|ref|YP_003554726.1|  THLPPE----------------------KRPTATVFQSY.....ALFPHMTVLQNVIYGLKFKK
gi|294102500|ref|YP_003554358.1|  ---------------------------------------.....--------------------
gi|294102409|ref|YP_003554267.1|  ---------------------------------------.....--------------------
gi|294102354|ref|YP_003554212.1|  DGNTVADF-------------------------------.....--------------------
gi|294101565|ref|YP_003553423.1|  ---------------------------------------.....--------------------
gi|294101424|ref|YP_003553282.1|  DNGKHSN------------------KEVATLVGMIFQQF.....NLFPHLSVLDNITLCPIQAK
gi|294101976|ref|YP_003553834.1|  ---------------------------------------.....----R---------------
gi|294101061|ref|YP_003552919.1|  THSKKS------------------INVLRQKMGMVFQNF.....YLFDHLTALRNVEIALLKVK
gi|294101048|ref|YP_003552906.1|  SSLPKKDLTEF----------------RRKQIAMVFQHY.....GLLPHKTIIDNVEFGLKLQG
gi|294101977|ref|YP_003553835.1|  ---------------------------------------.....--------------------
gi|294101084|ref|YP_003552942.1|  SRTGKEKELDKSFLEACHH--------MRQEVGMVFQSF.....NLFPHRTVLENVMLAPMVVK
gi|294101565|ref|YP_003553423.1|  ---------------------------------------.....--------------------
gi|294101786|ref|YP_003553644.1|  LKFNKAKMKK-----------------MRSQMQIIFQDPya...SLNPRMTVSQSIAAPLIIQG
gi|294101493|ref|YP_003553351.1|  STIDENQLADI----------------RKNTIGFVFQGF.....NLLPRMTALENVELPMLYSG
gi|294101884|ref|YP_003553742.1|  ---------------------------------------.....--------------------
gi|294101894|ref|YP_003553752.1|  ---------------------------------------.....--------------------
gi|294101778|ref|YP_003553636.1|  FEQARKYQPCIIFIDEMDAVGRHRGAGLGGGHDEREQTLn....QLLVELDGFDESTGIILIAA
gi|294102313|ref|YP_003554171.1|  ENLSHKESAQL----------------RNHHIGFIFQTY.....NLFPVYNVYENIEFPLLLLK
gi|294102640|ref|YP_003554498.1|  LKFNNAQKRE-----------------FHKQAQIVFQDPfs...SLNPRMSVSQLIAEPLLINK
gi|294101376|ref|YP_003553234.1|  FDEAQAHAPAIIFIDEIDAIAPKREE-----MGGEKQVErrvvaQLLALMDGLESRGQVIVIGA
gi|294102641|ref|YP_003554499.1|  MKMTEAEKRDI----------------RGSKIAMIFQDPmt...SLNPIMTVEEQIMEMISLHS
gi|294101359|ref|YP_003553217.1|  -------------------------------H-------.....--------------------
gi|294102459|ref|YP_003554317.1|  ---------------------------------------.....--------------------
gi|294101785|ref|YP_003553643.1|  LGMTSSEIRKV----------------RGEQVSMIFQDPmt...SLNPIMIVGDQIAEAIKTHM
gi|294101376|ref|YP_003553234.1|  FKKAKQASPSILYFDEIESLVPIRG--RDSGAGASFTERvis..QFLAEMSGIEELKGVTVLAT
gi|294102074|ref|YP_003553932.1|  RFLSEEEFKKLVEEKKFLE--------W----AVVHEHL.....YGTLK---------------
gi|294102442|ref|YP_003554300.1|  RKLRASQLPY-----------------YRRYLGVVFQDF.....KLLPHLTAWENVAFVLESMG
gi|294101577|ref|YP_003553435.1|  TPFPMFRR-------------------ARIGVGYLPQEA.....SIFRNLTVKENIEIVLQELG
gi|294101171|ref|YP_003553029.1|  TPLKTYEV-------------------IRKGIARTFQNL.....RLFPRSSVLENVMTAAQQHE
gi|294102413|ref|YP_003554271.1|  TGFPPNKV-------------------CESGIARTFQNI.....RLFSNETVLQNVMIGCHVRQ
gi|294102187|ref|YP_003554045.1|  ---------------------------------------.....--------------------
gi|294102332|ref|YP_003554190.1|  YHDGWKV--------------KDLRALRRDHIGFVFQAP.....YLIPFLDVTDNVALLPMLAG
gi|294102831|ref|YP_003554689.1|  ---------------------------------------.....--------------------
gi|294101321|ref|YP_003553179.1|  IDKAPEER-------------------------------.....--------------------
gi|294101626|ref|YP_003553484.1|  IDKAPEER-------------------------------.....--------------------
gi|294101069|ref|YP_003552927.1|  RRMSGRE--------------------IARRIGYVPQSS.....EKVRL-TAFDAILLGRRPYV
gi|294102759|ref|YP_003554617.1|  ISLRPEMLNAI----------------RWKDIALIPQGAmn...SFTPVLTIGKHIEEVLAIHL
gi|294101055|ref|YP_003552913.1|  FTLSPEE--------------------VRRRIGMVFQSP.....TPFPF-SIYDNMAYPLRYYG
gi|294101254|ref|YP_003553112.1|  SFSSPKDA-------------------IAAGIGMVHQHF.....MLIPSQTVWENMILGLEGLP
gi|294102760|ref|YP_003554618.1|  DKCSHSQL-----------------IELRRRCGYVPQDPyg...SLPPTLTVLDAVAEPWIIVN
gi|294101659|ref|YP_003553517.1|  REEKNLWA-------------------IRSHVAMVFQNPd....NQIVGTVVEDDTAFGPENIG
gi|294101172|ref|YP_003553030.1|  AQRSYDV--------------------VKQGISLVPEGR.....RVFAPLTVYENLMMGAFPRK
gi|294102017|ref|YP_003553875.1|  ---------------------------------------.....--------------------
gi|294101748|ref|YP_003553606.1|  ---------------------------------------.....--------------------
gi|294102409|ref|YP_003554267.1|  -------------V-------------------------.....--------------------
gi|294102070|ref|YP_003553928.1|  ---------------------------------------.....--------------------
gi|294102390|ref|YP_003554248.1|  ---------------------------------------.....--------------------
gi|294101403|ref|YP_003553261.1|  ---------------------------------------.....--------------------
gi|294101730|ref|YP_003553588.1|  ---------------------------------------.....--------------------
gi|294102602|ref|YP_003554460.1|  ---------------------------------------.....--------------------
gi|294102663|ref|YP_003554521.1|  YSGATD------------------VIALRRQVGMVFQKP.....NPFPM-AIYDNVAYGPRLQG
gi|294101436|ref|YP_003553294.1|  ---------------------------------------.....--------------------
gi|294102150|ref|YP_003554008.1|  ---------------------------------------.....--------------------
gi|294101607|ref|YP_003553465.1|  GL-------------------------------------.....--------------------
gi|294102035|ref|YP_003553893.1|  ---------------------------------------.....--------------------
gi|294102412|ref|YP_003554270.1|  VEENILG--------------KTPEFIVKKGIAMSPEGR.....RILPHLTVEENLLLGAYIRD
gi|294101660|ref|YP_003553518.1|  RPKSQD------------------LRKIRRLVGLVFQYPe....QQLFAETVFDEVAFAPRNWG
gi|294102549|ref|YP_003554407.1|  TIKTPRDA-------------------MKYGIGMVHQHF.....MLVPSLPVYKNVVLGDEPTT
gi|294102841|ref|YP_003554699.1|  DR-------------------------AVTSVGYVPQEGvr...DKIFPVSVFDVVLMGRLGIG
gi|294101272|ref|YP_003553130.1|  PH-------------------------LGQIAAYMQQKD.....LLLPWLSLMQNAMLPQVFSK
gi|294101433|ref|YP_003553291.1|  TGPSVPK--------------------------------.....--------------------
gi|294101963|ref|YP_003553821.1|  VFLDTPGHEAFTAMR------------------------.....--------------------
gi|294101356|ref|YP_003553214.1|  ---------------------------YNVKMGFFSQESaq...NLNYNRTIWEEISNTGYLG-
gi|294102542|ref|YP_003554400.1|  ETVSVN---------------------YRRSVTLLLQNT.....YLLKR-AVWENVAFGLKVRG
gi|294101861|ref|YP_003553719.1|  ---------------------------------------.....--------------------
gi|294102400|ref|YP_003554258.1|  ---------------------------------------.....--------------------
gi|294102043|ref|YP_003553901.1|  ---------------------------TREPGGWVHGDFvr...TLLLEKDLRHEL--------
gi|294101077|ref|YP_003552935.1|  KNQKDLRY-------------------LRQTIGFLFQDPd....DQLFCPTLLDDVLFGPLNGG
gi|294102348|ref|YP_003554206.1|  TSWSITDR-------------------AKAGLTLAWQMP.....ARYEGISIRDYLRIGPQNSS
gi|294102040|ref|YP_003553898.1|  FRAAAIDQLKI----------------WGER--------.....--------------------
gi|294101613|ref|YP_003553471.1|  ---------------------------------------.....--------------------
gi|294101367|ref|YP_003553225.1|  QFKSPFDA-------------------LDAGIGMVHQEF.....SLIPGFTAAENIVLNRESTQ
gi|294101893|ref|YP_003553751.1|  TYVGAQPGRIIQKMRQAGTKNPIMLMDEIDKIGQDFRGDpas..ALLEVLDPAQ----------
gi|294101841|ref|YP_003553699.1|  ---------------------------------------.....--------------------
gi|294102070|ref|YP_003553928.1|  YIVDTG---------------------------------.....--------------------
gi|294102221|ref|YP_003554079.1|  ---------------------------------------.....--------------------
gi|294101356|ref|YP_003553214.1|  ---------------------------KGIRIGYLSQDL.....V-------------------
gi|294101345|ref|YP_003553203.1|  AELSHKK--------------------RAQLLSFVISGR.....PAIQGFSVFELVALGRHPYT
gi|294102145|ref|YP_003554003.1|  ---------------------------------------.....--------------------
gi|294101756|ref|YP_003553614.1|  ---------------------------------------.....--------------------
gi|294102549|ref|YP_003554407.1|  THLPPLKR-------------------RKLGLAYIPEDRikt..GLAPLASLKDNALLGYQYKP
gi|294101372|ref|YP_003553230.1|  ---------------------------------------.....--------------------
gi|294101016|ref|YP_003552874.1|  EFKSKYRSVDILLIDDIQ---------------------.....--------------------
gi|294101780|ref|YP_003553638.1|  ---------------------------------------.....--------------------
gi|294101686|ref|YP_003553544.1|  SASQVAL--------------------RARRLLALHNNL.....DLFCD---------------
gi|294102507|ref|YP_003554365.1|  HSSARP---------------------------------.....--------------------
gi|294101471|ref|YP_003553329.1|  RTLSKTKK---------------------KNLRPYFQKI.....HQDPGSSFPQN---------
gi|294101845|ref|YP_003553703.1|  ---------------------------------------.....--------------------
gi|294101553|ref|YP_003553411.1|  RRP------------------------------------.....--------------------
gi|294101853|ref|YP_003553711.1|  ---------------------------------------.....--------------------
gi|294101780|ref|YP_003553638.1|  ---------------------------------------.....--------------------
gi|294102079|ref|YP_003553937.1|  ---------------------------------------.....--------------------
gi|294101472|ref|YP_003553330.1|  LSVKEKELKKL----------------WGRYLFLMPQEPst...ALNPLLSVFRQVREVFQHLR
gi|294102235|ref|YP_003554093.1|  TLVDLP---------------------------------.....--------------------
gi|294102390|ref|YP_003554248.1|  ---------------------------------------.....--------------------
gi|294101443|ref|YP_003553301.1|  ---------------------------------------.....--------------------
gi|294101748|ref|YP_003553606.1|  NRLKGKYEELKIMFP------------------------.....--------------------
gi|294101649|ref|YP_003553507.1|  ---------------------------------------.....--------------------
gi|294101715|ref|YP_003553573.1|  ---------------------------------------.....--------------------
gi|294101925|ref|YP_003553783.1|  HGEYASAFPS-----------------------------.....--------------------
gi|294101367|ref|YP_003553225.1|  ILNDPRSP-------------------LSVGIASVSEDRrgv..GLLLEEPISWNVIFTALQMQ
gi|294101751|ref|YP_003553609.1|  ---------------------------------------.....--------------------
gi|294101046|ref|YP_003552904.1|  ---------------------------------------.....--------------------
gi|294101779|ref|YP_003553637.1|  ---------------------------------------.....--------------------
gi|294101226|ref|YP_003553084.1|  RIIDVPGAYTLD---------------------------.....--------------------
gi|294101892|ref|YP_003553750.1|  NFYKIEAE-------------------------------.....--------------------
gi|294102315|ref|YP_003554173.1|  ---------------------------------------.....--------------------
gi|294102188|ref|YP_003554046.1|  ---------------------------------------.....---------N----------
gi|294102320|ref|YP_003554178.1|  -----------------------------------F---.....--------------------
gi|294102169|ref|YP_003554027.1|  ---------------------------------------.....--------------------
gi|294101254|ref|YP_003553112.1|  THQPPKQF-------------------IARGVRYIPADRkgt..GLVPNMDIKENSILKKYWN-
gi|294102077|ref|YP_003553935.1|  ---------------------------------------.....--------------------
gi|294102510|ref|YP_003554368.1|  LAVDSP---------------------------------.....--------------------
gi|294101748|ref|YP_003553606.1|  ---------------------------------------.....--------------------
gi|294101141|ref|YP_003552999.1|  ---------------------------------------.....--------------------
gi|294101018|ref|YP_003552876.1|  ---------------------------------------.....--------------------
gi|294101692|ref|YP_003553550.1|  --------------------------------------F.....--------------------
gi|294101032|ref|YP_003552890.1|  ---------------------------------------.....--------------------
gi|294101031|ref|YP_003552889.1|  ---------------------------------------.....--------------------
gi|294101431|ref|YP_003553289.1|  YFVDREK--------------------------------.....--------------------
gi|294102167|ref|YP_003554025.1|  ---------------------------------------.....--------------------
gi|294101458|ref|YP_003553316.1|  ---------------------------------------.....-------N------------
gi|294102320|ref|YP_003554178.1|  ---------------------------------------.....--------------------
gi|294101940|ref|YP_003553798.1|  ---------------------------------------.....--------------------
gi|294102120|ref|YP_003553978.1|  ---------------------------------------.....--------------------
gi|294101791|ref|YP_003553649.1|  YRLERGD-EYELGLCEYADDGFVLVIEWPDRLAE-----.....--------------------
gi|294102136|ref|YP_003553994.1|  ---------------------------------------.....--------------------
gi|294101830|ref|YP_003553688.1|  ---------------------------------------.....--------------------
gi|294102042|ref|YP_003553900.1|  ---------------------------------------.....--------------------
gi|294102015|ref|YP_003553873.1|  V--------------------------------------.....--------------------
gi|294102787|ref|YP_003554645.1|  ---------------------------------------.....--------------------
gi|294102032|ref|YP_003553890.1|  ---------------------------------------.....--------------------
gi|294102010|ref|YP_003553868.1|  ---------------------------------------.....--------------------
gi|294101586|ref|YP_003553444.1|  ---------------------------------------.....--------------------
gi|294101458|ref|YP_003553316.1|  ---------------------------------------.....--------------------
gi|294102625|ref|YP_003554483.1|  -----------------------------QNIGMVFDAP.....LLPLAEEVL-----------
gi|294102478|ref|YP_003554336.1|  ---------------------------------------.....--------------------
gi|294101874|ref|YP_003553732.1|  ---------------------------------------.....--------------------
gi|294102071|ref|YP_003553929.1|  ---------------------------------------.....--------------------


                                                           150                                      
                                                             |                                      
d1htwa_                             .....................-------------tnlgkniisafsn.................
gi|294102520|ref|YP_003554378.1|  .....................-------------sialrepslgpsfgvkggaagggysqvvpm
gi|294102529|ref|YP_003554387.1|  .....................-------------krvcialrepslgpsfgvkggaagggysqv
gi|294102437|ref|YP_003554295.1|  .....................-------------vadvslalreamlegkgilfegaqgtlldv
gi|294102168|ref|YP_003554026.1|  .....................-------------qeqsrldwilvdeyqdvnkpqyfllrrlig
gi|294101779|ref|YP_003553637.1|  .....................-------------qlytefktffphnavhyfvsyydyyqpeay
gi|294102457|ref|YP_003554315.1|  .....................-------------trvgrqnvlychvtlvpyleaarelktkpt
gi|294101625|ref|YP_003553483.1|  .....................-------------kmgethegsatmdwmeqerergitissaat
gi|294101185|ref|YP_003553043.1|  .....................-------------vrgdvpeglkdrsifaldmgslvagakyrg
gi|294102626|ref|YP_003554484.1|  .....................-------------vntfgpnatvelaksslalfasqgqtpkdl
gi|294101765|ref|YP_003553623.1|  .....................-------------pverfheginqvevderagrtfevvlrsll
gi|294102479|ref|YP_003554337.1|  .....................EEDIVKAA-----qiagihtfitslpegydtevgergvtlsgg
gi|294101904|ref|YP_003553762.1|  ...............lsrkeaELKVKEVLNLVGLigvderfphqlsggeqqrvalarvlvidpr
gi|294102557|ref|YP_003554415.1|  ...............meeskiREKMEGVIDLVGLtglesrqpsqlsggqqqrvalaraiimepa
gi|294101807|ref|YP_003553665.1|  .....................-------------ttprlaltaaeylafeqdmhvvviltdltn
gi|294101806|ref|YP_003553664.1|  .....................-------------ivvyvgcgergnemtdvllefpeledprsg
gi|294102649|ref|YP_003554507.1|  ...............wetdaiSKRVTEVLDLVDLsdkaqsypsqlsggqkqrvgiaralannps
gi|294101185|ref|YP_003553043.1|  .....................-------------ymekfsvsrligappgyvgyeeggqlteav
gi|294102868|ref|YP_003554726.1|  ...............idrkkaMQMGDEMLAKVGLpdsasksidqlsggeqqrvalarslvtepk
gi|294102500|ref|YP_003554358.1|  .....................-------------grdvdsmirdlvetavamvkrvkieevqgp
gi|294102409|ref|YP_003554267.1|  .....................-------------tnsefgfdylrdnmavakdqlvqrghhfci
gi|294102354|ref|YP_003554212.1|  .....................-------------gaeeqkrqisintalvtlerngkrlylldt
gi|294101565|ref|YP_003553423.1|  .....................-------------sefmerhevgkligappgyvgydeggklte
gi|294101424|ref|YP_003553282.1|  ..............gmkkkeaEDLAIRLLERVGLgdkvyakpsqlsggqqqrvaiaralamqpk
gi|294101976|ref|YP_003553834.1|  .....................-------------maltaaeyfafekgydvlvimtdmlyyces
gi|294101061|ref|YP_003552919.1|  ..............gmdkkhaREKAMLELERVG-maafadhyptqlsggqaqrvsiaralamdp
gi|294101048|ref|YP_003552906.1|  ...............isekerRERSNVALERVGLkgwenyypsslsggmrqrvgiaralvmdtp
gi|294101977|ref|YP_003553835.1|  .....................-------------yigcgergnemtevleefpelsdpfhnapl
gi|294101084|ref|YP_003552942.1|  ..............kaseeeaHEIALRLLEKVGLsehahkypatlsggqtqrgaiaralamnpk
gi|294101565|ref|YP_003553423.1|  .....................-------------iaeilrgkkivqlnignlvagtkyrgefee
gi|294101786|ref|YP_003553644.1|  ...........vykssekdkiQKKVDQTMDLVGLakrfansypheldggrrqrigiaraltlnp
gi|294101493|ref|YP_003553351.1|  ...............isarkrHERALHALQIVDLedranhqpqqlsggqqqrvaiaralandap
gi|294101884|ref|YP_003553742.1|  .....................-------------ktvgiiavdpsspfsggailadrirmqrha
gi|294101894|ref|YP_003553752.1|  .....................-------------dvenilvrllqaadydiqaaergiiyidel
gi|294101778|ref|YP_003553636.1|  ..................tnrPDILDPALLRPG-rfdrhivvdrpdvkgreeilavhvrnkkia
gi|294102313|ref|YP_003554171.1|  ...............ipqkerKEKIFDALEWLGLtdkidsrpsqlsggecqrvavaravvkrpe
gi|294102640|ref|YP_003554498.1|  .............acgsrkevDNKVKELMDTVGLaerlttsfpheldggrrqrigvaralaldp
gi|294101376|ref|YP_003553234.1|  ..................tniPNTLDPALRRPG-rfdreisipipdrngrfeilqihtrgmpla
gi|294102641|ref|YP_003554499.1|  ..............dfkgeavRKRAHEMLALVGIrpergkeyphqfsggmrqrvgiaialacep
gi|294101359|ref|YP_003553217.1|  .....................-------------edithevylvptrhkeeglinvllwekpsr
gi|294102459|ref|YP_003554317.1|  .....................-------------vlliderpeevtdmarsvdgeiiastfdrp
gi|294101785|ref|YP_003553643.1|  ..............hvssakaTKKASEMMELVGIdpvrmsdyphqfsggmkqrvviamalacnp
gi|294101376|ref|YP_003553234.1|  ..................tnrIDLIDPA------llssgrfdvvlelpmpdakarleifqihlq
gi|294102074|ref|YP_003553932.1|  .....................-------------sdvekvleagvdvvleidvqgalqvknafd
gi|294102442|ref|YP_003554300.1|  ...............mprrmvQKRTNEVVDQVGLwrrrflyppqlsggeqqrvaiaramanspa
gi|294101577|ref|YP_003553435.1|  ...............kpqkeiETMVSHILEELG-ltslasipgyalsggerrrveiarclsimp
gi|294101171|ref|YP_003553029.1|  aysfveavthfgkwrmketsiRDRSMELLNRVGLadralqpagtlpygyqrrleiaralaldpr
gi|294102413|ref|YP_003554271.1|  ..................kskW------------wmapfpvpsmiqeekeireksmkllqsvsl
gi|294102187|ref|YP_003554045.1|  .....................-------------daaelsmqqdhvvrmesrpvniegtgaiti
gi|294102332|ref|YP_003554190.1|  ...............kpnaeaRQQAIELLKAL--dvehrakampsqlsggeqqrvaiarglvnr
gi|294102831|ref|YP_003554689.1|  .....................-------------vlavdmdpqgnctsglgiearaievslydv
gi|294101321|ref|YP_003553179.1|  .....................-------------ergitinishveyqtenrhyahidcpghad
gi|294101626|ref|YP_003553484.1|  .....................-------------ergitinishveyqtenrhyahidcpghad
gi|294101069|ref|YP_003552927.1|  .............gwrlaesdIKKVDAI------ihtlgldelalryldemsggelqkvtiara
gi|294102759|ref|YP_003554617.1|  ..............glsgearRHRCRSLLEEAD-lewslanryphelsggqkqraaiatalacd
gi|294101055|ref|YP_003552913.1|  ...........ygskkksknlDVI----------irnkledvglfeevkdslsmnatllsggqq
gi|294101254|ref|YP_003553112.1|  .............qllpkkeiHQQII--------disrqyglevdpdakiwqlsigeqqrvail
gi|294102760|ref|YP_003554618.1|  .............grksrleaYSKARRLLKTLG-ieeerillsrvrsglsggqrqrvsiarsli
gi|294101659|ref|YP_003553517.1|  ...............lspleiRQRVDWALSVTGLshkmqnptyslsggekqrlavagalaldpp
gi|294101172|ref|YP_003553030.1|  ....................ePEKVKQDLQW---vfslfprleerrdqyagtlsggeqqmlaig
gi|294102017|ref|YP_003553875.1|  .....................-------------imaqmgafipaaeasmglmdrvftrigard
gi|294101748|ref|YP_003553606.1|  .....................-------------raafkaseagkqvvvlvpttilaqqhyhtf
gi|294102409|ref|YP_003554267.1|  .....................-------------edldpskyqqlleeyrqicakerdevldkg
gi|294102070|ref|YP_003553928.1|  .....................-------------vsdipgttrdatdtviemkegkfrfidtag
gi|294102390|ref|YP_003554248.1|  .....................-------------avlallqaveggyqgafmapteilaqqhyy
gi|294101403|ref|YP_003553261.1|  .....................-------------lhgiaeaqkaggiaafidaehaldprlaas
gi|294101730|ref|YP_003553588.1|  .....................-------------qkqsvepcndcpnclainggesldvieidg
gi|294102602|ref|YP_003554460.1|  .....................-------------kgahieervmdsnelerergitirakhctv
gi|294102663|ref|YP_003554521.1|  ..................iksREKLDEIVKR---sligaalwsevkdnlkssglglsggqqqrl
gi|294101436|ref|YP_003553294.1|  .....................-------------gaevkpyasgktdpnramvsvpdprfehlv
gi|294102150|ref|YP_003554008.1|  .....................-------------irkmkaqlldsldlerergitiklvpvrms
gi|294101607|ref|YP_003553465.1|  .....................-------------rnldvvmglenrvvynfidviegtcrlpqa
gi|294102035|ref|YP_003553893.1|  .....................-------------airaagwnmkvgiiqfmkgwpqygelasla
gi|294102412|ref|YP_003554270.1|  ....................dKEGIEK-------dmdhvyslfprlrerawqkggtlsggeqqm
gi|294101660|ref|YP_003553518.1|  ...............vseedlEKVVNETLLEVG-ipldfldrnpfqlsggekrrialasvlaae
gi|294102549|ref|YP_003554407.1|  ...........rglifnhhgaI------------eavrhlsaqyglnidplapvhslpvgiqqr
gi|294102841|ref|YP_003554699.1|  ............rrkifteedKKIAMDVLEHMGLagrrndpmgdlsqgqrqrvliaralasrpr
gi|294101272|ref|YP_003553130.1|  ...............ekhlrkNKKAKGLFERFGLngfedylpgavsggmkqrcalirtlmfere
gi|294101433|ref|YP_003553291.1|  .....................-------------lmgvtdspygspqgiippassifdikvmsv
gi|294101963|ref|YP_003553821.1|  .....................-------------argaqatdiailvvaaddglmpqtkeainh
gi|294101356|ref|YP_003553214.1|  .....................-------------tdtekrgllgaflfsgddiyklisvlsgge
gi|294102542|ref|YP_003554400.1|  ...............vrgkelMKSMEEALYFVGLapsqfarrkwyelsggeaqrvalasrlaik
gi|294101861|ref|YP_003553719.1|  .....................-------------ekagdiaailsnlepfdvlfideihrlpan
gi|294102400|ref|YP_003554258.1|  .....................-------------kepilifslemsaeqlvqrmlgseakvnih
gi|294102043|ref|YP_003553901.1|  .....................-------------selflfvidrcehvsqvispalscgqivlc
gi|294101077|ref|YP_003552935.1|  ...............inkeeaYEQAINVLKTL--nidnlahtppyalsggqkrlgalaavlamk
gi|294102348|ref|YP_003554206.1|  .....................ERNLEEAMDFVQ-msplfldraidkslsggerkrielasiylm
gi|294102040|ref|YP_003553898.1|  .....................-------------tgsrviaqqqgsdsaavaydalqaarasga
gi|294101613|ref|YP_003553471.1|  .....................-------------pnclritrqsdllfqgsislptatetevsl
gi|294101367|ref|YP_003553225.1|  .....................-------------ynflvesfgdrlrtlnteemrqrgenaiek
gi|294101893|ref|YP_003553751.1|  .....................-------------nsnftdhyiesafdlsnvifittanvthti
gi|294101841|ref|YP_003553699.1|  .....................-------------gypfttlspnlgilavdddrivvadvpgli
gi|294102070|ref|YP_003553928.1|  .....................-------------gllvrdehplvegirkqatlaieeshvilf
gi|294102221|ref|YP_003554079.1|  .....................-------------giktlvvstdpahsladafnrpigldvipv
gi|294101356|ref|YP_003553214.1|  .....................-------------eiedtvllhylkkqagialvekelrateed
gi|294101345|ref|YP_003553203.1|  ...........nwkgeledrdI------------kavekalvevnawhlsgrdfaklsdgesqr
gi|294102145|ref|YP_003554003.1|  .....................-------------cdrlneekkrgitielgfaplklhdgrvvs
gi|294101756|ref|YP_003553614.1|  .....................-------------ykvsivsekpqttrnaihgiynepemqivf
gi|294102549|ref|YP_003554407.1|  .......pflkrnffqnfrsiREFALHLMERY--nimaaseniqagtlsggnmqrlvmareleq
gi|294101372|ref|YP_003553230.1|  .....................-------------taipgttrdlieevltyrgipirlvdtagi
gi|294101016|ref|YP_003552874.1|  .....................-------------flgnkgssqeeffhtfnqlhvskkqivics
gi|294101780|ref|YP_003553638.1|  .....................-------------fdtlyaegqrryveslsayarqflgiqkkp
gi|294101686|ref|YP_003553544.1|  .....................-------------tdldgalshveghgfvvldsvqamrssled
gi|294102507|ref|YP_003554365.1|  .....................-------------dykpsleppfhivhptastvaicgggaslr
gi|294101471|ref|YP_003553329.1|  .....................-------------rlirtifedffrwgyhpalssekewwnalg
gi|294101845|ref|YP_003553703.1|  .....................-------------fasgkraqselirageeeaevialffcprt
gi|294101553|ref|YP_003553411.1|  .....................-------------aaieqlkvlaqqskvafygpsggtqdvikv
gi|294101853|ref|YP_003553711.1|  .....................-------------rkpeelrllmidpkrvelsiyehlphmlak
gi|294101780|ref|YP_003553638.1|  .....................-------------dvlykgmkrildkdfreragkhlsidgaeq
gi|294102079|ref|YP_003553937.1|  .....................-------------dtgaiyralafylnamgfepvespylteil
gi|294101472|ref|YP_003553330.1|  ..................gmdR------------htartatqnlfsalgitqeasrerpgklsg
gi|294102235|ref|YP_003554093.1|  .....................-------------giyslgaasideqvaseflikekpelaitv
gi|294102390|ref|YP_003554248.1|  .....................-------------eketimrsfarghldlivsttvievgvdvp
gi|294101443|ref|YP_003553301.1|  .....................-------------rslleinavsakvselrdlveeaknlkils
gi|294101748|ref|YP_003553606.1|  .....................-------------earismahgqmaekdlertmldfyngnldi
gi|294101649|ref|YP_003553507.1|  .....................-------------istgdilrqnvkektklgcqaqefmnggkl
gi|294101715|ref|YP_003553573.1|  .....................-------------gmgiilawcgfplpakegtvvgnldnvfad
gi|294101925|ref|YP_003553783.1|  .....................-------------akvfrinapsnplyipfwlmnfdelafflv
gi|294101367|ref|YP_003553225.1|  .....................QKYL---------kpvlgglfkirdeeairevtkkyidtleik
gi|294101751|ref|YP_003553609.1|  .....................-------------vchgvamlkagaisrivlvrpaveageslg
gi|294101046|ref|YP_003552904.1|  .....................-------------kaqmpegisriiftapikalsnerymdlrr
gi|294101779|ref|YP_003553637.1|  .....................-------------aqlytefktffphnavhyfvsyydyyqpea
gi|294101226|ref|YP_003553084.1|  .....................-------------ptneaeqvarrmvdegadlaiivldatale
gi|294101892|ref|YP_003553750.1|  .....................-------------vdfflvdlpgygyaargfkekekwaklieq
gi|294102315|ref|YP_003554173.1|  .....................-------------nipviaidpkgditnlllsfpeqrsedflp
gi|294102188|ref|YP_003554046.1|  .....................-------------pvqaelvksgmgdrlieslsdrfdyivvdl
gi|294102320|ref|YP_003554178.1|  .....................-------------rntgqrflnsynmflkelddgfiyvskkys
gi|294102169|ref|YP_003554027.1|  .....................-------------tkkaasfrfaviegdiatsrdaerlsklgv
gi|294101254|ref|YP_003553112.1|  .....................-------------kpvargpmidwkavfshainlvkkysvstp
gi|294102077|ref|YP_003553935.1|  .....................-------------adqlfstldtyvrkvelsdghdvlvsdtvg
gi|294102510|ref|YP_003554368.1|  .....................-------------gildprshnevhrrl...............
gi|294101748|ref|YP_003553606.1|  .....................-------------pgqyvvrgfivdiydpayalpirieffdei
gi|294101141|ref|YP_003552999.1|  .....................-------------aawkwgsgvasrhpisrfiflyptratate
gi|294101018|ref|YP_003552876.1|  .....................-------------rksflvnwdteekqaylrgyfsgetnldiv
gi|294101692|ref|YP_003553550.1|  .....................-------------pifprvaaqvrgclghrcpyrdrcfiqkal
gi|294101032|ref|YP_003552890.1|  .....................-------------skgtaidldvdepdlglvlqiknpkkenvy
gi|294101031|ref|YP_003552889.1|  .....................-------------cdvdvdapnlqlllnpqdeqafsftgrkip
gi|294101431|ref|YP_003553289.1|  .....................-------------tpldeqgnydfevleaidldllesqlakll
gi|294102167|ref|YP_003554025.1|  .....................-------------iwkslgatiidadalaheawkdttvlrras
gi|294101458|ref|YP_003553316.1|  .....................-------------gevidfnrwgrvaensspytantmltdrrn
gi|294102320|ref|YP_003554178.1|  .....................-------------ktnpgswpnvfsdfrvpadyesigrldnli
gi|294101940|ref|YP_003553798.1|  .....................-------------lhgavnflqgnperrvlffsldmskeettq
gi|294102120|ref|YP_003553978.1|  .....................-------------ksavfvpvveildeiragfdegtaykiqqa
gi|294101791|ref|YP_003553649.1|  .....................-------------qpt...........................
gi|294102136|ref|YP_003553994.1|  .....................-------------evnkgcpwvtdascltaikkvnklinpkie
gi|294101830|ref|YP_003553688.1|  .....................-------------qglfavdnippallpqllellsqhraavqe
gi|294102042|ref|YP_003553900.1|  .....................-------------smlkiveeppehgvilfllendkflptlks
gi|294102015|ref|YP_003553873.1|  .....................-------------tfqtrqhilhhmldvvdpdevfsaadfvdk
gi|294102787|ref|YP_003554645.1|  .....................-------------ryslfgcpdgrssrnlyapphggkqkgsli
gi|294102032|ref|YP_003553890.1|  .....................-------------yslqrlhesakekpapddwiyaynfsdpsr
gi|294102010|ref|YP_003553868.1|  .....................-------------irqvsdvlekkglsvitmpeqakwldmslv
gi|294101586|ref|YP_003553444.1|  .....................-------------kvlspmdtdtgkvlsqgipalywgvdgcry
gi|294101458|ref|YP_003553316.1|  .....................-------------kifyesriakldlpeemkpqidseyeeite
gi|294102625|ref|YP_003554483.1|  .....................-------------qryripysinegltvgqtalwdiarriwna
gi|294102478|ref|YP_003554336.1|  .....................-------------srgyggrtsepvvikgtssereivgdepll
gi|294101874|ref|YP_003553732.1|  .....................-------------rimtgksakseknlvrairralfefpehre
gi|294102071|ref|YP_003553929.1|  .....................-------------ifaplpdpqlilvdeesspayrmqaapllh


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  edinlhftgdlhaittahnllaalldnhlhqgnplnidprrvvfrrvidlneralryvnvglgg
gi|294102529|ref|YP_003554387.1|  vpmedinlhftgdlhaitsahnllsalidnhlhqgnplnidprrvvfrrvvdlneralrhvivg
gi|294102437|ref|YP_003554295.1|  dhgtypfvtssspiaaggcvglgvgpsdvdrvigvvkayctrvgegpfptedlgdhgqtlrdrg
gi|294102168|ref|YP_003554026.1|  tkgnimvvgdpdqsiygwrgadmtmilnfekdfpaakvvvldqnyrstgnilkaanaviisner
gi|294101779|ref|YP_003553637.1|  ipssdtyiekdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavge
gi|294102457|ref|YP_003554315.1|  qhsvqelrrigilpdiiicrshypicdemkekialfcnvpkeaviealdeptiyqvplslqaqe
gi|294101625|ref|YP_003553483.1|  tciwrdcfvniidtpghvdftveversmrvldgavavfcavggvepqsetvwrqadkyhvpria
gi|294101185|ref|YP_003553043.1|  efeerlkavlneiktsegriilfidelhtivgagaaegaidagnmlkpmlargelhcigattid
gi|294102626|ref|YP_003554484.1|  wqwgsdlfsrdqdavdtarltlfrrwedewhrflqpesgifynlnelggtgklcgnvrnlitrw
gi|294101765|ref|YP_003553623.1|  rqdpdiilvgeirdsetahlvmraaltghlvlstlhtddaanaplrliemgvppflivsslkav
gi|294102479|ref|YP_003554337.1|  qrqrvaiaraiirnprilildeatssldvavesqiqeamekamegrtsfviahrlstvrsadri
gi|294101904|ref|YP_003553762.1|  vllmdeplsnldaklriymraeirkiqkklgitcihvthdqkealtiadrivvlnkgkieqvaa
gi|294102557|ref|YP_003554415.1|  lllfdeplsnldaklreqmrieirhlqkrlgitsvyvthdqaeamsisdrvvvmnkgrieqvgt
gi|294101807|ref|YP_003553665.1|  ycealreisaarkevpgrrgypgylytdlatmyeragrlkgkkgsitqipiltmpeddkthpip
gi|294101806|ref|YP_003553664.1|  eplmkrtvliantsnmpvaareasiytaitmaeyyrdmgysvalmadstsrwaealremsgrle
gi|294102649|ref|YP_003554507.1|  lllcdeatsaldpkttqsilalldeinrklgitivlvthemgvirqichrvavlehgqvvelga
gi|294101185|ref|YP_003553043.1|  rrrpysvilfdeiekahhdvfnvllqilddgrvtdsqghvvdfkntviimtsnigaplllegit
gi|294102868|ref|YP_003554726.1|  vllldeplsnldaklrirmrreirqlqkgigitaiyvthdqeealalsdrivvmekgeiiqidt
gi|294102500|ref|YP_003554358.1|  aeeraewrlvdallprperktsmpdfmkifsgkeaeetppqeedtirestrnkvyallkagkld
gi|294102409|ref|YP_003554267.1|  vdevdsilideartpliisgpsednvemyttadqiarqlkegrdfekdekernvaftedgiarc
gi|294102354|ref|YP_003554212.1|  pgfadfigemrsamrvsdsalavvsglhgvevqtgkayeyaedfsipvafvvskldrensdyar
gi|294101565|ref|YP_003553423.1|  airrrpysvvlfdeiekahedvfnillqiledgrltdgqghtvdfrnaviimtsnigakdwvkg
gi|294101424|ref|YP_003553282.1|  imlfdeptsaldpelvgevleviaqlaetgmtmviithemlfakdvsdriifmadgniveqgsp
gi|294101976|ref|YP_003553834.1|  lreisaareevpgrrgypgymysdlaeiyeragcvencqgsitqipiitmpdddmthpvvdlsg
gi|294101061|ref|YP_003552919.1|  dvmlfdeptsaldpeligevlevmrnlakggmtmlvvthemgfacsvaneimfmeegrilesgs
gi|294101048|ref|YP_003552906.1|  illmdepfsgldplirremqdelirlqkelkktiffvthdldeamrmgdrmavmkngtivqmga
gi|294101977|ref|YP_003553835.1|  mermvliantsnmpvaareasvylgmtlaeyfrdmgyntaimadstsrwaealreiggrleemp
gi|294101084|ref|YP_003552942.1|  vmlydeptsaldpelvgevlqvmkdldnegmtqiivthqmrfarnasdyivfmdggeivemadg
gi|294101565|ref|YP_003553423.1|  rmrkllkelretgdviifideihsiigaggaegavdaanilkpslsrgefqvigattldeyrky
gi|294101786|ref|YP_003553644.1|  kfivcdepvsaldvsiqaqilnliqdlqvqfgltylfithdlsvvkhlstnimvmylgqvvela
gi|294101493|ref|YP_003553351.1|  liladeptgnldsktgidvmklfvrlnvesgktiiqvtherdmalfgsriitvkdgtivhderv
gi|294101884|ref|YP_003553742.1|  ndpdvyirsmgtrgslggvsrstreavkildacgkdvviietvgvgqseidivkladtvclvlv
gi|294101894|ref|YP_003553752.1|  dkitrksesasitrdvsgegvqqallkilegtlsnvppkggrkhpyqdfiqmdtsnilficgga
gi|294101778|ref|YP_003553636.1|  ddvdlgvvarrtpgfvgadlanlvneaallaaragkslitmaefeegidr..............
gi|294102313|ref|YP_003554171.1|  liladeptanldsensynilemmvrlnkelettfifathdekvmkylrrkihlfdgrvaqde..
gi|294102640|ref|YP_003554498.1|  efivldepvsaldvciqaqilnllgdlkkergytylfishnlsvvryvsdevavmylgqvveka
gi|294101376|ref|YP_003553234.1|  edvdlmrlsdithgfvgadlealakeaamsslrellpcidyeqavipyekllsmnvtmenflda
gi|294102641|ref|YP_003554499.1|  tlliadepttaldvtiqaqvldliknlqkivntslllithdlgivaeicdevaimyagrlveys
gi|294101359|ref|YP_003553217.1|  aivfchtraetveltrrlhdenfqamclhgemsqrernmalsqfrsgrtpllvatnvaargldv
gi|294102459|ref|YP_003554317.1|  aeehlrvanlalekakrlvetgkdvvllldsitrlarasnlvvppsgrtlsggmdpaalyfpkr
gi|294101785|ref|YP_003553643.1|  kvliadepttaldvtiqaqvlemmnelkkkfnmatilithdlgivaqtcekaaviyageiveyg
gi|294101376|ref|YP_003553234.1|  kkplaedvhleelvrsteghsggdihficrkasalairdflkigekgapciekhhfeials...
gi|294102074|ref|YP_003553932.1|  dsvlifimppskeelerrlrnrgteeedtvqlrlsnalkemekmhmydyvvvndsvlraaleik
gi|294102442|ref|YP_003554300.1|  ifiadeptgnldihtaedvmrllvalnaagatvimathdqylvdayrqrvvelqegrivrdeek
gi|294101577|ref|YP_003553435.1|  dfllldepfsgidpiavydiqqiilslrakgygilltdhnvrdtlaitdrtylihqgeiviegs
gi|294101171|ref|YP_003553029.1|  lllldepaagmnpeevmalneliksihmefqlailviehhmdlvmeicpriicmnfgakiaegs
gi|294102413|ref|YP_003554271.1|  aqdanvlssslpygaqrrleiaralatdpsfllldepaagmnpletvdlmsfirrirdefnlti
gi|294102187|ref|YP_003554045.1|  rmlvrnslrmrpdriivgecrgeeafdmlqamntghdgslttlhansprdvlsrlesmvlmagm
gi|294102332|ref|YP_003554190.1|  ppviladeptapldseralavirilndmaqrfetavivvthdekiiptfkriyhirdgvtyeee
gi|294102831|ref|YP_003554689.1|  llggasaqdalmatswqgvsllpatidlagaevelasvisretclrrhmanlnqfdvaiidcpp
gi|294101321|ref|YP_003553179.1|  yiknmitgaaqmdgailvvsaadgpmpqtrehvllarqvnvpavvvfmnktdqvdddelldlve
gi|294101626|ref|YP_003553484.1|  yiknmitgaaqmdgailvvsaadgpmpqtrehvllarqvnvpavvvfmnktdqvdddelldlve
gi|294101069|ref|YP_003552927.1|  lvqeprillldepissldvknqieimetmkhiikghglsavmslhdltmalrygdrfvfmkkge
gi|294102759|ref|YP_003554617.1|  pdflladepttaldvitqkeiiltlerlargrnmglllvthdlplavqicdaiavmhegeivee
gi|294101055|ref|YP_003552913.1|  qrlciaralavepeillldepcssldvkntqniemmlralcqqysiiivthnlfqarrishrtf
gi|294101254|ref|YP_003553112.1|  qmlyrkaqvlildeptavltpqealrlfstiqqmtaeghgivfishkldevlslsdrisilrkg
gi|294102760|ref|YP_003554618.1|  lepalllcdeptsmqdastrseiihvlnervkegmamvfvthdlylargaakrgivllegecce
gi|294101659|ref|YP_003553517.1|  clvldeptamldpqgrrdlldvlktlhaqgrtiiyithrleetvhcdralvlksgkvqwdgtis
gi|294101172|ref|YP_003553030.1|  ralmsrprlllldepslglapiiirdifkelrrinsegvtillveqnarqalllshrgyvlqtg
gi|294102017|ref|YP_003553875.1|  elsrgnstfmvemietanilhnvtdrsivvldeigrgtstydgmsiawavleyldhgcgskpkv
gi|294101748|ref|YP_003553606.1|  rsrmagfpirvevlsrfvstsrqkriledtkkglvdiligtqrllqkdiefkdlglliideehr
gi|294102409|ref|YP_003554267.1|  glkiigterhesrridnqlrgrsgrqgdpgssrfylsleddllrlfgseriqgimeklgmeege
gi|294102070|ref|YP_003553928.1|  lrkksridsdieyysfvrtlqavdrsdvallvmdasepttdqdkkmaaqviekgkglillinkw
gi|294102390|ref|YP_003554248.1|  rlhsfleplgvsvvlligslknrareltlqkistgeahvvvgthalfsdpvtfsnlgfavideq
gi|294101403|ref|YP_003553261.1|  lgvdvqslyvaqpdsgeqalyvldtlvrsgavdlvvvdsvaaltpqaeidgkigdsqlglqarl
gi|294101730|ref|YP_003553588.1|  asnnsvdevrelkahvslsafsslykvyiidevhmlslsafnallktleeppshvvfilattep
gi|294102602|ref|YP_003554460.1|  ewngyliniidtpghadfsgevervlstvdsvlllvdanegpmpqtryvlmralamglrpivfi
gi|294102663|ref|YP_003554521.1|  ciaraiatepevllmdeptsaldpmatarieelvrtlkerytviivthnmqqaarisdytaffl
gi|294101436|ref|YP_003553294.1|  tifepkkqtpatvefvdlaglsrdaskgaglgnaflsfvaesdalvhvvrtfdnpevphpedni
gi|294102150|ref|YP_003554008.1|  ykskdgneyilnlidtpghvdftyevsrsiascegallvvdasqgveaqtvanaymavdqglei
gi|294101607|ref|YP_003553465.1|  lirdkrvdnlfllpaaqtrtkdavspdqmvelcemlkkegfdfilldspagieggfknaaagat
gi|294102035|ref|YP_003553893.1|  rfpeiqlvqtgrpdfvkkgsplqfdieeaqrglelakkwiekglfdivildeinvaldyelvel
gi|294102412|ref|YP_003554270.1|  lavgralmsrpdlvmmdepslglapmlvkevfdiireinaqgktvllveqnafaalkvahhayi
gi|294101660|ref|YP_003553518.1|  paylvldeptagldatgrkdlikllskqkkkgrgiifvthdletalmssdsilvleggrevvqg
gi|294102549|ref|YP_003554407.1|  veilkllyrkaeilifdeptavlspreieglfsiirefrkagktiifiahnlnevlavsdvitv
gi|294102841|ref|YP_003554699.1|  illmdeplasidpeargvlyedlasfagnvtiilvshdlsviangatavacv............
gi|294101272|ref|YP_003553130.1|  ivlldeplsaldaitrrslqslllslqkdfkktvlmithdidealyladtvlvltqapmkirdr
gi|294101433|ref|YP_003553291.1|  nlllddptkpvvwrgpiiasvikqfwedvawdktdfiivdlppgtadapltvmqtidldgflvv
gi|294101963|ref|YP_003553821.1|  araagvpivvavnkidkpaarpdrvrqqlsdvglvpeewggdsimvdvsaktgegiphllemvl
gi|294101356|ref|YP_003553214.1|  ksrvallkllleetnllildeptnhldmrtrdifqqalteyhgtiiivshdryfldklvsrvie
gi|294102542|ref|YP_003554400.1|  pevllldeptasvdrvsaelikqgvrmcrekwgttlvlvshdvlwvkslsdrhliltegelsts
gi|294101861|ref|YP_003553719.1|  veeilypsmedfslhiivgkgplannicltlppftlvgattrlglltsplrarfgiveqlalyn
gi|294102400|ref|YP_003554258.1|  dirngsfaekdwekladaagrlsqaplfiddssmlstlefrararrfksrfenlglivvdylql
gi|294102043|ref|YP_003553901.1|  erytdstrayqiwgrglpeekvedlfawcsfpepdltlwidtplpvainrikttrghfdriese
gi|294101077|ref|YP_003552935.1|  pdlllldepssglderawqnlvdvlnqldmaliiashdipflehvtrrgyelssg.........
gi|294102348|ref|YP_003554206.1|  kprlaildepdsgvdllalrevlgllrlladqgsgvmvithredvaagcdrsylmcdgriileg
gi|294102040|ref|YP_003553898.1|  dvliidtagrlhskhnlmeeltkivrvierevgrdsmenllvldavmgqngfaqaesfhkalsl
gi|294101613|ref|YP_003553471.1|  ciredpkictikrefspetgtslfvdgmrirlqdlddvkrqwhmegeqfafigqgevaeaihhr
gi|294101367|ref|YP_003553225.1|  lnvvispdtlvsempvghkqfteiareidkkktqllvldeptavlteseaeillasmrklaalg
gi|294101893|ref|YP_003553751.1|  paplldrmevirlpgyvaeekihiakkhllpklfkehgltdkmisitsktvektirdytreagv
gi|294101841|ref|YP_003553699.1|  egahenkglgiyflrhiertrvlihvldlsvgtpedvlyqwevicsefkaykesllerpymvvg
gi|294102070|ref|YP_003553928.1|  vidgfngpnwmdedvahilrrsgkpvivvanklddgihedrvydayslgfehvvgisalhkryi
gi|294102221|ref|YP_003554079.1|  aenlwgieidaeeeakkymkaiqdkmlhivsaviveeikrqieiaymspgaeeaaifdkfielm
gi|294101356|ref|YP_003553214.1|  iaraakneeeyhsllkrhdhlshryeqlggyefaamaqkvmkglgfsdgdgqrytstfsggwkm
gi|294101345|ref|YP_003553203.1|  vliaralaqdtpillldeptafldlprkvellsllrqyawkmnkgvlmsvhdidlalrfadriw
gi|294102145|ref|YP_003554003.1|  ivdvpghekfirqmvagasgidavmlvvaadegvmpqtrehlailnllgvhdgviviskadlvd
gi|294101756|ref|YP_003553614.1|  tdtpgihrprhklgealvkaavrslenadlilyvvevddisispeddriieilqevstpiflvv
gi|294102549|ref|YP_003554407.1|  qpdfllvsqptrgvdiggisfihdrllslrragkailmisadldeilslsdriavmnrgeivav
gi|294101372|ref|YP_003553230.1|  gapgdeieamgiaraekammeadvriwvidgsepltpadlalvqkisatnhivtinkadlplvi
gi|294101016|ref|YP_003552874.1|  drppkeiqniedrlvsrfewglvtdiqmpdletriailqkkaqirnyevpedvisflaqnvpsn
gi|294101780|ref|YP_003553638.1|  dvddisglspaisieqkgtshnprstvgtvteiydylrllygrlgvpycpscgkavirysldei
gi|294101686|ref|YP_003553544.1|  gwpgtpsqvravaqqcidsakktgipfvvvghitkegriagpmllehmvdavllfsgedtsayr
gi|294102507|ref|YP_003554365.1|  pgeislahrgilfldeftefrrdllealrqpledgsivvsraagrvefpcrvlllaacnpcpcg
gi|294101471|ref|YP_003553329.1|  egmekaslserllhrypcqlsggelqrfallrallfsplflvadeptsrldpsvqakvahmlve
gi|294101845|ref|YP_003553703.1|  lqlpeeisseegnlflkrvftrngrgktfiqgklfplslfnevaapllriqsqfaqlelldsdr
gi|294101553|ref|YP_003553411.1|  akealayaedhlndviifdtagrlhvdedlmeelsrlkdlvnpheillvvdamtgqeavkvats
gi|294101853|ref|YP_003553711.1|  pvtspkkaiqalawavremeqrydifakarvrnlagynekaipkdrlphiviivdeladlmfta
gi|294101780|ref|YP_003553638.1|  frnvvlvdqspigrtprsnpatytglftlirelfaelpeskirgyapgrfsfnvrggrceacsg
gi|294102079|ref|YP_003553937.1|  skikvslsdgcvyingadvtehirsprvdsivssyaalptvrrcllsiqreqaeegglvadgrd
gi|294101472|ref|YP_003553330.1|  gmaqrallamalaspaefilldeptkgldssrkedatalvkgiinagktllcithdfslpkqig
gi|294102235|ref|YP_003554093.1|  vdasnlerslylvvqmleagqpliialnmadvaenkgirihreklekalgvpvvptvarerkgl
gi|294102390|ref|YP_003554248.1|  qatvmviedadrfglsqlhqlrgrvgrggnqsycvllsnpttregverlkvmcattdgfkiaea
gi|294101443|ref|YP_003553301.1|  gsaaiafvdeiyhfnksqqnallpsvekgdiilvgtttenpwfeinktllsrlvvfqlkplaee
gi|294101748|ref|YP_003553606.1|  lvcttivesgldiprantlivddaqelglaqmyqlrgrvgrreegayayflypetmplqketme
gi|294101649|ref|YP_003553507.1|  vpdeiivgmmgerlkekdcekgflldgfprtvpqaealdqllatmnlsldavilldvddevvvk
gi|294101715|ref|YP_003553573.1|  igdeqsieqnlstfsahlkniihilseatrsslvlldelgagtdpqegaalgialidtlrekks
gi|294101925|ref|YP_003553783.1|  gakptddqrveyrllrelittfkkencklksgdvtqefitadspipfsarklwyemnwwlnasf
gi|294101367|ref|YP_003553225.1|  ctgdyqrvqelsggnqqkvclakafalhpkllfvseptrgidvgakrvvldtlreynqkrgtti
gi|294101751|ref|YP_003553609.1|  ylpgdlrekvepyvrplydafydlfsperflryidknvieiaplaymrgrtlndsfiildeaqn
gi|294101046|ref|YP_003552904.1|  mgfdvgietgdfkrneeapiicctqeiytlkytkephqkliidefhyifedpdrartyidgirg
gi|294101779|ref|YP_003553637.1|  yipssdtyiekdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavg
gi|294101226|ref|YP_003553084.1|  rnlylafqamergihtivalnmvdearhrgisidveklekllgvpvvptvalsgqginriiqri
gi|294101892|ref|YP_003553750.1|  yitqretlqllvhlvdfrhgllkndqelqewisqigipslvvftkadkiskgrhkgmlhsyirk
gi|294102315|ref|YP_003554173.1|  winienataegfppseyaareaekwkkglagwgidgdrikkmresvsfsiytpgsnsgikvnvl
gi|294102188|ref|YP_003554046.1|  hrnfgditielaegcqriwlvtdcsctgvknlhlvtglldqlriswiergvivnkaeredrsiv
gi|294102320|ref|YP_003554178.1|  nkifellesdddealqklidegkaeryssedfkdelrtdlehdrailmeikrlweqidrdpkll
gi|294102169|ref|YP_003554027.1|  paiqinthggchleanlvskafkelpledldvifienvgnlvcpaefdigedmkvavssvpega
gi|294101254|ref|YP_003553112.1|  sietpvknlsggnlqklmlgrelcdapkaliavhptwgldvaatqfvreqlllerdrgaavflv
gi|294102077|ref|YP_003553935.1|  firdlppaliaafrttleeisvsslillvldgsmpdvmetldvveetlsdigagaiprlivlnk
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  vesirsfhpqsqmsaatldeieihsitaarekkleemipdschtvlfepsqienkaesy.....
gi|294101141|ref|YP_003552999.1|  gfrdyvswapetdgtllhgtsnyelqgmfdnpdprsekefltndrlfavglwqkrlfsatvdqf
gi|294101018|ref|YP_003552876.1|  atvgekniiqcdgkrithgnvrslipalaflpgdlaivdgapsvrrqfldrlcallfplyvrkm
gi|294101692|ref|YP_003553550.1|  kkaqnwdvivsnyhmyfayvmngkgtfpvdfdvlicdeahrmvdaarsissvrvswedlvrllr
gi|294101032|ref|YP_003552890.1|  kvvpqieaarckgcgvcadncafgalnqfgthapvvnmqlchgcgvcelvcpqkaikdskasig
gi|294101031|ref|YP_003552889.1|  eidterctvcggcvgfcrfnalekanngitllpwkcegcggcalvcphqaismhsyeqgqywrg
gi|294101431|ref|YP_003553289.1|  kgeevrvpefdfikgkkfpgatlrlnkhdvliiegihglnekvtavvpeemkfgifvspltgin
gi|294102167|ref|YP_003554025.1|  erwgtqvllgnghinpsvvasivfsdmteyewvcdmihpfvriemerkvaslqgwviaeipllf
gi|294101458|ref|YP_003553316.1|  vvviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltdkntrvvf
gi|294102320|ref|YP_003554178.1|  ergtekytniiideahrfrtettityeklaeicrgkrvilvtatpynnspkdilsllklfqkgq
gi|294101940|ref|YP_003553798.1|  rlfmrelevstnalhglikvnsprirearegmkkhlnrlevvgeesgqrwtidrlekhvalrip
gi|294102120|ref|YP_003553978.1|  vkdadcvaiddlgaqrkdkswvderlfslidaryrsgkqtiittnacsmsqlkemlgehgtriv
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  tltkgdktyndpanqvkgtlftveyydhpslefrkhnskannryaikpyygknrgdtlpfcpvi
gi|294101830|ref|YP_003553688.1|  glaavvdvrggrllndlfsvvdslkgtiplvqvlfldssdeslvrrfettrrrhplgdhipvle
gi|294102042|ref|YP_003553900.1|  rcwnlal.........................................................
gi|294102015|ref|YP_003553873.1|  smaaierimnrgkiplfvggtpfyyhalfegvltkdlprdrkltdelekfaskhgnqalhdqls
gi|294102787|ref|YP_003554645.1|  ieslkgerfslvmngrnstfsgarngtsledllgyvdremyerifsvgledmqkirplndrgiq
gi|294102032|ref|YP_003553890.1|  plainlpagkgkemgsafeellselkiaiskafeksqyedakaqlvknfqeqvnglmeevrawa
gi|294102010|ref|YP_003553868.1|  tpkvdwalhdestrllmdiggdaegalalkqfepiikkvgyrlilvvnafrpqtasvtriqkmm
gi|294101586|ref|YP_003553444.1|  ekpgeisiydiqnrigsnfdillleggksfpchkiw............................
gi|294101458|ref|YP_003553316.1|  yqeysqkerlkskwarleaivgteqrikqiakdivehfekrdlaqeneggkgmivamsrriaid
gi|294102625|ref|YP_003554483.1|  gehgwplgetwdilrepclagreiatsppadiftlnekgwigflehaapergldsfkkmclfvk
gi|294102478|ref|YP_003554336.1|  lasrlphvpvavsrdrlkdvealqkhnvelivaddafqhrrlgrdvdivlvdaccpfgngrlvp
gi|294101874|ref|YP_003553732.1|  evvsflekqapctvmiiatstamalkivrilnlpqperfi........................
gi|294102071|ref|YP_003553929.1|  i...............................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ktngvpresgfditvasevmailclsesikelkerlaqivvaytydgtavtagdlnaqgsmavv
gi|294102529|ref|YP_003554387.1|  lggkadgvpresgfditvasevmailclsanikelkerlskivvgytyngtvvtagdlnahgsm
gi|294102437|ref|YP_003554295.1|  geygattgrprrcgwldmvalkyavrvngmssialtkldvltgfekikicthyevngekhenyl
gi|294102168|ref|YP_003554026.1|  rrkknlwtardmgekiyvllapneyqeadfilsemhrlhnfcgyrygdmavlyrinamsriyeq
gi|294101779|ref|YP_003553637.1|  kwdrrgfmerlidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidpv
gi|294102457|ref|YP_003554315.1|  fdrlvmrllsf.....................................................
gi|294101625|ref|YP_003553483.1|  fvnkmdrvgadfyqvvngirtrlgarsvplqlpigsedrfsgivdliqmkavffqddlgtapvv
gi|294101185|ref|YP_003553043.1|  eyrkriekdaalarrfqpvlveqpdvedtisilrglkerlevhhgvrirdnalvgaavlsnryi
gi|294102626|ref|YP_003554484.1|  qqqpskenlphfiqslieglkgasgklaneiafhlkepvsqyrnrlikeepwitvftqgfdeke
gi|294101765|ref|YP_003553623.1|  vsqrlirllcplckkpdsnspvgcsycggrgfhgrvgvfeylpitervqelllhkapvqkirtq
gi|294102479|ref|YP_003554337.1|  lvlskghivesgthdellekggiyrhlyelqf................................
gi|294101904|ref|YP_003553762.1|  pfelyanpatlfvadfigqanifkg.......................................
gi|294102557|ref|YP_003554415.1|  pielyarpsnsfvaafigkvnfmpak......................................
gi|294101807|ref|YP_003553665.1|  dltgyitegqiilsrglhrkgiyppvdvmpslsrlkdk..........................
gi|294101806|ref|YP_003553664.1|  empgeegypaylgtrlasfyeragraiclgsdgregsvtaigavsppggdlsepvsqntlrvtk
gi|294102649|ref|YP_003554507.1|  vkdvfmkpqsktaref................................................
gi|294101185|ref|YP_003553043.1|  gdgqikedareavmkelrqafrpeflnrvddvvlfkplqrheirqivkllaqelqkrlkdhrid
gi|294102868|ref|YP_003554726.1|  prniyfhaqnsfvadfigrsniit........................................
gi|294102500|ref|YP_003554358.1|  erevelevaesasmgipilggagmdsmgmninemlsgllpkktkkrrmkvsdgkkllqaeeaek
gi|294102409|ref|YP_003554267.1|  enllkmpglfsdaansdlahrivqavkahvlfqkdvhyvvkdgeiiivdeftgrlmfgrrysdg
gi|294102354|ref|YP_003554212.1|  tlddikkqlsdkavpfflpigkeasfkgvvdilnqkayeyvtdgsgsfkeisipaemvdevsaa
gi|294101565|ref|YP_003553423.1|  tslgfsisgeadgyfdwdktksdildavqktfrpefinrvdemvvfrplskkemlvivdimlsd
gi|294101424|ref|YP_003553282.1|  qdimvkpahprtqaf.................................................
gi|294101976|ref|YP_003553834.1|  yitegqivldrgihdrgayppinvlpslsrlmnk..............................
gi|294101061|ref|YP_003552919.1|  pdkllntpqyertrqf................................................
gi|294101048|ref|YP_003552906.1|  paqilanpadeyvarfvqdk............................................
gi|294101977|ref|YP_003553835.1|  geegypaylgtrlaqyyeragrakllglperegsvtvinavspaggdfsepvtqaslrlsgafw
gi|294101084|ref|YP_003552942.1|  dvlfetpqnkrtkaf.................................................
gi|294101565|ref|YP_003553423.1|  iekdaalerrfqpvmveepsvddtisileglrdryeshhrvkisddalvaaarlssryiterfl
gi|294101786|ref|YP_003553644.1|  dskklfknpvhpytktl...............................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  pgmgddiqimkagimeiadifvvnkadrpgaekietevklmldligktdwfppihmtvaekgdg
gi|294101894|ref|YP_003553752.1|  fagieevigrrvnkkmigfggdilsvkehrnyelmrqvqpedlmafgfipeligrlpvvvplee
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  gntilfkdplhpytqal...............................................
gi|294101376|ref|YP_003553234.1|  lkevepsa........................................................
gi|294102641|ref|YP_003554499.1|  dirqlyskpmhpytqg................................................
gi|294101359|ref|YP_003553217.1|  egvshviqmglpdnretfvhrsgrtgraghegrnllvlspkea.....................
gi|294102459|ref|YP_003554317.1|  ffgaarnieeggsltvigtalvdtgsrmddviyeefkgtgnmelhlsrklaeqrifpavditks
gi|294101785|ref|YP_003553643.1|  tvheifknmrhpyti.................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  riiasynl........................................................
gi|294102442|ref|YP_003554300.1|  g...............................................................
gi|294101577|ref|YP_003553435.1|  pdevaqsevarkfy..................................................
gi|294101171|ref|YP_003553029.1|  peeiqansevlkaylge...............................................
gi|294102413|ref|YP_003554271.1|  lliehdmkvvmgiceyiwvldygkliaegnpdeiqsnprvieaylge.................
gi|294102187|ref|YP_003554045.1|  elpvraireqissgidlivhqerlkdgtrr..................................
gi|294102332|ref|YP_003554190.1|  gq..............................................................
gi|294102831|ref|YP_003554689.1|  slglltinalvaahklvvpiqceyyalegvgqlahtiglvrdclnpdlavdgvlltmydsrtrl
gi|294101321|ref|YP_003553179.1|  meirellskydfpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapqretdkp
gi|294101626|ref|YP_003553484.1|  meirellskydfpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapqretdkp
gi|294101069|ref|YP_003552927.1|  iryilardeis.....................................................
gi|294102759|ref|YP_003554617.1|  gapadivtkprhrhttq...............................................
gi|294101055|ref|YP_003552913.1|  fildgeiieagptkdlfenp............................................
gi|294101254|ref|YP_003553112.1|  ekt.............................................................
gi|294102760|ref|YP_003554618.1|  ensteallsapkhaytralv............................................
gi|294101659|ref|YP_003553517.1|  elfrhte.........................................................
gi|294101172|ref|YP_003553030.1|  siimagtsedllnsadirnaylg.........................................
gi|294102017|ref|YP_003553875.1|  lfathyhelvaledhlnglknlsmavhegergisflykvvdgpadrsygievarlagippavlk
gi|294101748|ref|YP_003553606.1|  fgvmhkeklkdtregldvltlsatpiprtlslslrglrsfsiistpp.................
gi|294102409|ref|YP_003554267.1|  ai..............................................................
gi|294102070|ref|YP_003553928.1|  dtleaadklgdemrkrvrdempflshapllfvsaltkrglnkltqtiknvqenrsrrigtteln
gi|294102390|ref|YP_003554248.1|  hrfgvlqknalrakganegqaphilvmtatpiprtltlsvygdlsvsvidempp..........
gi|294101403|ref|YP_003553261.1|  msyalrrltsaisrsncvvvfinqlrakistgyssgpqetttggralkfyssvrvevkrgksin
gi|294101730|ref|YP_003553588.1|  hkvpvtirsrcqhipfrkidvqnivkslsmvahnenrnaeeealweiarqadgamrdalslleq
gi|294102602|ref|YP_003554460.1|  nkvdrphanpmsalnqtfdlfielgaaeeqldfpvlygsgldgwavrdlnkyahegmkhlfeti
gi|294102663|ref|YP_003554521.1|  mgelieygktpklftspg..............................................
gi|294101436|ref|YP_003553294.1|  dpardwnivemeliyrdlgvidnrlsrlaakkrllpeeeeekkllercqaflmeekplrelgls
gi|294102150|ref|YP_003554008.1|  ipvinkidlpsahpesvqkeieevvgidadgailasakegigiqdilerivaqvpapegdteap
gi|294101607|ref|YP_003553465.1|  ealvvttpeipsvrdadriigllesmekkpirlvinrvkpsmvkegemldvqdvldvlaielig
gi|294102035|ref|YP_003553893.1|  dqvidilkkrppfvevvltgrnppvalleyadlitemkeirhpfqkgitgrrgiey........
gi|294102412|ref|YP_003554270.1|  levgsivlsgpgedllknprvkeayl......................................
gi|294101660|ref|YP_003553518.1|  apgkiieels......................................................
gi|294102549|ref|YP_003554407.1|  mrkgkhiatlprseat................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  itlpsekprnldsseyiaik............................................
gi|294101433|ref|YP_003553291.1|  tspqelsvmvvekalnmtkmmevpllgavenmsyvtcpdcgkaievfgpshvkeieekfslpvl
gi|294101963|ref|YP_003553821.1|  lvaemeelradp....................................................
gi|294101356|ref|YP_003553214.1|  iregkileypgnysyfiq..............................................
gi|294102542|ref|YP_003554400.1|  s...............................................................
gi|294101861|ref|YP_003553719.1|  vdetseivqrgakvlgieieeeaayeiarrsrgtprvairllkrvrdvaevrqspsintavasv
gi|294102400|ref|YP_003554258.1|  msfarridskqqevaeisralkgvareldvpvialsqlsraveqrnekmpqlsdlrdsgaieqd
gi|294102043|ref|YP_003553901.1|  tdgflnrvcegykelskrfphrivridgsqpteevsaqiwkvvevhls................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  saaavkry........................................................
gi|294102040|ref|YP_003553898.1|  ngvilskydntakggvilaiahrlalpiryiglgesvddlrlfepqefvralle..........
gi|294101613|ref|YP_003553471.1|  pqqrrsilealfgidqyrkkredanqklkfaseelarletlvseltsrrdeiaamvtiaekarr
gi|294101367|ref|YP_003553225.1|  iaivfishrlhevidvcdkivvlrdgqvvhettpak............................
gi|294101893|ref|YP_003553751.1|  rnlqrslatlcrkv..................................................
gi|294101841|ref|YP_003553699.1|  nkidierghenapaiesfmkarnipyyntsaitgegiaefmgnivalcrehtrphsei......
gi|294102070|ref|YP_003553928.1|  ddlmdmavsllpsdeee...............................................
gi|294102221|ref|YP_003554079.1|  esignpydvivfdtaptghtlrlitlpeilgiwiehliekranamelmkvaakydkdlqekike
gi|294101356|ref|YP_003553214.1|  rislaamllsspdillldeptnhldtesmewledwllnfngtliaishdrhfldkictstaels
gi|294101345|ref|YP_003553203.1|  vmspshsftvgipedl................................................
gi|294102145|ref|YP_003554003.1|  eellelaiadvtdfvqgtflegkvvvpvssvtnknipllmeelaklidrvqprtrrgpffmpid
gi|294101756|ref|YP_003553614.1|  nkidqvqqserrlmavaslfkeklpivgalgvsakkgynidklvqilkdklpagfpwydeeilt
gi|294102549|ref|YP_003554407.1|  lprkeasr........................................................
gi|294101372|ref|YP_003553230.1|  seemingllpqspvfvisaekregiealkdai................................
gi|294101016|ref|YP_003552874.1|  irelegalnri.....................................................
gi|294101780|ref|YP_003553638.1|  vdvifrnypdqrleilspqvrgkkgefknlfaqnrekgfmrvrvdgtiywleeeialdknkrht
gi|294101686|ref|YP_003553544.1|  mirgtknrygntdelgifemtekgl.......................................
gi|294102507|ref|YP_003554365.1|  wagdpvescscsayekeryskrlsgpildridlhvsvprllpkelisfedqsgedsetvrqrvc
gi|294101471|ref|YP_003553329.1|  eahvksiavlfishdevllnalcsriirl...................................
gi|294101845|ref|YP_003553703.1|  qrdildsyggeeiiclknelrsvfsnallkekelrsvekkqkevidryenansilqsfksispe
gi|294101553|ref|YP_003553411.1|  fheklsltgvvlskldgdarggaalairattqvpikfagvgegidaielfdakrmaqriigmgd
gi|294101853|ref|YP_003553711.1|  qkdvedyicrlaqmaratgihlllatqrpsvnvvtglikaniparvaftlpsqadsrtiidvsg
gi|294101780|ref|YP_003553638.1|  agsvkvsmlflpdvyvdcevcggtrynretlevrykgrniadvlnmtvddafeffkeipriask
gi|294102079|ref|YP_003553937.1|  mgtvvfpdatikiyltasdsvrakrrhlqllergekvsfdevlrqiqnrdqfdsnreiaplcqa
gi|294101472|ref|YP_003553330.1|  gqtgvlfsgllvesgdsqivlqhpshpytqgl................................
gi|294102235|ref|YP_003554093.1|  edlvkrvkdrfengvsl...............................................
gi|294102390|ref|YP_003554248.1|  dlrlrgpgevcgvrqhgitdfrvadllkd...................................
gi|294101443|ref|YP_003553301.1|  dlvqilykalkdeekglgalklavsedvitvlakmaggdarqaltrlellassvaasgaaeltm
gi|294101748|ref|YP_003553606.1|  rfeaisafsdigsgyslalqdlqirgsgdiigvsqhgqdervgyrfyykmleeeiar.......
gi|294101649|ref|YP_003553507.1|  rlcgrrmcrqcgeiyhvtfkpssqgmrcekcggelfqrdddketvirsrlkvyhdqtaplisyy
gi|294101715|ref|YP_003553573.1|  itlatthhnpiksyalttphvetasmefnvetlaptyhllmgipgrsnaiyiaerygmpsevlq
gi|294101925|ref|YP_003553783.1|  estkkdeqkretkyeinkgdyenligaeftshlttannqpphvsqhkdfysyekkllarlkdsr
gi|294101367|ref|YP_003553225.1|  vmisseleelrsicdriaivnegkiagt....................................
gi|294101751|ref|YP_003553609.1|  ttpeqmkmfltrlgfgskavvtgditqidlpsgkksgliqvreilegikg..............
gi|294101046|ref|YP_003552904.1|  tapttsilvmsatfsqpgvigryletitersftvyesqervtdlvyvpkkpaqlfsvhdalvfv
gi|294101779|ref|YP_003553637.1|  ekwdrrgfmerlidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidp
gi|294101226|ref|YP_003553084.1|  pearkghippl.....................................................
gi|294101892|ref|YP_003553750.1|  glksievpfivsaqdksgvgefrqfltqyl..................................
gi|294102315|ref|YP_003554173.1|  gsfrcpsekiindhdlflekvqnttstllsllniesdplsgrehlliskifeqswrngkdvdlp
gi|294102188|ref|YP_003554046.1|  ekiqreygvkgllpfdeklekgwlkgeplilsqprspyskvireiaselvgke...........
gi|294102320|ref|YP_003554178.1|  kfkkelstnatlqknhliiftesketanylfeeinkeypkkvllftgdskeavrdkvianfdar
gi|294102169|ref|YP_003554027.1|  dkplkyphlfseakavlltkmdlapyvpfdmdlykndlqhlnprvecieiealngkgidrwvsl
gi|294101254|ref|YP_003553112.1|  sedleellslsdrlavifkgeimgildhpe..................................
gi|294102077|ref|YP_003553935.1|  idkidlslipflqtrlqgrskakvlpicalsgvgvtellqevey....................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  lgfmrhdyrsscllplladsavvfdeihsfdqtlfsallgflrefnvpalcmtaslpinrldql
gi|294101018|ref|YP_003552876.1|  sdcrralrhrvillrerkdpsltskvlaplvswiwstraaavdllkigiqefrillpsdivltf
gi|294101692|ref|YP_003553550.1|  skgaataesflsnreeeqgvlrdelssvqeegrklfellevsiadgvlipvrneelyrcgllvs
gi|294101032|ref|YP_003552890.1|  imniknqesfwflegildigepnpvplihavlkkadslpfpqivdgppgnacpmvaaveqsnfv
gi|294101031|ref|YP_003552889.1|  tttygplwharlhageensgmlvarlkkesrkealkegvpfividgppgiscpaisaltgatla
gi|294101431|ref|YP_003553289.1|  ldehnrtsttdnrllrrmirdyrtrghsaertldlwpsvikgareyifpyqssavamfnsslpy
gi|294102167|ref|YP_003554025.1|  enripwwvdlsvyvtapldlrlarnevrgwnkeeierrerflrnaeekraeadlvirndssidt
gi|294101458|ref|YP_003553316.1|  gdyidiydmtravedgttvkifyesriakldlpeemkp..........................
gi|294102320|ref|YP_003554178.1|  kstipnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylmvrrtraeie..
gi|294101940|ref|YP_003553798.1|  slvvidyltllkrpgqsdleaveevmprlktltqrlkirtlilsqlgraskldqrkgatgghak
gi|294102120|ref|YP_003553978.1|  srltema.........................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ylglgrlfpfgefqndeairgvkgelpstyqdeiktfyedftgisiessspqqmgdfktradfi
gi|294101830|ref|YP_003553688.1|  giqkerallapvreyadvvldtsglsirglkdrliae...........................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  aidpkrasqlhvndvr................................................
gi|294102787|ref|YP_003554645.1|  srffsagaglgtaslptflaslsnqekalyriqggarssaeinvflkkiqetkeqikllqqqkd
gi|294102032|ref|YP_003553890.1|  gekgfalkrtpqgfvnipmieettesgdvskrelqqeefeslseekqkelqgkseeisqrtldt
gi|294102010|ref|YP_003553868.1|  kkmesicglevgalisnshlmh..........................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  lykeivalrpdwhsddlmsgkikvvitgsssdpsdwqafigskadretlakrmkdrndelklvi
gi|294102625|ref|YP_003554483.1|  tikkggtpveilsalyslaaenpswgkelslwamdhpefdesirrlqaalretehkveslgelq
gi|294102478|ref|YP_003554336.1|  agilreppkaiqrahivvitkadqvs......................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  lkdalkpnlvqtlehvpafvhggpfaniahgcnsiqatkyglklsdyfiteagfgadlgaekff
gi|294102529|ref|YP_003554387.1|  aallkdalkpnlvqtlehvpafvhggpfaniahgcnslqatkyglkladyfiteagfgadlgae
gi|294102437|ref|YP_003554295.1|  tntsllakaspvyttldgwkedisgcrdfeklpeaarryveyieketgvpvqligvgpgrsqti
gi|294102168|ref|YP_003554026.1|  kciekgvpyrvvrgtafydrkeikdvlsfmrlavnpldgaslgrianvptrgigkksqeklmeg
gi|294101779|ref|YP_003553637.1|  sghtlkqlpkasifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtrydm
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  geipgelmadvkkardllienladfdesvmesylegqdvpeetlrrairentiqqrivpvlcgs
gi|294101185|ref|YP_003553043.1|  tdrflpdkaidlvdeacamirteidslpaeldaasrkvmqleieeaalkkekdaaslerlsvlq
gi|294102626|ref|YP_003554484.1|  qayrscllgfsailwqlwdefrrrknrlsfddmiryamealehspsyaerfkeilvdefqdtnp
gi|294101765|ref|YP_003553623.1|  arkegmrtlvengmlkverglttyeeil....................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  vfwgldaslayqrhfpainwllsyslytdt..................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  lelseeavdyiadagydpvfgarplkrfivkqletrmarslvagevregskvyvtvkdkalaf.
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  lidmesvarealdkaqeegiifideidkvvargtssgpdvsregvqrdllpivegstvqtkygt
gi|294102409|ref|YP_003554267.1|  lhqaieakekvrvgresqtlatitlqnyfrmyrklagmtgtavteseefkeiygldvivvptn.
gi|294102354|ref|YP_003554212.1|  resliesvveaddevmmmylegdeisheeivkvarkairerqifpvlpasgtanigvhqvldfl
gi|294101565|ref|YP_003553423.1|  vrerlryqdidikvseeakafilekgynprygarplrrkiqqliedrmadmllegkikkgslvs
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  aldkrlaqqrhfpainwqqsytlyegs.....................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  pdkaidlideaaararlktmeipanlkdiehdleevrkekeaavtsqefekaarlrdterkise
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  vaelvegiekhgaflkqsihgikkqkrklaeeikdilsrdiaknv...................
gi|294101894|ref|YP_003553752.1|  ldddalarilvepknalirqyqktfeiegvklffeqdaikaiakearkkntgarglrsimeylm
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  gtrreell........................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  andvveevrrqfgeivfstivprnvklseapshampiayyeptctgakaymnfsmevaerwl..
gi|294101321|ref|YP_003553179.1|  flmpiedvftitgrgt................................................
gi|294101626|ref|YP_003553484.1|  flmpiedvftitgrgt................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  rafhlletfe......................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  rlirdvlafqtlptsrkgrvlkiyyctqtsiepptfvffvndpeivsqsfnkhienkiremdtf
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  kgedaighelwmkvvknkqappfrtahasliygkgv............................
gi|294101730|ref|YP_003553588.1|  vma.............................................................
gi|294102602|ref|YP_003554460.1|  aeyvpapkvnlhap..................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  edeqrklsgfafltlkpemivlnldetqteghvpgldaimsiakerglglvqvfgrmememadl
gi|294102150|ref|YP_003554008.1|  lqalifdsvynnyrg.................................................
gi|294101607|ref|YP_003553465.1|  ivpdddsvvksanrgepltsgdtslasmafsniadrllgkev......................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  gkfpldlelshlgdqgr...............................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  alnm............................................................
gi|294102400|ref|YP_003554258.1|  adlvmllyrpgyydtaaspeeednratiriakhrngptgdvnlvfl..................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lldeldekrrgyyfsrraflerelysfqsrihalerrknraaewetiwkeglsfyqslfnsyeq
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  dpiidtlqarrdkfalarkiltdkkntafyfvlnaeklpiietkraieilqkhdigiggvivnk
gi|294101356|ref|YP_003553214.1|  qgaislykg.......................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  rafpisgfgt......................................................
gi|294101756|ref|YP_003553614.1|  drperflageiirekvlllth...........................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ievvidrlkvlddrkgriseaveaalslsggyvllvteggkeqlltenyacpdcgislpeiepr
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  earekqrlrwrkygfhcnaelperiikrelnlgtdvrpflirmadnlrlsgrgisrvlkvarti
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  snseaiwegrlerisksidehtkleqilarltggktgegiadsienlcleltqiispdtekgsk
gi|294101553|ref|YP_003553411.1|  vmglaekvqqvtsqedvakitkslkkdkltmedlllqfeqieklgpldkvidml..........
gi|294101853|ref|YP_003553711.1|  aekllgkgdmlfvsprfpkpvrlqspyiedgksle.............................
gi|294101780|ref|YP_003553638.1|  laliqeaglgyirlgqsaltlsggeaqrvklakelskrftgptlylldepttglfytdvkkllh
gi|294102079|ref|YP_003553937.1|  sdaifvdtssmtedevvdylvrlvke......................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ah..............................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  dekgllrkvnagtssssvmaeiealv......................................
gi|294101715|ref|YP_003553573.1|  karatlkeq.......................................................
gi|294101925|ref|YP_003553783.1|  fnfmfhpgdykdassskdlhnllnewigsenklaildlsgvpfevldiaiglitrfvydsmywg
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  fsqrgtmdlaytiartrrrlpreqrsrlyelatildvpkvqmpllcgigiyhgsmlpkekllve
gi|294101779|ref|YP_003553637.1|  vsghtlkqlpkasifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtryd
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  miingiqtppfaqigvmptdtfyppserfklalalnqilaspafnqwmtgvpleigsflhspeg
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  arskkgdyrilistevlsegvnlhrsnvvvnydipwnptrmmqrvgrinrvdtpfdvihtfnff
gi|294102169|ref|YP_003554027.1|  vetwlke.........................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  reaglkifpesiasfpdlkekasamryrvkqckkeealeealkaykngekvlwvvntvkrcqei
gi|294101018|ref|YP_003552876.1|  erggaldlqdpmqdywesvrkwrekehitgvpqvgpqrddmiittkgqsvsivmsrgqrrrtav
gi|294101692|ref|YP_003553550.1|  shietalkmlrsieelcnekpydvddgplalalawieevrlfshslqwclavghfpewaywreg
gi|294101032|ref|YP_003552890.1|  ilvteptpfglsdlalatetvrelhipagvvinrsdlgnieeaeifcknlalpilarlpfskev
gi|294101031|ref|YP_003552889.1|  vavtepslsglhdllrlsklcasldvplaivlnksdlseakgeeikneakkenwhflgsipfrp
gi|294101431|ref|YP_003553289.1|  elavlrgyaqpllqtvpesssmhgearrllsmlkfvpplpsenvpsnsilrefigggc......
gi|294102167|ref|YP_003554025.1|  leqslsr.........................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  gggiveelvhseieiqkdgldkngqprliatitkarhgtkgsfeleyig...............
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  sdvegidsntisagednlfilltaiislkyyyeatalshevtsillvdeidatlhpsilykllk
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  eylqkkeelektghqiesarknleairydlslmewvekarspwvemteaqrkleeigevlffpd
gi|294102032|ref|YP_003553890.1|  lrkirdlekalkeeigkleaeicrsaitpylqdvkekygtteilckwidalaediisnfnifva
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  vrdmwltgfdvpsmhsmyvdkpmsghnlmqaiarvnrvfkekqgglvvdyi.............
gi|294102625|ref|YP_003554483.1|  drigpagqvrfsgseavsflhhwtsmatiwlppaikgalslfigtppvleknslwimpnitasi
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  dikcregnlhpsavvivatvralkmhggvakseltgenlealskgipnlekhienmqgfgvpvv
gi|294102529|ref|YP_003554387.1|  kffdikcrignltpsavvivatvralkmhggvakneltgenlealskgipnlekhienmkrfgi
gi|294102437|ref|YP_003554295.1|  lr..............................................................
gi|294102168|ref|YP_003554026.1|  lgaipemeaeqlwravadgkdlgltgkakigamelgrhmfniikrsgsfhdvllyildsieyed
gi|294101779|ref|YP_003553637.1|  emlaevgycsgienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdrark
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  afknkgiqllldavvdylps............................................
gi|294101185|ref|YP_003553043.1|  kelqeareeadalraqyesekeviskvrkmreeidavkreiekaereydlnkaaelkhgrlpel
gi|294102626|ref|YP_003554484.1|  lqdrliqavrshsqrlfivgdlkqsiyrfrhadlslfgsyikkakyghgdyilldtsfrskeil
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  vktdhilfiaagafssvkpsdlvpelqgrfpirvelqplgreelarilvepenslikqyqalls
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  gdmfps..........................................................
gi|294101565|ref|YP_003553423.1|  idedk...........................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  eleekkkdwqsrryqekplvsfddiativsewtnipvtqlteeetqrllrm.............
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ldlmyeipsrsnevekiiitkevvek......................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  dgtplrlywr......................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  sedeqrefmadlgikeagrerliqeaysllglisffttgkdevkawtlkkdata..........
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  qkkvheerteslgfqretlrrqcfataltvksarerliaqkeekrhveevlskvdeeatlargt
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  vipeeagpffekrrvdqeqylkqidemfggfgvariplldsdikgieql...............
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  lfsfnnpygacpdcsglgshehfseehaidpvrsveegallpwkkkhymlrklytfsqskewdl
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  adldnssrvrvphisealay............................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  yqelgnnalvflqklsqsltvllseqslsdlyaeqeeienklgtlrklkrlagvrtleeltnyc
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ilhrivdqgntvvtiehnldvllssdyiidlgpeggmeggs.......................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  kyesytgknrplllayeeahtylnkndnnsysknaverifkegrkfgvgalvisqrpseiseti
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  safrerildvvvgtnalalgvnlpaesvifaqlvqfhdnapiskneflqmagragrkglfdtgy
gi|294101779|ref|YP_003553637.1|  memlaevgycsgienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdrar
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  kprasiftvshlsdnermffismvlneivgwmrtqtgtpslrailyidevfgymppvkeppskk
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  pttqsndqiklkeaaegkinafltllggdaellt..............................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  amelqesfaenllcyhsrfrlkdrqkwhkkliekfrdpepmiaittqvcemsldlsasllisef
gi|294101018|ref|YP_003552876.1|  almlaagwaverklrrkpllildeiaaelddrgrnilidalvesswqvfaata...........
gi|294101692|ref|YP_003553550.1|  dalvseptlcsdkvsegilsqkaekiiaisatmtvegsfdfwkretgiiptdtyvlespfdlek
gi|294101032|ref|YP_003552890.1|  arayakgiapilidkqwqeaasdilnhvkevl................................
gi|294101031|ref|YP_003552889.1|  nvveaiskkeiplea.................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  lfedysnrykiqiictshslsliefalarkynviylldn.........................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  egllrfkkiheeegarereleelvfqcrnldkqlqafhipsiqkvleqkgairalaqnrnriek
gi|294102032|ref|YP_003553890.1|  aakdesteidfsrytinvfvandpengvpviwetnptyynltgkveyesrqgylytdfhkivsg
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  wpgkmsessllpdrhklalhdltgterghlpllkekrdqrealfrrlvacgedllilsspstda
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  vainrfptdteaelklvhercaafgvpvalseiwakggeggielaerileavekpnsfhplydv
gi|294102529|ref|YP_003554387.1|  pvvvainrfptdteaelelvkehcvalgvqqvlsevwakggeggielaervleavekpntfhkl
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  qlkkddpegweervenirelgslvtsggdlaevlaevalftdlettdmddleavnfltlhaakg
gi|294101779|ref|YP_003553637.1|  ttlvengfrlpscldnrplnwrefkkylrqvifisatpgdwerevstcvaeqiirp........
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  qqqlkkeegahaagqegdqllreevtedeiaeivsrwtg.........................
gi|294102626|ref|YP_003554484.1|  vhevndlfssvwkdglgqelplpfeslevphylsthelrqqctvdpfltyleggkegekirear
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  terievrfsedaieeiaamaekmnaemenigarrlhtmveqlleeisftaperqgevvdinaqf
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  sysltqnlhkkkeevsalwqklsnlrsslraerqrrqeygneyarvegecvkilsrlqarseal
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  tqpygtlpknvqnfilygsderlpmffsdrgerhqymgryegllpwlegrwnetesenvleela
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  keaemnltwlnesyrrseqsgaeakklrreasrlalelrkkrertarsleeavnhslrdmamed
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  laqvgtlialrltnsgdqsivkssspdnlnslidllpslrigeavivgesikipsrirvklnnp
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  vtwl............................................................
gi|294101779|ref|YP_003553637.1|  kttlvengfrlpscldnrplnwrefkkylrqvifisatpgdwerevstcvaeqiirptgvvdpe
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  plitllkqarafgigvvlatqnpvdldykglsnigtwfigrlqtqrdkdrvleglerlenasgy
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  apvtsliqrmgrcnryleiceggrilly....................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  qmkilvvdlglkviekgydervcrvverlcndnggsslvllssmrlvkkvgnwlkgsqhpytvy
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  eeeiiqnlsldilsmkqrldrevreihqswtiddlesldlsfgvsqkagdlekqkedfrnqhvi
gi|294102032|ref|YP_003553890.1|  afqkanggylvldaekvllnfmswealkralrtgeatienlgeqygaipisslrpqpipinvkv
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  lgkplppspflg....................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  aqspkekiekiakeiygakgvtytaqaekdleeihrlgkdnlvicmaktqasisdnpaligrpe
gi|294102529|ref|YP_003554387.1|  ydaslspkekiekiakeiygaksvaymaqaekdleeihrlgkdnllvcmgktqasisdnpalig
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  lefpvvflvgleeaifphfkclevqesleeerrlcyvgmtraeeklymsgarsrrlfgtvfrng
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  lrqirrlallfsqyyeekrtvwdkqkeclrpvqwkdmailvpsrtswfpllekiffeefqlpiy
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  vkerlsplmedt....................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  dknekeleeaknkvfvaeketetykkefeythlsykkiierhgeiyvqcqrlatslsqlkknvd
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  gyrvedicqtchgyrlrpealmvqlnhhtidelvempvdrllpvlkemefteneqkimgqvmie
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  itfsitlsdlgkikstgadeisflmasgmmppgpvmkiasggelsrlllalqlalpdsqlpgtl
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  rp..............................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  vvvspatgqvddlvdrlrgitargeralvttltkkssedlaeyladlqfkvkyihselnafera
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  drqfldkaitglkkrefllnnvhenspsif..................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  vqnelprtellerfrsdlssvligsvsfregvdvpgegltqviidripfphpkdpvvqsrnele
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  rnetceqarkardearsllktrkehvekmernvsplsvqtlrekcgslrqfftrwhqiqnqike
gi|294102032|ref|YP_003553890.1|  vmvgtpylyallqyydpeflkmfkikaefdrdmprtfeseqqmaqficgfvrnegkipftvkav
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  gfeltvrevrlsagagfiiaitgsimtmpglpkvpaamkidvdndgnitg..............
gi|294102529|ref|YP_003554387.1|  rpegfeltvrevrlsagagfivpitgsimtmpglpkvpaamkidvdddgnitg...........
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  lsrflweipd......................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  fegstsyfsrseiqdliallnflddpgkelylmsflssplsslsleevrdlaldapkgyrlqaf
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  vlenqletvlenteqrlypepvrvilaaqklgklpiqiklaaeafkceeklaapleaylggrqf
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  lekrlsflvdvgvgylslmrradtlsggesqrirlatqigsklsgvlyvldeptiglhsrdtdr
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  vfdeveaglggkaavlagyklkqlaekcrvilitheatiaalaeqhfvvarqenksfikeiek.
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  elirdlrsgevsilvginllregmdlpevslvaildadregflrshrsliqimgraarntrgqv
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  grkafvtvilpqakmflrqalgrlirsksdqgrvvil...........................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  nemnldlfrqkkelqwggaaagtlglaflgagyrtgdifflktgitaiaaslgfiivdffqkrk
gi|294102032|ref|YP_003553890.1|  aeviewagrlaehqnrvttefnkiieviveatawalsenatlvedrhvykaieekrfrsnliqe
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  qekwphlarqiddwrlmahflgpsavlasfleksdsflrafpawkrrgvaanmrkaidmarefe
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  wlfvksleeaqlgielvkqkragritflpleqchprnpdygfplpcqgtvgwatdliaseqlws
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  llrtlrsirdlgntvvvvehdretmlaadaivemgpgageqgg.....................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  vlyadvetesirtsvqetrrrreiqmlfnekhgiipqtis........................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ffnekeellcrlrknlveteeelshtveglaiecpkdylelekaemyiddcidgireydqalqs
gi|294102032|ref|YP_003553890.1|  riqraye.........................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  eaigtslpgcasylreamerqekfaepdvsnekenvirvmtvhgskglefpvlavlglertssa
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  pavnhllgdlliveeydvgmnlaragasfpivtlqgdvftvggsvsggkfrktggaierrlqie
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  qrdaeeelgrrqrkledcesslnsikklldqtdaewksfveekgfsaslkvehwtefeslvkql
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  gekgslmpspkmgvalsripgernsgqaplawslsrlfeeqeeyeewqrlfyvactrardslil
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  dleknlkdkrgslervvsllqeaeelecviakerafwkekeqeaekkllshsirferqreeivr
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  rgrlaqirdmekqlsssqeyisakeeeihslfrslslgpwsklslvspidiltsrleeaeeqwn
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  cghlpwrrdg......................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lekersfflndvedsgkllkrtqhslkeleeaiasfgdfpdetelerelasakgeeavlcekvk
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  qitmiqrekkrneeiyerahkawnesrtlkkelfeqakvhdepsflelgerwqrcndlkkiien
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  sgevlinrieseaaqlterlrslsgelentelsldegldrlrelgvqsyelwenikeidserar
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  hrlsllaiaggnenltkvleelpkrtpaesqiligeskeqeqllsqqleelneerghlktride
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lsaeteslvertsllrercaeahervqieeekvkdsqrqvdsarlelnqiislwedayhypgte
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  lekdkelsalflerekleeelrlalkewlavvacrcvleqtrqkheqerqpevfkkagdflelm
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  nisleeyeeeslahvrrlekkvrelgdydlgvlseneslknrlafltvqiedvhggigelqsli
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  tegryslistaseeggfsveleeksgflrkkedvwssgladqvylsirlalaelygkrmeplpl
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  qstdervgllfgealkntderfnslfqrlfgggeahleleeglslweagvdifarppgkrlqnl
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ilddvfvrfderrqigaarvvldvasrgqillfscrrd..........................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1htwa_                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  aqlsggeqsltaiallfatmevaevplaildevdasldeynllrfidlvsdyamhmqilamthr
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                         
                                                         
d1htwa_                             .....................
gi|294102520|ref|YP_003554378.1|  .....................
gi|294102529|ref|YP_003554387.1|  .....................
gi|294102437|ref|YP_003554295.1|  .....................
gi|294102168|ref|YP_003554026.1|  .....................
gi|294101779|ref|YP_003553637.1|  .....................
gi|294102457|ref|YP_003554315.1|  .....................
gi|294101625|ref|YP_003553483.1|  .....................
gi|294101185|ref|YP_003553043.1|  .....................
gi|294102626|ref|YP_003554484.1|  .....................
gi|294101765|ref|YP_003553623.1|  .....................
gi|294102479|ref|YP_003554337.1|  .....................
gi|294101904|ref|YP_003553762.1|  .....................
gi|294102557|ref|YP_003554415.1|  .....................
gi|294101807|ref|YP_003553665.1|  .....................
gi|294101806|ref|YP_003553664.1|  .....................
gi|294102649|ref|YP_003554507.1|  .....................
gi|294101185|ref|YP_003553043.1|  .....................
gi|294102868|ref|YP_003554726.1|  .....................
gi|294102500|ref|YP_003554358.1|  .....................
gi|294102409|ref|YP_003554267.1|  .....................
gi|294102354|ref|YP_003554212.1|  .....................
gi|294101565|ref|YP_003553423.1|  .....................
gi|294101424|ref|YP_003553282.1|  .....................
gi|294101976|ref|YP_003553834.1|  .....................
gi|294101061|ref|YP_003552919.1|  .....................
gi|294101048|ref|YP_003552906.1|  .....................
gi|294101977|ref|YP_003553835.1|  .....................
gi|294101084|ref|YP_003552942.1|  .....................
gi|294101565|ref|YP_003553423.1|  .....................
gi|294101786|ref|YP_003553644.1|  .....................
gi|294101493|ref|YP_003553351.1|  .....................
gi|294101884|ref|YP_003553742.1|  .....................
gi|294101894|ref|YP_003553752.1|  .....................
gi|294101778|ref|YP_003553636.1|  .....................
gi|294102313|ref|YP_003554171.1|  .....................
gi|294102640|ref|YP_003554498.1|  .....................
gi|294101376|ref|YP_003553234.1|  .....................
gi|294102641|ref|YP_003554499.1|  .....................
gi|294101359|ref|YP_003553217.1|  .....................
gi|294102459|ref|YP_003554317.1|  .....................
gi|294101785|ref|YP_003553643.1|  .....................
gi|294101376|ref|YP_003553234.1|  .....................
gi|294102074|ref|YP_003553932.1|  .....................
gi|294102442|ref|YP_003554300.1|  .....................
gi|294101577|ref|YP_003553435.1|  .....................
gi|294101171|ref|YP_003553029.1|  .....................
gi|294102413|ref|YP_003554271.1|  .....................
gi|294102187|ref|YP_003554045.1|  .....................
gi|294102332|ref|YP_003554190.1|  .....................
gi|294102831|ref|YP_003554689.1|  .....................
gi|294101321|ref|YP_003553179.1|  .....................
gi|294101626|ref|YP_003553484.1|  .....................
gi|294101069|ref|YP_003552927.1|  .....................
gi|294102759|ref|YP_003554617.1|  .....................
gi|294101055|ref|YP_003552913.1|  .....................
gi|294101254|ref|YP_003553112.1|  .....................
gi|294102760|ref|YP_003554618.1|  .....................
gi|294101659|ref|YP_003553517.1|  .....................
gi|294101172|ref|YP_003553030.1|  .....................
gi|294102017|ref|YP_003553875.1|  .....................
gi|294101748|ref|YP_003553606.1|  .....................
gi|294102409|ref|YP_003554267.1|  .....................
gi|294102070|ref|YP_003553928.1|  .....................
gi|294102390|ref|YP_003554248.1|  .....................
gi|294101403|ref|YP_003553261.1|  .....................
gi|294101730|ref|YP_003553588.1|  .....................
gi|294102602|ref|YP_003554460.1|  .....................
gi|294102663|ref|YP_003554521.1|  .....................
gi|294101436|ref|YP_003553294.1|  .....................
gi|294102150|ref|YP_003554008.1|  .....................
gi|294101607|ref|YP_003553465.1|  .....................
gi|294102035|ref|YP_003553893.1|  .....................
gi|294102412|ref|YP_003554270.1|  .....................
gi|294101660|ref|YP_003553518.1|  .....................
gi|294102549|ref|YP_003554407.1|  .....................
gi|294102841|ref|YP_003554699.1|  .....................
gi|294101272|ref|YP_003553130.1|  .....................
gi|294101433|ref|YP_003553291.1|  .....................
gi|294101963|ref|YP_003553821.1|  .....................
gi|294101356|ref|YP_003553214.1|  .....................
gi|294102542|ref|YP_003554400.1|  .....................
gi|294101861|ref|YP_003553719.1|  .....................
gi|294102400|ref|YP_003554258.1|  .....................
gi|294102043|ref|YP_003553901.1|  .....................
gi|294101077|ref|YP_003552935.1|  .....................
gi|294102348|ref|YP_003554206.1|  .....................
gi|294102040|ref|YP_003553898.1|  .....................
gi|294101613|ref|YP_003553471.1|  rstmeradvlygvtmdepgls
gi|294101367|ref|YP_003553225.1|  .....................
gi|294101893|ref|YP_003553751.1|  .....................
gi|294101841|ref|YP_003553699.1|  .....................
gi|294102070|ref|YP_003553928.1|  .....................
gi|294102221|ref|YP_003554079.1|  .....................
gi|294101356|ref|YP_003553214.1|  .....................
gi|294101345|ref|YP_003553203.1|  .....................
gi|294102145|ref|YP_003554003.1|  .....................
gi|294101756|ref|YP_003553614.1|  .....................
gi|294102549|ref|YP_003554407.1|  .....................
gi|294101372|ref|YP_003553230.1|  .....................
gi|294101016|ref|YP_003552874.1|  .....................
gi|294101780|ref|YP_003553638.1|  .....................
gi|294101686|ref|YP_003553544.1|  .....................
gi|294102507|ref|YP_003554365.1|  .....................
gi|294101471|ref|YP_003553329.1|  .....................
gi|294101845|ref|YP_003553703.1|  .....................
gi|294101553|ref|YP_003553411.1|  .....................
gi|294101853|ref|YP_003553711.1|  .....................
gi|294101780|ref|YP_003553638.1|  .....................
gi|294102079|ref|YP_003553937.1|  .....................
gi|294101472|ref|YP_003553330.1|  .....................
gi|294102235|ref|YP_003554093.1|  .....................
gi|294102390|ref|YP_003554248.1|  .....................
gi|294101443|ref|YP_003553301.1|  .....................
gi|294101748|ref|YP_003553606.1|  .....................
gi|294101649|ref|YP_003553507.1|  .....................
gi|294101715|ref|YP_003553573.1|  .....................
gi|294101925|ref|YP_003553783.1|  .....................
gi|294101367|ref|YP_003553225.1|  .....................
gi|294101751|ref|YP_003553609.1|  .....................
gi|294101046|ref|YP_003552904.1|  .....................
gi|294101779|ref|YP_003553637.1|  .....................
gi|294101226|ref|YP_003553084.1|  .....................
gi|294101892|ref|YP_003553750.1|  .....................
gi|294102315|ref|YP_003554173.1|  .....................
gi|294102188|ref|YP_003554046.1|  .....................
gi|294102320|ref|YP_003554178.1|  .....................
gi|294102169|ref|YP_003554027.1|  .....................
gi|294101254|ref|YP_003553112.1|  .....................
gi|294102077|ref|YP_003553935.1|  .....................
gi|294102510|ref|YP_003554368.1|  .....................
gi|294101748|ref|YP_003553606.1|  .....................
gi|294101141|ref|YP_003552999.1|  .....................
gi|294101018|ref|YP_003552876.1|  .....................
gi|294101692|ref|YP_003553550.1|  .....................
gi|294101032|ref|YP_003552890.1|  .....................
gi|294101031|ref|YP_003552889.1|  .....................
gi|294101431|ref|YP_003553289.1|  .....................
gi|294102167|ref|YP_003554025.1|  .....................
gi|294101458|ref|YP_003553316.1|  .....................
gi|294102320|ref|YP_003554178.1|  .....................
gi|294101940|ref|YP_003553798.1|  .....................
gi|294102120|ref|YP_003553978.1|  .....................
gi|294101791|ref|YP_003553649.1|  .....................
gi|294102136|ref|YP_003553994.1|  .....................
gi|294101830|ref|YP_003553688.1|  .....................
gi|294102042|ref|YP_003553900.1|  .....................
gi|294102015|ref|YP_003553873.1|  .....................
gi|294102787|ref|YP_003554645.1|  .....................
gi|294102032|ref|YP_003553890.1|  .....................
gi|294102010|ref|YP_003553868.1|  .....................
gi|294101586|ref|YP_003553444.1|  .....................
gi|294101458|ref|YP_003553316.1|  .....................
gi|294102625|ref|YP_003554483.1|  .....................
gi|294102478|ref|YP_003554336.1|  .....................
gi|294101874|ref|YP_003553732.1|  .....................
gi|294102071|ref|YP_003553929.1|  .....................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0038720 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes