SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

P-loop containing nucleoside triphosphate hydrolases alignments in Aminobacterium colombiense DSM 12261

These alignments are sequences aligned to the 0046478 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1e79a3                             v...............................................................
gi|294102520|ref|YP_003554378.1|  dieiarsakmkpivevaaqlgideeelelygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102529|ref|YP_003554387.1|  dieiaqnaelkpivevaaqlginedeleyygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102437|ref|YP_003554295.1|  veiiigaqw.......................................................
gi|294102168|ref|YP_003554026.1|  dsildklnprqqeavrycdgp...........................................
gi|294101779|ref|YP_003553637.1|  adwgpsgdqpeaieklveslkngtrfqtllgvtgsgktf.........................
gi|294102457|ref|YP_003554315.1|  tkfifvtggvvsslgkgitaaslgvllkkrgfrvsiikldpylnvdagtmnpfqhgevfvtddg
gi|294101625|ref|YP_003553483.1|  emkkirn.........................................................
gi|294101185|ref|YP_003553043.1|  tyealdkygrdlvkmarlgkldpvigrdeevrrvirilsrktknnp..................
gi|294102626|ref|YP_003554484.1|  tqpgqfkaitadaplvavsagagtgktwtlawrfiwilvtgradtneiltltftekaalemaer
gi|294101765|ref|YP_003553623.1|  ydaafpakdivdfvdriineaakngasdihieglsawsrvrfridgycravysfsldfhpaiis
gi|294102479|ref|YP_003554337.1|  hpvplgviqgaikmedvwfaykdeqwvlkgval...............................
gi|294101904|ref|YP_003553762.1|  islthltkiftkgkesfka.............................................
gi|294102557|ref|YP_003554415.1|  yikkivkdfgsyddpsnrv.............................................
gi|294101807|ref|YP_003553665.1|  t...............................................................
gi|294101806|ref|YP_003553664.1|  vietiav.........................................................
gi|294102649|ref|YP_003554507.1|  misiqnlyktypceggdfealrn.........................................
gi|294101185|ref|YP_003553043.1|  ipvtrlmegerekllkldeilhqrvigqdeavelvadavirarsgikdprrpvgsf........
gi|294102868|ref|YP_003554726.1|  lqlkqln.........................................................
gi|294102500|ref|YP_003554358.1|  ltprmivecldryivgqekakravaialrnrmrrrnlprdlanevapkn...............
gi|294102409|ref|YP_003554267.1|  pneralkryrqiaddinglepeysaksdedlrslvadfkrranegesldnllvevfalvrevsr
gi|294102354|ref|YP_003554212.1|  kpedirsv........................................................
gi|294101565|ref|YP_003553423.1|  ipvtqlteeetqrllrmeeeihcrligqeeavsavarairrarsgmkdprrpvgsf........
gi|294101424|ref|YP_003553282.1|  ievknlhksfgnlhvlqgvs............................................
gi|294101976|ref|YP_003553834.1|  k...............................................................
gi|294101061|ref|YP_003552919.1|  ilrvedihksyggvevlrgis...........................................
gi|294101048|ref|YP_003552906.1|  dksedavvavrgvslaa...............................................
gi|294101977|ref|YP_003553835.1|  engv............................................................
gi|294101084|ref|YP_003552942.1|  lihvenlyksfedgevlngis...........................................
gi|294101565|ref|YP_003553423.1|  ptldqlgidlseksrkdeldpvigrdkeiqrviqilarrtknnp....................
gi|294101786|ref|YP_003553644.1|  llkvdhlkkhfyt...................................................
gi|294101493|ref|YP_003553351.1|  lvrvdniyktysmgevdvtalqgvs.......................................
gi|294101884|ref|YP_003553742.1|  aekalhgdiralariislveneapeseeimkylyphtgkal.......................
gi|294101894|ref|YP_003553752.1|  dtpkpaevkkfldqyvigqedakkilsvavynhfkristmseenddielqksn...........
gi|294101778|ref|YP_003553636.1|  dnrpkvtfddvagcdeskeelseviqflrdpgkfralgakvpkg....................
gi|294102313|ref|YP_003554171.1|  ivnike..........................................................
gi|294102640|ref|YP_003554498.1|  lldirnlkkyfnvskgllha............................................
gi|294101376|ref|YP_003553234.1|  isyedigglgpqiqrvremielplrfpqvfdrlgvqppkg........................
gi|294102641|ref|YP_003554499.1|  lldirnlsvrfntdsgivhav...........................................
gi|294101359|ref|YP_003553217.1|  skvlilsptrelsqqiwkeakwfgnyinvsaaslvggmdmsqqirslrdgsavvtgtpgrvldh
gi|294102459|ref|YP_003554317.1|  lrn.............................................................
gi|294101785|ref|YP_003553643.1|  ileirnlrvsyetedgtvealngidldld...................................
gi|294101376|ref|YP_003553234.1|  pdvtwsdiggleaikeelieavqwplkynsvyekfnitpp........................
gi|294102074|ref|YP_003553932.1|  mf..............................................................
gi|294102442|ref|YP_003554300.1|  irlagvtkifqpdival...............................................
gi|294101577|ref|YP_003553435.1|  lkarkvckafkgrtvvssvdl...........................................
gi|294101171|ref|YP_003553029.1|  llelngvdkffggvhavqsmsfalnekei...................................
gi|294102413|ref|YP_003554271.1|  vletkgltmcfg....................................................
gi|294102187|ref|YP_003554045.1|  einrlhddllnevfgygpiqplldddtvteimvngceqvfverwgkieptdvffnndnhirrii
gi|294102332|ref|YP_003554190.1|  irisglrkrygsgdtavdalkmvnm.......................................
gi|294102831|ref|YP_003554689.1|  mlsiavtnqkggvgktttcvnlsaelgrlgysvlavdmdpqgnctsglgiearaievslydvll
gi|294101321|ref|YP_003553179.1|  akphlnvgt.......................................................
gi|294101626|ref|YP_003553484.1|  akphlnvgt.......................................................
gi|294101069|ref|YP_003552927.1|  ilsvddlhfsygetpilknislsvknqem...................................
gi|294102759|ref|YP_003554617.1|  mieivdlsitykteshdvsa............................................
gi|294101055|ref|YP_003552913.1|  ileihqlavafnnkkilkninan.........................................
gi|294101254|ref|YP_003553112.1|  plvqmqeitkefagivanhnid..........................................
gi|294102760|ref|YP_003554618.1|  tdkvsvfypsrdgknsgqwalrn.........................................
gi|294101659|ref|YP_003553517.1|  tlqgvgfsypeadssaldqvs...........................................
gi|294101172|ref|YP_003553030.1|  nilldvqnlqvsygairalrgislq.......................................
gi|294102017|ref|YP_003553875.1|  yirpqinnglnlkieggrhpvieatfldlpfvpndivldgdeeri...................
gi|294101748|ref|YP_003553606.1|  vldslrgtrwkkavektrervreevknlvrlyarrellkgyafpvaseiyrhfveafpyvetpd
gi|294102409|ref|YP_003554267.1|  pmvrsdfpdviyrtslekfhavaeeveetysngqpvlvgttsienseriskllkarkiphqvln
gi|294102070|ref|YP_003553928.1|  fehvvgisalhkryiddlmdmavsllpsdeeeerdpeei.........................
gi|294102390|ref|YP_003554248.1|  dplpdflrlkhafpplydsilemhypqgreswkkardrlayqelfvlqtgmalrrgersrlaek
gi|294101403|ref|YP_003553261.1|  redilelaiddirskfgegsimrlgdpfkvq.................................
gi|294101730|ref|YP_003553588.1|  ekrvsha.........................................................
gi|294102602|ref|YP_003554460.1|  vqaekirn........................................................
gi|294102663|ref|YP_003554521.1|  ivsnlnlfygknqvlhninmdifgktv.....................................
gi|294101436|ref|YP_003553294.1|  lk..............................................................
gi|294102150|ref|YP_003554008.1|  slsrirn.........................................................
gi|294101607|ref|YP_003553465.1|  prvivvts........................................................
gi|294102035|ref|YP_003553893.1|  rrfvqvym........................................................
gi|294102412|ref|YP_003554270.1|  lkieelhvyyggihavkgis............................................
gi|294101660|ref|YP_003553518.1|  msiiiknlthtyhpstpletvalegin.....................................
gi|294102549|ref|YP_003554407.1|  lwisrltktfgtlr..................................................
gi|294102841|ref|YP_003554699.1|  pavvfedvsfgyen..................................................
gi|294101272|ref|YP_003553130.1|  mlrlshlgkk......................................................
gi|294101433|ref|YP_003553291.1|  kkdvgkviavgsgkggvgkssiscllavalakkgfsvgildaditgpsvpklmgvtdspygspq
gi|294101963|ref|YP_003553821.1|  khmeprppiv......................................................
gi|294101356|ref|YP_003553214.1|  dssekavaihfpqcprsgqevisvkdvkktygdnli............................
gi|294102542|ref|YP_003554400.1|  rlknikhfysqrcvlqipsl............................................
gi|294101861|ref|YP_003553719.1|  lrpsslqdfvgqqklkdklsiyvqaarqrkealdh.............................
gi|294102400|ref|YP_003554258.1|  vtgfs...........................................................
gi|294102043|ref|YP_003553901.1|  mfitlegidgcgkstqaaflkeqlqqkkkepvlwtrepggwvhgdfvrtlllekdlrhelself
gi|294101077|ref|YP_003552935.1|  mpllrlksiafayprssplfthlsfe......................................
gi|294102348|ref|YP_003554206.1|  llkvdsitvrrdnatilk..............................................
gi|294102040|ref|YP_003553898.1|  kspkvivlvgvngsgkt...............................................
gi|294101613|ref|YP_003553471.1|  mfierlrlkgfksfggsheltfspgf......................................
gi|294101367|ref|YP_003553225.1|  epllkmenigkayfgnrvl.............................................
gi|294101893|ref|YP_003553751.1|  pwntyteenlditkaqrildedhyglvkvkerileflavrqlagke..................
gi|294101841|ref|YP_003553699.1|  dv..............................................................
gi|294102070|ref|YP_003553928.1|  i...............................................................
gi|294102221|ref|YP_003554079.1|  mvhhvkrqf.......................................................
gi|294101356|ref|YP_003553214.1|  iqlvnithfygeqglynsln............................................
gi|294101345|ref|YP_003553203.1|  pllatqdlsigygpkkgttlvagpia......................................
gi|294102145|ref|YP_003554003.1|  eislvlgtag......................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  pflemtrltvsgdrgkdvv.............................................
gi|294101372|ref|YP_003553230.1|  ytgeemveisthggtlvaqkclesligkgarlaepgeftrraflngkidlsqaeavlgiirsks
gi|294101016|ref|YP_003552874.1|  lnpnyifnsfvvgksnrlahaaslavaetpgeaynp............................
gi|294101780|ref|YP_003553638.1|  v...............................................................
gi|294101686|ref|YP_003553544.1|  idesgcekprssdlmavniidvrpp.......................................
gi|294102507|ref|YP_003554365.1|  pnpdladikgqagakraleiaaaghhn.....................................
gi|294101471|ref|YP_003553329.1|  flrkggsqivlfshlsv...............................................
gi|294101845|ref|YP_003553703.1|  mle.............................................................
gi|294101553|ref|YP_003553411.1|  dvdykvvkslvdsirgrcigqevldsitpgqqvvaivyeelvslmgedvvpfiisskpptl...
gi|294101853|ref|YP_003553711.1|  lrveapipgkpyvgieipnpkrrgvllrrilesqafeqadynlplpmgvrvdsrpliigledlp
gi|294101780|ref|YP_003553638.1|  ahhnlkeidvaipsrv................................................
gi|294102079|ref|YP_003553937.1|  mknlvv..........................................................
gi|294101472|ref|YP_003553330.1|  flsvenlsildeenkplvrnvsfsipsesv..................................
gi|294102235|ref|YP_003554093.1|  it..............................................................
gi|294102390|ref|YP_003554248.1|  ppgrtpiqtrwlkkkeegrlwafirercsareriywvcplidesetlsvasvteryeylkklfp
gi|294101443|ref|YP_003553301.1|  qwerpladrmrpsslddfvgqnhllapgtplrqilqsgkvps......................
gi|294101748|ref|YP_003553606.1|  ppynrvpvltmvgprkknlihravlqelnrggqvffvsnrinrlkgkyeelkimfpearismah
gi|294101649|ref|YP_003553507.1|  mrv.............................................................
gi|294101715|ref|YP_003553573.1|  wtlpelskkpffvfydllhpllgekgipltiecgrsfhvlv.......................
gi|294101925|ref|YP_003553783.1|  sieigkhsssdnlsvyvdihklilrhc.....................................
gi|294101367|ref|YP_003553225.1|  lagnilkvehlwvdm.................................................
gi|294101751|ref|YP_003553609.1|  pvrpktggqklyieamrahdiv..........................................
gi|294101046|ref|YP_003552904.1|  navlsaptgagktlvaylwagllttegkaqmpeg..............................
gi|294101779|ref|YP_003553637.1|  tllgvtgsgktftvanvlaqfdrpvlvlahnktlaaqlytefktffphnavhyfvsyydyyqpe
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ppqtlpev........................................................
gi|294102315|ref|YP_003554173.1|  sdnlvlydskdltthgm...............................................
gi|294102188|ref|YP_003554046.1|  eriavlscrggaggssfsislalqlasmgkrtalidgdlymgdvafllntpyelnwtswanecl
gi|294102320|ref|YP_003554178.1|  ekytniiideahrfrtettityeklaeicrgkrvilvtatpynnspkdilsllklfqkgqksti
gi|294102169|ref|YP_003554027.1|  svmaadeefarrmr..................................................
gi|294101254|ref|YP_003553112.1|  kkitvlgdrgipvvkdlsidvrereilglagiagngqqelcealaglrplkegrimiddeelth
gi|294102077|ref|YP_003553935.1|  ryrrekagipt.....................................................
gi|294102510|ref|YP_003554368.1|  hmakgkrkleelvqkldlilevrdaraphltsspmsdqlsricpvyivlsradlaeegatkawl
gi|294101748|ref|YP_003553606.1|  qvhlpvdggarawilggasvpllvvfsdqrqae...............................
gi|294101141|ref|YP_003552999.1|  d...............................................................
gi|294101018|ref|YP_003552876.1|  lewaagln........................................................
gi|294101692|ref|YP_003553550.1|  iwdsfmqqrntvfvaeaptgigktfallapalkwalpqekrilfltagitlqeqlirkdlprlk
gi|294101032|ref|YP_003552890.1|  mfrltvas........................................................
gi|294101031|ref|YP_003552889.1|  pkei............................................................
gi|294101431|ref|YP_003553289.1|  ektkv...........................................................
gi|294102167|ref|YP_003554025.1|  lvl.............................................................
gi|294101458|ref|YP_003553316.1|  aplcipqlevlikgmflkdrfldiirhfvlfqsdgkeikkilagyhqyhavnkalqstqratme
gi|294102320|ref|YP_003554178.1|  fkrleyqeqavlnakkivleyggvfisdvv..................................
gi|294101940|ref|YP_003553798.1|  r...............................................................
gi|294102120|ref|YP_003553978.1|  rtakglamac......................................................
gi|294101791|ref|YP_003553649.1|  hvy.............................................................
gi|294102136|ref|YP_003553994.1|  mvkqidirkyrkmedlslvfsqginilsgtngtcktsllhivsnsfqevnkgcpwvtdasclta
gi|294101830|ref|YP_003553688.1|  rcl.............................................................
gi|294102042|ref|YP_003553900.1|  iaidiarlllcekknacgqclsccswhekthpdlvlsgslekaptisecreiavelslypvvas
gi|294102015|ref|YP_003553873.1|  il..............................................................
gi|294102787|ref|YP_003554645.1|  mrfiefkirsfgllenmeghfpag........................................
gi|294102032|ref|YP_003553890.1|  lekfigqeravqaisfglsves..........................................
gi|294102010|ref|YP_003553868.1|  tllaslirlyewpkav................................................
gi|294101586|ref|YP_003553444.1|  yifavsgmkn......................................................
gi|294101458|ref|YP_003553316.1|  vviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltdkntrvvfg
gi|294102625|ref|YP_003554483.1|  ivagsprmemetlarelvlwknkkgylsgqeilpaetpwqnigmvfdapllplaeevlqryrip
gi|294102478|ref|YP_003554336.1|  ipvisvgnitlggtnktpfvemlsrhfynmgvrvgivsrgyggrtsepvvikgtssereivgde
gi|294101874|ref|YP_003553732.1|  hv..............................................................
gi|294102071|ref|YP_003553929.1|  lqehpgpaillfperalaeffysfletegveniflwpsvgg.......................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  gegkttttvglaqglaklgkkvsialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102529|ref|YP_003554387.1|  gegkttttvglgqglaklgkrvcialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  aetdldlghyerfideslsadnnvttgkiystviskerhgcylggtvqviphitneiqdrilka
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ikn.............................................................
gi|294101765|ref|YP_003553623.1|  rikimasmdisdkrrpqdgqfniktgsqdfldvrvsslptvdgekialrlldsskipdniyqlg
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  rtlglrhfdvqlmggmalhegkitemktgegktlvatlavvlnalsgngvhvvtvndylakrda
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  irrgtldtsgikivvldegdhmldlgfkeeleaildslpncqrvwlfsatmpaeiknlakrylk
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  dkivaplgrrideaspmvdarlpdgsrvnavippvsidgptltvrkfrrepftaqdlialgtls
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ggasaqdalmatswqgvsllpatidlagaevelasvisretclrrhmanlnqfdvaiidcppsl
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  qlraeqeilqdmesshpmdr............................................
gi|294102409|ref|YP_003554267.1|  akyh............................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  apilpesgrlkerflkeifpyplteaqkkvsleisqdmalnipmhr..................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  giippassifdikvm.................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  lfvidrcehvsqvispalscgqivlcerytdstrayqiwgrglpeekvedlfawcsfpepdltl
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  eealraatrtlrgelssfakdiynemltisssievgldfpeedipfienegvesalytlkqgle
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  h...............................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  dlnvgllhgqlpsseketimrsfarghldlivsttvievgvdv.....................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  gqmaekdlertmldfyngnldilvcttivesgldiprantlivddaqelglaqmyqlrgrvgrr
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ayipssdtyiekdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfav
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  sgtvdgerylalgpk.................................................
gi|294102320|ref|YP_003554178.1|  pnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylmvrrtraeieeyfsrd
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  qppkqfiargvryipadrkgtglvpnmdikensilkkywnkpvargpmidwkavfshainlvkk
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  qffssikqkawafnflegriqllrrdlaklrpahrel...........................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ellgydvsfgllkgrgnyvcvrralelehegflsfgdsgaasiylsewlkktqtgdlselklps
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  qgdrrvgviwhtqgsgkslsmvfyagklvideelenptivvitdrndlddqlfstflkseellr
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ikkvnklinpkietltkgdktyndpanqvkgtlftveyydhpslefrkhnskannrya......
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  cr..............................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  dyidiydmtravedgttvkifyesriakldlpeemkpqidseyeeiteyqeysqkerlkskwar
gi|294102625|ref|YP_003554483.1|  ysinegltvgqtalwdiarriwnagehgwplgetwdilrepclagreiatsppadiftlnekgw
gi|294102478|ref|YP_003554336.1|  plllasrlphvpvav.................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  aittahnllaalldnhlhqgnplnidprrvvfrrvidlne........................
gi|294102529|ref|YP_003554387.1|  aitsahnllsalidnhlhqgnplnidprrvvfrrvvdlneralrhvivglggkadg........
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  addndiviaeiggtvgdiegqp..........................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  feqrdlellekllsqke...............................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ewmgpi..........................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  tpvfislteegeahedithevylvptrhkeeglinvllwekpsraivfchtra...........
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  desvsflrvatearyni...............................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  glltinalvaahklvvpiqceyyalegvgqlahtiglvrdclnpdlavdgvl............
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  w...............................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  dlldrcntg.......................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  eegayayfl.......................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  gekwdrrgfmerlidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideid
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ikeqglkfpkvakpvplfyelnekedfifnrtiehianqfkyarympmlyyknelnqlerqsqr
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ysvstpsietpvknl.................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  dfpifprvaaqvrgclghrcpyrdrcfiqkalkkaqnwdvivsnyhmyfayvmngkgtfpvdfd
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ntpvqaqdrvhlrellnnrtsggiifttiqkfapftnetngevidfnrwgrvaenss.......
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  leaivgteq.......................................................
gi|294102625|ref|YP_003554483.1|  igflehaapergldsfkkmclfvktikkggtpveilsalyslaaenpswgkelslwa.......
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  pvsghtlkqlpkasifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtry
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  nmgrfmkillvkrlessffafrntgqrflnsynmflkelddgfiyvskkysnkifellesddde
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  vlicdeahrmvdaarsissvrvswedlvrllrskgaataesflsnreeeqgvlrdelssvqeeg
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  dmemlaevgycsgienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdra
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  alqklidegkaeryssedfkdelrtdlehdrailmeikrlweqidrdpkllkfkkelstn....
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  rklfellevsiadgvlipvrneelyrcgllvsshietalkmlrsieelcnekpydvddgplala
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  rkttlvengfrlpscldnrplnwrefkkylrqvifisatpgdwerevstcv.............
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  lawieevrlfshslqwclavghfpewaywregdalvseptlcsdkvsegilsqkaekiiaisat
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  mtvegsfdfwkretgiiptdtyvlespfdlekqmkilvvdlglkviekgydervcrvverlcnd
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                   10               
                                                                                    |               
d1e79a3                             .......................................-DVPVGEELLGRVVDALGN......
gi|294102520|ref|YP_003554378.1|  .......................................-------------------......
gi|294102529|ref|YP_003554387.1|  .......................................-------------------......
gi|294102437|ref|YP_003554295.1|  .......................................-----GDEGKGRVVDALGN......
gi|294102168|ref|YP_003554026.1|  .......................................-------------------......
gi|294101779|ref|YP_003553637.1|  .......................................-------------------......
gi|294102457|ref|YP_003554315.1|  .......................................-------------------......
gi|294101625|ref|YP_003553483.1|  .......................................-------------------......
gi|294101185|ref|YP_003553043.1|  .......................................-------------------......
gi|294102626|ref|YP_003554484.1|  .......................................-------------------......
gi|294101765|ref|YP_003553623.1|  .......................................-------------------......
gi|294102479|ref|YP_003554337.1|  .......................................-------------------......
gi|294101904|ref|YP_003553762.1|  .......................................-------------------......
gi|294102557|ref|YP_003554415.1|  .......................................-------------------......
gi|294101807|ref|YP_003553665.1|  .......................................--LPVSRDMLGRIFNGRGE......
gi|294101806|ref|YP_003553664.1|  .......................................----------------IKN......
gi|294102649|ref|YP_003554507.1|  .......................................-------------------......
gi|294101185|ref|YP_003553043.1|  .......................................-------------------......
gi|294102868|ref|YP_003554726.1|  .......................................-------------------......
gi|294102500|ref|YP_003554358.1|  .......................................-------------------......
gi|294102409|ref|YP_003554267.1|  .......................................-------------------......
gi|294102354|ref|YP_003554212.1|  .......................................-------------------......
gi|294101565|ref|YP_003553423.1|  .......................................-------------------......
gi|294101424|ref|YP_003553282.1|  .......................................-------------------......
gi|294101976|ref|YP_003553834.1|  .......................................--MPVGLSLVGQVLNGRGR......
gi|294101061|ref|YP_003552919.1|  .......................................-------------------......
gi|294101048|ref|YP_003552906.1|  .......................................-------------------......
gi|294101977|ref|YP_003553835.1|  .......................................-------------------......
gi|294101084|ref|YP_003552942.1|  .......................................-------------------......
gi|294101565|ref|YP_003553423.1|  .......................................-------------------......
gi|294101786|ref|YP_003553644.1|  .......................................-------------------......
gi|294101493|ref|YP_003553351.1|  .......................................-------------------......
gi|294101884|ref|YP_003553742.1|  .......................................-------------------......
gi|294101894|ref|YP_003553752.1|  .......................................-------------------......
gi|294101778|ref|YP_003553636.1|  .......................................-------------------......
gi|294102313|ref|YP_003554171.1|  .......................................-------------------......
gi|294102640|ref|YP_003554498.1|  .......................................-------------------......
gi|294101376|ref|YP_003553234.1|  .......................................-------------------......
gi|294102641|ref|YP_003554499.1|  .......................................-------------------......
gi|294101359|ref|YP_003553217.1|  .......................................-------------------......
gi|294102459|ref|YP_003554317.1|  .......................................-----GDVIWGMVRPPKDQehyeal
gi|294101785|ref|YP_003553643.1|  .......................................-------------------......
gi|294101376|ref|YP_003553234.1|  .......................................-------------------......
gi|294102074|ref|YP_003553932.1|  .......................................-------------------......
gi|294102442|ref|YP_003554300.1|  .......................................-------------------......
gi|294101577|ref|YP_003553435.1|  .......................................-------------------......
gi|294101171|ref|YP_003553029.1|  .......................................-------------------......
gi|294102413|ref|YP_003554271.1|  .......................................-------------------......
gi|294102187|ref|YP_003554045.1|  .......................................-------------------......
gi|294102332|ref|YP_003554190.1|  .......................................-------------------......
gi|294102831|ref|YP_003554689.1|  .......................................-------------------......
gi|294101321|ref|YP_003553179.1|  .......................................-------------------......
gi|294101626|ref|YP_003553484.1|  .......................................-------------------......
gi|294101069|ref|YP_003552927.1|  .......................................-------------------......
gi|294102759|ref|YP_003554617.1|  .......................................-------------------......
gi|294101055|ref|YP_003552913.1|  .......................................-------------------......
gi|294101254|ref|YP_003553112.1|  .......................................-------------------......
gi|294102760|ref|YP_003554618.1|  .......................................-------------------......
gi|294101659|ref|YP_003553517.1|  .......................................-------------------......
gi|294101172|ref|YP_003553030.1|  .......................................-------------------......
gi|294102017|ref|YP_003553875.1|  .......................................-------------------......
gi|294101748|ref|YP_003553606.1|  .......................................-------------------......
gi|294102409|ref|YP_003554267.1|  .......................................-------------------......
gi|294102070|ref|YP_003553928.1|  .......................................-------------------......
gi|294102390|ref|YP_003554248.1|  .......................................-------------------......
gi|294101403|ref|YP_003553261.1|  .......................................-------------------......
gi|294101730|ref|YP_003553588.1|  .......................................-------------------......
gi|294102602|ref|YP_003554460.1|  .......................................-------------------......
gi|294102663|ref|YP_003554521.1|  .......................................-------------------......
gi|294101436|ref|YP_003553294.1|  .......................................-------------------......
gi|294102150|ref|YP_003554008.1|  .......................................-------------------......
gi|294101607|ref|YP_003553465.1|  .......................................-------------------......
gi|294102035|ref|YP_003553893.1|  .......................................-------------------......
gi|294102412|ref|YP_003554270.1|  .......................................-------------------......
gi|294101660|ref|YP_003553518.1|  .......................................-------------------......
gi|294102549|ref|YP_003554407.1|  .......................................-------------------......
gi|294102841|ref|YP_003554699.1|  .......................................-------------------......
gi|294101272|ref|YP_003553130.1|  .......................................-------------------......
gi|294101433|ref|YP_003553291.1|  .......................................-------------------......
gi|294101963|ref|YP_003553821.1|  .......................................-------------------......
gi|294101356|ref|YP_003553214.1|  .......................................-------------------......
gi|294102542|ref|YP_003554400.1|  .......................................-------------------......
gi|294101861|ref|YP_003553719.1|  .......................................-------------------......
gi|294102400|ref|YP_003554258.1|  .......................................-------------------......
gi|294102043|ref|YP_003553901.1|  .......................................-------------------......
gi|294101077|ref|YP_003552935.1|  .......................................-------------------......
gi|294102348|ref|YP_003554206.1|  .......................................-------------------......
gi|294102040|ref|YP_003553898.1|  .......................................-------------------......
gi|294101613|ref|YP_003553471.1|  .......................................-------------------......
gi|294101367|ref|YP_003553225.1|  .......................................-------------------......
gi|294101893|ref|YP_003553751.1|  .......................................-------------------......
gi|294101841|ref|YP_003553699.1|  .......................................-------------------......
gi|294102070|ref|YP_003553928.1|  .......................................-------------------......
gi|294102221|ref|YP_003554079.1|  .......................................-------------------......
gi|294101356|ref|YP_003553214.1|  .......................................-------------------......
gi|294101345|ref|YP_003553203.1|  .......................................-------------------......
gi|294102145|ref|YP_003554003.1|  .......................................-------------------......
gi|294101756|ref|YP_003553614.1|  .......................................-------------------......
gi|294102549|ref|YP_003554407.1|  .......................................-------------------......
gi|294101372|ref|YP_003553230.1|  .......................................-------------------......
gi|294101016|ref|YP_003552874.1|  .......................................-------------------......
gi|294101780|ref|YP_003553638.1|  .......................................-------------------......
gi|294101686|ref|YP_003553544.1|  .......................................-------------------......
gi|294102507|ref|YP_003554365.1|  .......................................-------------------......
gi|294101471|ref|YP_003553329.1|  .......................................-------------------......
gi|294101845|ref|YP_003553703.1|  .......................................-------------------......
gi|294101553|ref|YP_003553411.1|  .......................................-------------------......
gi|294101853|ref|YP_003553711.1|  .......................................-------------------......
gi|294101780|ref|YP_003553638.1|  .......................................-------------------......
gi|294102079|ref|YP_003553937.1|  .......................................-------------------......
gi|294101472|ref|YP_003553330.1|  .......................................-------------------......
gi|294102235|ref|YP_003554093.1|  .......................................-------------------......
gi|294102390|ref|YP_003554248.1|  .......................................-------------------......
gi|294101443|ref|YP_003553301.1|  .......................................-------------------......
gi|294101748|ref|YP_003553606.1|  .......................................-------------------......
gi|294101649|ref|YP_003553507.1|  .......................................-------------------......
gi|294101715|ref|YP_003553573.1|  .......................................-------------------......
gi|294101925|ref|YP_003553783.1|  .......................................-------------------......
gi|294101367|ref|YP_003553225.1|  .......................................-------------------......
gi|294101751|ref|YP_003553609.1|  .......................................-------------------......
gi|294101046|ref|YP_003552904.1|  .......................................-------------------......
gi|294101779|ref|YP_003553637.1|  .......................................-------------------......
gi|294101226|ref|YP_003553084.1|  .......................................-------------------......
gi|294101892|ref|YP_003553750.1|  .......................................-------------------......
gi|294102315|ref|YP_003554173.1|  .......................................-------------------......
gi|294102188|ref|YP_003554046.1|  .......................................-------------------......
gi|294102320|ref|YP_003554178.1|  .......................................-------------------......
gi|294102169|ref|YP_003554027.1|  .......................................-------------------......
gi|294101254|ref|YP_003553112.1|  .......................................-------------------......
gi|294102077|ref|YP_003553935.1|  .......................................-------------------......
gi|294102510|ref|YP_003554368.1|  .......................................-------------------......
gi|294101748|ref|YP_003553606.1|  .......................................-------------------......
gi|294101141|ref|YP_003552999.1|  .......................................-------------------......
gi|294101018|ref|YP_003552876.1|  .......................................-------------------......
gi|294101692|ref|YP_003553550.1|  nggsslvllssmrlvkkvgnwlkgsqhpytvyvqnelpr-------------------......
gi|294101032|ref|YP_003552890.1|  .......................................-------------------......
gi|294101031|ref|YP_003552889.1|  .......................................-------------------......
gi|294101431|ref|YP_003553289.1|  .......................................-------------------......
gi|294102167|ref|YP_003554025.1|  .......................................-------------------......
gi|294101458|ref|YP_003553316.1|  .......................................-------------------......
gi|294102320|ref|YP_003554178.1|  .......................................-------------------......
gi|294101940|ref|YP_003553798.1|  .......................................-------------------......
gi|294102120|ref|YP_003553978.1|  .......................................-------------------......
gi|294101791|ref|YP_003553649.1|  .......................................-------------------......
gi|294102136|ref|YP_003553994.1|  .......................................-------------------......
gi|294101830|ref|YP_003553688.1|  .......................................-------------------......
gi|294102042|ref|YP_003553900.1|  .......................................-------------------......
gi|294102015|ref|YP_003553873.1|  .......................................-------------------......
gi|294102787|ref|YP_003554645.1|  .......................................-------------------......
gi|294102032|ref|YP_003553890.1|  .......................................-------------------......
gi|294102010|ref|YP_003553868.1|  .......................................-------------------......
gi|294101586|ref|YP_003553444.1|  .......................................-------------------......
gi|294101458|ref|YP_003553316.1|  .......................................-------------------......
gi|294102625|ref|YP_003554483.1|  .......................................-------------------......
gi|294102478|ref|YP_003554336.1|  .......................................-------------------......
gi|294101874|ref|YP_003553732.1|  .......................................-------------------......
gi|294102071|ref|YP_003553929.1|  .......................................-------------------......


                                       20        30         40         50        60               70
                                        |         |          |          |         |                |
d1e79a3                             ....AIDGKGPIGSKARRRVG.LKAPGIIPRISVR.EPMQTGIKAVDSL.V.P..IG...RGQR
gi|294102520|ref|YP_003554378.1|  ....-----------------.--------R----.-------------.-.-..--...----
gi|294102529|ref|YP_003554387.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102437|ref|YP_003554295.1|  ....RVEVFARY---------.-------------.-------------.-.-..--...----
gi|294102168|ref|YP_003554026.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101779|ref|YP_003553637.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102457|ref|YP_003554315.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101625|ref|YP_003553483.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101185|ref|YP_003553043.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102626|ref|YP_003554484.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101765|ref|YP_003553623.1|  ....-----------------.-------------.-------------.-.-..--...--GL
gi|294102479|ref|YP_003554337.1|  ....-----------------.-------------.-------------.-.E..VC...PGER
gi|294101904|ref|YP_003553762.1|  ....-----------------.-------------.--------VDDVH.L.D..ID...AGEL
gi|294102557|ref|YP_003554415.1|  ....-----------------.-------------.-------RAVDRVdL.H..VK...EGEL
gi|294101807|ref|YP_003553665.1|  ....PIDGGAPILPDAKLDIN.GMPMNPFSRDYPS.EFIQTGISTIDGM.N.P..MV...RGQK
gi|294101806|ref|YP_003553664.1|  ....ESGEEKNVVMLQRWPVR.KPRP-VARRLPPI.IPLTTGQRVVDAF.F.P..IA...KGGT
gi|294102649|ref|YP_003554507.1|  ....-----------------.-------------.-----------VS.I.N..IQ...SGEI
gi|294101185|ref|YP_003553043.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102868|ref|YP_003554726.1|  ....-----------------.-------------.KKFGHSYAVRDFS.F.D..IN...EGEL
gi|294102500|ref|YP_003554358.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102409|ref|YP_003554267.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102354|ref|YP_003554212.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101565|ref|YP_003553423.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101424|ref|YP_003553282.1|  ....-----------------.-------------.-------------.M.T..VG...EGEV
gi|294101976|ref|YP_003553834.1|  ....SIDGTPLSFIDKDLPIT.GMPINPVRRTSPN.AYVETGISSIDMM.N.T..LV...RGQK
gi|294101061|ref|YP_003552919.1|  ....-----------------.-------------.-------------.F.T..VR...KGET
gi|294101048|ref|YP_003552906.1|  ....-----------------.-------------.-------------.-.-..-R...QGEV
gi|294101977|ref|YP_003553835.1|  ....------ELTMKQRWEVR.RPRP-VLSRLSFD.APLLTGQRILDTL.F.P..IA...IGGA
gi|294101084|ref|YP_003552942.1|  ....-----------------.-------------.-------------.I.D..IH...EGDL
gi|294101565|ref|YP_003553423.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101786|ref|YP_003553644.1|  ....-----------------.-------------.-PYGTLFAVDDVS.F.S..IK...EGET
gi|294101493|ref|YP_003553351.1|  ....-----------------.-------------.-------------.F.S..VK...KGEF
gi|294101884|ref|YP_003553742.1|  ....-----------------.-------------.-------------.-.-..--...---V
gi|294101894|ref|YP_003553752.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101778|ref|YP_003553636.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102313|ref|YP_003554171.1|  ....-----------------.-----LTKRYPMG.DHTFTALSSVDLE.-.-..FK...KGEF
gi|294102640|ref|YP_003554498.1|  ....-----------------.-------------.--------VDDIT.L.T..IT...KGQT
gi|294101376|ref|YP_003553234.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102641|ref|YP_003554499.1|  ....-----------------.-------------.---------NNLN.L.S..LR...RGKA
gi|294101359|ref|YP_003553217.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102459|ref|YP_003554317.1|  lrveMVNFADPEAARKRPHFGtLTPIFPDSRLTLEtDPDEISTRLIDLF.A.P..IG...KGQR
gi|294101785|ref|YP_003553643.1|  ....-----------------.-------------.-------------.-.-..--...EGVT
gi|294101376|ref|YP_003553234.1|  ....-----------------.-------------.-------------.-.-..--...--QG
gi|294102074|ref|YP_003553932.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102442|ref|YP_003554300.1|  ....-----------------.-------------.---------EDVY.L.S..IM...QGEF
gi|294101577|ref|YP_003553435.1|  ....-----------------.-------------.-------------.-.D..VH...MGEI
gi|294101171|ref|YP_003553029.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102413|ref|YP_003554271.1|  ....-----------------.-------------.-----GLTAVNSF.NmA..VP...KGSI
gi|294102187|ref|YP_003554045.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102332|ref|YP_003554190.1|  ....-----------------.-------------.-------------.-.H..VA...PGEV
gi|294102831|ref|YP_003554689.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101321|ref|YP_003553179.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101626|ref|YP_003553484.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101069|ref|YP_003552927.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102759|ref|YP_003554617.1|  ....-----------------.-------------.--------VKNAF.L.S..IP...RGRI
gi|294101055|ref|YP_003552913.1|  ....-----------------.-------------.-------------.-.-..IY...PHQI
gi|294101254|ref|YP_003553112.1|  ....-----------------.-------------.-------------.F.D..VN...RGEV
gi|294102760|ref|YP_003554618.1|  ....-----------------.-------------.-----------IS.L.S..LQ...QGES
gi|294101659|ref|YP_003553517.1|  ....-----------------.-------------.-------------.F.Q..VR...EGEW
gi|294101172|ref|YP_003553030.1|  ....-----------------.-------------.-------------.-.-..VK...EGEI
gi|294102017|ref|YP_003553875.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101748|ref|YP_003553606.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102409|ref|YP_003554267.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102070|ref|YP_003553928.1|  ....-----------------.-------------.-------------.-.-..--...---R
gi|294102390|ref|YP_003554248.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101403|ref|YP_003553261.1|  ....-----------------.------------V.EVISTGILPLDVA.L.G..IGglpKGRI
gi|294101730|ref|YP_003553588.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102602|ref|YP_003554460.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102663|ref|YP_003554521.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101436|ref|YP_003553294.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102150|ref|YP_003554008.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101607|ref|YP_003553465.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102035|ref|YP_003553893.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102412|ref|YP_003554270.1|  ....-----------------.-------------.-------------.L.H..IP...KGKI
gi|294101660|ref|YP_003553518.1|  ....-----------------.-------------.-------------.L.T..TE...KGQW
gi|294102549|ref|YP_003554407.1|  ....-----------------.-------------.-------AVDDFS.L.E..IA...SGTV
gi|294102841|ref|YP_003554699.1|  ....-----------------.-------------.-----GTMVLDQAsF.Q..VP...QGEF
gi|294101272|ref|YP_003553130.1|  ....-----------------.-------------.---YNGLPVIDQFdL.D..IE...KGSF
gi|294101433|ref|YP_003553291.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101963|ref|YP_003553821.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101356|ref|YP_003553214.1|  ....-----------------.-------------.--------FKDIS.F.S..VH...RGEK
gi|294102542|ref|YP_003554400.1|  ....-----------------.-------------.-------------.-.E..IG...QGEI
gi|294101861|ref|YP_003553719.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102400|ref|YP_003554258.1|  ....-----------------.-------------.----TGFYQFDRM.T.Gg.LQ...PGSL
gi|294102043|ref|YP_003553901.1|  ....-----------------.-----------I-.-------------.-.-..--...----
gi|294101077|ref|YP_003552935.1|  ....-----------------.-------------.-------------.-.-..IF...EKEK
gi|294102348|ref|YP_003554206.1|  ....-----------------.-------------.----------DIS.L.R..VE...SGEV
gi|294102040|ref|YP_003553898.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101613|ref|YP_003553471.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101367|ref|YP_003553225.1|  ....-----------------.-------------.---------KDVS.F.T..LE...KGQI
gi|294101893|ref|YP_003553751.1|  ....-----------------.-------------.-------------.-.-..-A...KGQV
gi|294101841|ref|YP_003553699.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102070|ref|YP_003553928.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102221|ref|YP_003554079.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101356|ref|YP_003553214.1|  ....-----------------.-------------.-------------.W.S..IT...HGSK
gi|294101345|ref|YP_003553203.1|  ....-----------------.-------------.-------------.T.S..LY...EGEL
gi|294102145|ref|YP_003554003.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101756|ref|YP_003553614.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102549|ref|YP_003554407.1|  ....-----------------.-------------.---------KNLT.L.T..VH...RGEI
gi|294101372|ref|YP_003553230.1|  ....-----------------.-------------.-------------.F.L..LR...EGIR
gi|294101016|ref|YP_003552874.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101780|ref|YP_003553638.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101686|ref|YP_003553544.1|  ....-----------------.-------------.QRFTSGIPELDRV.L.GggWV...SGGV
gi|294102507|ref|YP_003554365.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101471|ref|YP_003553329.1|  ....-----------------.-------------.-------------.-.S..FK...KGEV
gi|294101845|ref|YP_003553703.1|  ....-----------------.-------------.ELSLRNIGGLDSA.H.L..HF...KGRF
gi|294101553|ref|YP_003553411.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101853|ref|YP_003553711.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101780|ref|YP_003553638.1|  ....-----------------.-------------.-------------.-.-..--...---F
gi|294102079|ref|YP_003553937.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101472|ref|YP_003553330.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102235|ref|YP_003554093.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102390|ref|YP_003554248.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101443|ref|YP_003553301.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101748|ref|YP_003553606.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101649|ref|YP_003553507.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101715|ref|YP_003553573.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101925|ref|YP_003553783.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101367|ref|YP_003553225.1|  ....-----------------.-------------.----PGETVRDVS.F.T..VK...EGEI
gi|294101751|ref|YP_003553609.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101046|ref|YP_003552904.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101779|ref|YP_003553637.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101226|ref|YP_003553084.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101892|ref|YP_003553750.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102315|ref|YP_003554173.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102188|ref|YP_003554046.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102320|ref|YP_003554178.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102169|ref|YP_003554027.1|  ....-----------------.------------D.ESHHRGILVIN--.-.-..--...----
gi|294101254|ref|YP_003553112.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102077|ref|YP_003553935.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102510|ref|YP_003554368.1|  ....-----------------.-------------.-------------.-.-..--...---R
gi|294101748|ref|YP_003553606.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101141|ref|YP_003552999.1|  ....-----------------.-------------.-------------.-.-..--...---R
gi|294101018|ref|YP_003552876.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101692|ref|YP_003553550.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101032|ref|YP_003552890.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101031|ref|YP_003552889.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101431|ref|YP_003553289.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102167|ref|YP_003554025.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101458|ref|YP_003553316.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102320|ref|YP_003554178.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101940|ref|YP_003553798.1|  ....-----------------.-------------.----LGIRRLDTA.F.Dg.VY...PGEM
gi|294102120|ref|YP_003553978.1|  ....-----------------.-------------.-------------.-.-..VE...DGSS
gi|294101791|ref|YP_003553649.1|  ....-----------------.-------------.-------------.-.-..--...SGLT
gi|294102136|ref|YP_003553994.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101830|ref|YP_003553688.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102042|ref|YP_003553900.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102015|ref|YP_003553873.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102787|ref|YP_003554645.1|  ....-----------------.-------------.-------------.-.-..--...---L
gi|294102032|ref|YP_003553890.1|  ....-----------------.-------------.-------------.-.-..--...KGYN
gi|294102010|ref|YP_003553868.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101586|ref|YP_003553444.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101458|ref|YP_003553316.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102625|ref|YP_003554483.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102478|ref|YP_003554336.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294101874|ref|YP_003553732.1|  ....-----------------.-------------.-------------.-.-..--...----
gi|294102071|ref|YP_003553929.1|  ....-----------------.-------------.------KKLWEAW.N.R..TR...SGEH


                                            80        90          100       110       120           
                                             |         |            |         |         |           
d1e79a3                             ELIIGDRQTGKTSIAIDTIINQKRFNDGT...DEKKKLYCIYVAIGQKRSTVAQLVKRL.....
gi|294102520|ref|YP_003554378.1|  -----------------------------...---------------------------.....
gi|294102529|ref|YP_003554387.1|  -----------------------------...---------------------------.....
gi|294102437|ref|YP_003554295.1|  ---QGGANAGHTVI---------------...---------------------------.....
gi|294102168|ref|YP_003554026.1|  LLVLAGAGSGKTRVLAHKIAYLI---EKG...YASPKGILAVTFTNKAAREMGERVQAL.....
gi|294101779|ref|YP_003553637.1|  -----------------------------...---------------------------.....
gi|294102457|ref|YP_003554315.1|  -----------------------------...---------------------------.....
gi|294101625|ref|YP_003553483.1|  IGIAAHIDAGKTTT-TERILFYTGRNYKM...GETHE----------------------.....
gi|294101185|ref|YP_003553043.1|  -VLIGDPGVGKTAIVEGLAQRIV------...---------------------------.....
gi|294102626|ref|YP_003554484.1|  -----------------------------...--------------------------L.....
gi|294101765|ref|YP_003553623.1|  ILVTGPTGSGKSTT-LHALIKQVNAL---...---------------------------.....
gi|294102479|ref|YP_003554337.1|  VAVVGETGGGKSTL-MDLIPRFYD-----...--PSRGKVSVDGCDVRTLDLTELRKQI.....
gi|294101904|ref|YP_003553762.1|  ITFLGPSGCGKTTI-LRMIAGFEKPT---...---------------------------.....
gi|294102557|ref|YP_003554415.1|  ITLLGPSGCGKTTL-LRMIAGFEDPT---...---------------------------.....
gi|294101807|ref|YP_003553665.1|  LPIFSGSGLPHNRM-AAQIARQATVISG-...--HEDFAVVFAAMGITFEEASFFMEDF.....
gi|294101806|ref|YP_003553664.1|  ACVPGPFGSGKTVI-QHQLAKWA------...--ESDI-VVYVGCGERGNEMTDVLLEFpeled
gi|294102649|ref|YP_003554507.1|  FGIIGLSGAGKSTL-LRTLNRLE------...---------------------------.....
gi|294101185|ref|YP_003553043.1|  -IFLGPTGVGKTEL-AKTLAEAL------...---------------------------.....
gi|294102868|ref|YP_003554726.1|  VSLLGPSGCGKTTT-LRMIGGFL------...--QPDE---------------------.....
gi|294102500|ref|YP_003554358.1|  ILMVGPTGVGKTEI-ARRLADLVLAPFV-...--KVEA-TKFTEVGYVGRDVDSMIRDL.....
gi|294102409|ref|YP_003554267.1|  -------------------YRFL------...--GLSVKCIYAYMDQKERKEAYL----.....
gi|294102354|ref|YP_003554212.1|  -AIAAHGGAGKTSL-VEAIL---------...---------------------------.....
gi|294101565|ref|YP_003553423.1|  -LFLGPTGVGKTEL-ARRLADF-------...---------------------------.....
gi|294101424|ref|YP_003553282.1|  VSVIGPSGSGKSTL-ARCICRLEDIN---...--DGEI----YLYGQRVDNGK------.....
gi|294101976|ref|YP_003553834.1|  LPIFSGSGLPANEI-AAQIVQQAAVPGR-...--ETDFLVIFAAMGITRREARYFIDTF.....
gi|294101061|ref|YP_003552919.1|  KVFIGPSGTGKSTL-LRCINQLTIP----...---------------------------.....
gi|294101048|ref|YP_003552906.1|  FVIMGLSGSGKSTL-IRCVIRLIE-----...---------------------------.....
gi|294101977|ref|YP_003553835.1|  AVLPGGFGTGKTVT-QQSLAKWC------...--NAEI-IIYIGCGERGNEMTEVLEEFpelsd
gi|294101084|ref|YP_003552942.1|  VSIIGPSGCGKSTF-LRCLNCLE------...---------------------------.....
gi|294101565|ref|YP_003553423.1|  -VLLGDPGVGKTAIVEGLAQKIQ------...--DGNI---------------------.....
gi|294101786|ref|YP_003553644.1|  LGVVGESGCGKSTL-GRAVLRL-------...---------------------------.....
gi|294101493|ref|YP_003553351.1|  LSIMGASGSGKSTL-MNIIGCL-------...---------------------------.....
gi|294101884|ref|YP_003553742.1|  IGITGSPGAGKSTLVDKLILEFRK-----...---------------------------.....
gi|294101894|ref|YP_003553752.1|  VLLIGPTGSGKTLL-AQSLAKKL------...---------------------------.....
gi|294101778|ref|YP_003553636.1|  VLLLGPPGTGKTLL-ARAAAGEADVPFFS...VSGSDFVEMFVGVGA-----ARVRDLF.....
gi|294102313|ref|YP_003554171.1|  CGLIGPSGSGKTTL-LNIIGALD------...---------------------------.....
gi|294102640|ref|YP_003554498.1|  LGLVGESGCGKSTL-GRVVIGL-------...---------------------------.....
gi|294101376|ref|YP_003553234.1|  VLLYGPPGTGKTVI-ARAVANETDVYFTH...ISGPEI------IGKFYGESEERLRNV.....
gi|294102641|ref|YP_003554499.1|  LGFVGETGAGKTTTALAVL----------...---------------------------.....
gi|294101359|ref|YP_003553217.1|  -----------------------------...---------------------------.....
gi|294102459|ref|YP_003554317.1|  ALLVSPPKAGKTTV-LKKIANAVTVN---...--HPDIILMVLLIDERPEEVTDMARSV.....
gi|294101785|ref|YP_003553643.1|  LGIVGETGAGKTTL-AKSIMRIIP-----...---------------------------.....
gi|294101376|ref|YP_003553234.1|  ILLHGPSGTGKTLL-VRALAHESGVNFIP...VKGPALMSK--YVGESERAIREVFKKA.....
gi|294102074|ref|YP_003553932.1|  -VISGPSGAGKGTV-RKALFEQM------...---------------------------.....
gi|294102442|ref|YP_003554300.1|  VYLVGTTGSGKTTL-MRLITRELI-----...---------------------------.....
gi|294101577|ref|YP_003553435.1|  VGLLGPNGAGKTTT-FYMIVGLIKP----...---------------------------.....
gi|294101171|ref|YP_003553029.1|  VGLIGPNGAGKTTI-FNVVTGVY------...--DPDG---------------------.....
gi|294102413|ref|YP_003554271.1|  VGLIGPNGAGKTTV-FNMITGFYKPT---...---------------------------.....
gi|294102187|ref|YP_003554045.1|  -IVTGGTGSGKTTT-LNVLSSFI------...---------------------------.....
gi|294102332|ref|YP_003554190.1|  VGLIGPSGSGKSTL-LKCLG---------...---------------------------.....
gi|294102831|ref|YP_003554689.1|  -----------------------------...---------------------------.....
gi|294101321|ref|YP_003553179.1|  ---IGHIDHGKTTL-TAAITKCLSTK---...--GWSNFEAYDMIDKAPEER-------.....
gi|294101626|ref|YP_003553484.1|  ---IGHIDHGKTTL-TAAITKCLSTK---...--GWSNFEAYDMIDKAPEER-------.....
gi|294101069|ref|YP_003552927.1|  VMILGPNGSGKTTL-LRCLNGIN------...---------------------------.....
gi|294102759|ref|YP_003554617.1|  TGLVGESGSGKSSLLMA------------...---------------------------.....
gi|294101055|ref|YP_003552913.1|  TAIIGPSGCGKSTF-LKSLNRLV------...---------------------------.....
gi|294101254|ref|YP_003553112.1|  HALLGENGAGKSTL-MNILYGLY------...--NPDR---------------------.....
gi|294102760|ref|YP_003554618.1|  LALIGESGSGKTSL-LRVLLGLISPT---...---------------------------.....
gi|294101659|ref|YP_003553517.1|  LALLGSNGSGKSTLAKHLNALLL------...--PSQGACFVYGMDTREEKNLWAIRSH.....
gi|294101172|ref|YP_003553030.1|  VCVIGANGAGKSTL-MNALMSE-------...---------------------------.....
gi|294102017|ref|YP_003553875.1|  ALITGPNMAGKSTY-LRMAALLVI-----...---------------------------.....
gi|294101748|ref|YP_003553606.1|  -LLVGDVGFGKTEIAMRAAFKAS------...--EAGKQV-V-----------------.....
gi|294102409|ref|YP_003554267.1|  -----------------------------...---------------------------.....
gi|294102070|ref|YP_003553928.1|  VSIVGRPNVGKSSL-VNALA---------...--GSDR---------------------.....
gi|294102390|ref|YP_003554248.1|  -LLQGDVGSGKTAVAVLAL----------...---------------------------.....
gi|294101403|ref|YP_003553261.1|  VEIFGPEGSGKTTVALHGIAEAQ------...--K------------------------.....
gi|294101730|ref|YP_003553588.1|  YLFSGPRGCGKTTL-ARLLAKSL------...---------------------------.....
gi|294102602|ref|YP_003554460.1|  LAIIAHIDHGKTTL-IDSIFKAAQIF---...---------------------------.....
gi|294102663|ref|YP_003554521.1|  TALIGPSGCGKSSF-IRCLNRMNDFIPNV...---------------------------.....
gi|294101436|ref|YP_003553294.1|  CGIVGLPLCGKSTV-FNVITRAG------...---------------------------.....
gi|294102150|ref|YP_003554008.1|  FCIIAHIDHGKSTL-ADRLIEYTGTV---...---------------------------.....
gi|294101607|ref|YP_003553465.1|  ----GKGGVGKTTTTANVSFALAKAGYKVvaiDADIGLRNLDVVMGLENRVVYNFIDVI.....
gi|294102035|ref|YP_003553893.1|  -----GDGKGKTTAALGLAIRAAGWN---...---------------------------.....
gi|294102412|ref|YP_003554270.1|  VTLIGANGAGKSST-IRSIAGLVR-----...--SA-----------------------.....
gi|294101660|ref|YP_003553518.1|  LSIVGHTGSGKSTLAQHLNALIV------...---------------------------.....
gi|294102549|ref|YP_003554407.1|  HSLVGENGAGKSTV-VKCVYG--------...---------------------------.....
gi|294102841|ref|YP_003554699.1|  LVIIGPNGGGKTTL-LRLILGLEKP----...----AR-GKIEVLGTTPDRAVTSVGYV.....
gi|294101272|ref|YP_003553130.1|  SVLIGPSGCGKSTL-FDLLTGTI------...--EREY-GTMEWIGEAV----------.....
gi|294101433|ref|YP_003553291.1|  -----------------------------...---------------------------.....
gi|294101963|ref|YP_003553821.1|  -TVMGHVDHGKTTL-LDYIRQTNI-----...---------------------------.....
gi|294101356|ref|YP_003553214.1|  IALVGVNGAGKSTL-SRLISQSEV-----...---------------------------.....
gi|294102542|ref|YP_003554400.1|  LGLLGANGSGKSTL-LRILAFL-------...---------------------------.....
gi|294101861|ref|YP_003553719.1|  ILFYGPPGLGKTTL-AGIIAHEM------...--GGQL---------------------.....
gi|294102400|ref|YP_003554258.1|  NIIAARPSMGKTALALN-IAQY-------...---------------------------.....
gi|294102043|ref|YP_003553901.1|  -----------------------------...---------------------------.....
gi|294101077|ref|YP_003552935.1|  IYIRGENGAGKTTL-FSLIMGLLRPQ---...---------------------------.....
gi|294102348|ref|YP_003554206.1|  TGVLGRNGAGKSSLAYAL-----------...---------------------------.....
gi|294102040|ref|YP_003553898.1|  -----------------------------...---------------------------.....
gi|294101613|ref|YP_003553471.1|  TAIVGPNGSGKSNI-LD------------...---------------------------.....
gi|294101367|ref|YP_003553225.1|  LGLVGENGAGKSTL-MNILFGMPVIQET-...---------------------------.....
gi|294101893|ref|YP_003553751.1|  LCFVGPPGVGKTSL-AQSIARAL------...--GRRF-VNFSLGG-------------.....
gi|294101841|ref|YP_003553699.1|  -GLVGLPNAGKSSL-LAAISNAR------...---------------------------.....
gi|294102070|ref|YP_003553928.1|  -AIVGRPNVGKSSL-FNRILGR-------...---------------------------.....
gi|294102221|ref|YP_003554079.1|  VFFGGKGGTGKTTCAAAYAY---------...---------------------------.....
gi|294101356|ref|YP_003553214.1|  TGLIGSNGTGKTTL-FKIIMGLV------...--EPREGNVYFPKGIRIGYLSQD----.....
gi|294101345|ref|YP_003553203.1|  VCLIGPNGVGKTTL-LKTLAGTQ------...---------------------------.....
gi|294102145|ref|YP_003554003.1|  -----HIDHGKTTL-VKALTGVS------...---------------------------.....
gi|294101756|ref|YP_003553614.1|  -PIVGRPNVGKSSL-LNNILAYK------...---------VSIVSEKPQTTRNAIHGI.....
gi|294102549|ref|YP_003554407.1|  VGIAGITGNGQSEL-EEAISGLR------...---------------------------.....
gi|294101372|ref|YP_003553230.1|  VALVGRPNVGKSSL-LNALLKES------...---------------------------.....
gi|294101016|ref|YP_003552874.1|  LFIWGGVGLGKTHL-MHAIGHYVLNK---...--NNSLKVTYVSSEKFINE--------.....
gi|294101780|ref|YP_003553638.1|  --ITGPSGSGKSSLAFDTLY---------...---------------------------.....
gi|294101686|ref|YP_003553544.1|  VLLGGQPGIGKSTLLLQVCGAMA------...---------------------------.....
gi|294102507|ref|YP_003554365.1|  LLFIGSPGSGKTML-ARAIRGIV------...---------------------------.....
gi|294101471|ref|YP_003553329.1|  VGLVGPSGKGKTTL-GDILLGLI------...---------------------------.....
gi|294101845|ref|YP_003553703.1|  IAITGESGAGKSSIV-RA-----------...---------------------------.....
gi|294101553|ref|YP_003553411.1|  CMMVGLQGSGKTTSAVKIAKRIQ------...--NAHN-PLVVACDLRRPAAIEQLKVL.....
gi|294101853|ref|YP_003553711.1|  LLVAGTTGSGKSVFVNSCIAGLCYCR---...---------------------------.....
gi|294101780|ref|YP_003553638.1|  SCISGVSGSGKSSLLYDVLYKGMK-----...---------------------------.....
gi|294102079|ref|YP_003553937.1|  -AIDGPAGAGKSSV-AKKVAEL-------...---------------------------.....
gi|294101472|ref|YP_003553330.1|  FFLVGETGSGKTPI-AQAIAGTL------...---------------------------.....
gi|294102235|ref|YP_003554093.1|  LALAGNPNTGKTSL-FNLLTGSRQ-----...---------------------------.....
gi|294102390|ref|YP_003554248.1|  -----------------------------...---------------------------.....
gi|294101443|ref|YP_003553301.1|  CVLYGPPGVGKTTL-VRLMAMVT------...--ERSL-LEINAVSAKVSELRDLVEEA.....
gi|294101748|ref|YP_003553606.1|  -----------------------------...---------------------------.....
gi|294101649|ref|YP_003553507.1|  -ILLGPPGAGKGTQAAEIKTKYKV-----...---------------------------.....
gi|294101715|ref|YP_003553573.1|  --VTGPNTGGKTVA-LK------------...--TVGMGIILA----------------.....
gi|294101925|ref|YP_003553783.1|  -AILGSTGSGKSNTTVSILRAILN-----...--DYDG---------------------.....
gi|294101367|ref|YP_003553225.1|  FGIGGLAGQGKLGI-AN------------...---------------------------.....
gi|294101751|ref|YP_003553609.1|  -FAIGPAGTGKTYLAVCHGVAML------...--KAG----------------------.....
gi|294101046|ref|YP_003552904.1|  -----------------------------...-----I---------------------.....
gi|294101779|ref|YP_003553637.1|  ---------------A-------------...---------------------------.....
gi|294101226|ref|YP_003553084.1|  -LLIGNPNVGKSVI-FSRLTGVRAISSN-...--YPGTTVGFL----------------.....
gi|294101892|ref|YP_003553750.1|  -AFVGRSNVGKSML-LNALMERKLAH---...---------------------------.....
gi|294102315|ref|YP_003554173.1|  --IIGMTGSGKTGLGIALL----------...---------------------------.....
gi|294102188|ref|YP_003554046.1|  -----------------------------...---------------------------.....
gi|294102320|ref|YP_003554178.1|  -----------------------------...---A-----------------------.....
gi|294102169|ref|YP_003554027.1|  --IIGSPGAGKTTL-LEATKKAA------...---------------------------.....
gi|294101254|ref|YP_003553112.1|  -----------------------------...---------------------------.....
gi|294102077|ref|YP_003553935.1|  VALTGYTNSGKSTL-LQQLSHGR------...---------------------------.....
gi|294102510|ref|YP_003554368.1|  LAVVGIPNVGKSLF-LNLLV---------...---------------------------.....
gi|294101748|ref|YP_003553606.1|  -----------------------------...---------------------D-----.....
gi|294101141|ref|YP_003552999.1|  TCLLAPCGSGKTLAAWKWGSGVA------...---------------------------.....
gi|294101018|ref|YP_003552876.1|  -LLVGNNGSGKTNA-LEAIHIL-------...---------------------------.....
gi|294101692|ref|YP_003553550.1|  -----------------------------...---------------------------.....
gi|294101032|ref|YP_003552890.1|  ----GKGGTGKTCIAASLALSLS------...---------------------------.....
gi|294101031|ref|YP_003552889.1|  VIISGKGGTGKTCIMAALCSSFS------...---------------------------.....
gi|294101431|ref|YP_003553289.1|  IVIAGPSGSGKTTTAKR------------...---------------------------.....
gi|294102167|ref|YP_003554025.1|  -GVTGDVGAGKSTV-SQ-IWKSL------...---------------------------.....
gi|294101458|ref|YP_003553316.1|  -----------------------------...---------------------------.....
gi|294102320|ref|YP_003554178.1|  -------GLGKTYI-SAMLAGQL------...--DGRT---------------------.....
gi|294101940|ref|YP_003553798.1|  LNLAGAQGSLKTSLALHGAVNFLQG----...--NPERRVLFFSLDMSKEE--------.....
gi|294102120|ref|YP_003553978.1|  LILGGGTGVGKTHLAIAMIQELT------...--AKGKSAVFVPV--------------.....
gi|294101791|ref|YP_003553649.1|  ILLYGDLGAGKTVLVK-------------...---------------------------.....
gi|294102136|ref|YP_003553994.1|  -----------------------------...--------I------------------.....
gi|294101830|ref|YP_003553688.1|  -IITGMSGAGKSTV-LNILED--------...---------------------------.....
gi|294102042|ref|YP_003553900.1|  -----------------------------...---------------------------.....
gi|294102015|ref|YP_003553873.1|  -AIIGPTAVGKTKLSLE-IAETLKAEVI-...--SVDSRQVYRYMN-------------.....
gi|294102787|ref|YP_003554645.1|  SLILGDNESGKTTL-MSFL----------...---------------------------.....
gi|294102032|ref|YP_003553890.1|  IFVLGNPGSGRTSYSLQRLHESAK-----...---------------------------.....
gi|294102010|ref|YP_003553868.1|  -AVTGALGSGKTEWVLNMALALL------...--EA-----------------------.....
gi|294101586|ref|YP_003553444.1|  --------SGKTKLCLLLLKYLK------...--EAGI---------------------.....
gi|294101458|ref|YP_003553316.1|  -----------------------------...---------------------------.....
gi|294102625|ref|YP_003554483.1|  -----------------------------...---------------------------.....
gi|294102478|ref|YP_003554336.1|  -----------------------------...---------------------------.....
gi|294101874|ref|YP_003553732.1|  IAFVGPAGTGKSQR-AQYVATDN------...--NVDYIIDDGL---------------.....
gi|294102071|ref|YP_003553929.1|  KIIIGGPG---------------------...---------------------------.....


                                       130       140       150       160        170       180       
                                         |         |         |         |          |         |       
d1e79a3                             ..TDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF.RDNGKHALIIYDDLSKQAVAYRQM
gi|294102520|ref|YP_003554378.1|  ..-------------------------------------.------------------------
gi|294102529|ref|YP_003554387.1|  ..-------------------------------------.------------------------
gi|294102437|ref|YP_003554295.1|  ..-------------------------------------.------------------------
gi|294102168|ref|YP_003554026.1|  ..VGAKASAM-----------------------------.------------------------
gi|294101779|ref|YP_003553637.1|  ..-------------------------------TVANVL.AQFDRPVLVLAHNKTLAAQLYTEF
gi|294102457|ref|YP_003554315.1|  ..-------------------------------------.----------------F-------
gi|294101625|ref|YP_003553483.1|  ..-------------------------------------.------------------------
gi|294101185|ref|YP_003553043.1|  ..-------------------------------------.------------------------
gi|294102626|ref|YP_003554484.1|  ..-------------------------------------.------------------------
gi|294101765|ref|YP_003553623.1|  ..-------------------------------------.------------------------
gi|294102479|ref|YP_003554337.1|  ..-------------------------------------.------------------------
gi|294101904|ref|YP_003553762.1|  ..-------------------------------------.------------------------
gi|294102557|ref|YP_003554415.1|  ..-------------------------------------.------------------------
gi|294101807|ref|YP_003553665.1|  ..RRTGAIQRTVMFVNLADDPAIERITTPRLALTAAEYLaFEQDMHVVVILTDLTNYCEALREI
gi|294101806|ref|YP_003553664.1|  prSGEPLMKRTVLIANTSNMPVAAREASIYTAITMAEYY.RDMGYSVALMADSTSRWAEALREM
gi|294102649|ref|YP_003554507.1|  ..-------------------------------------.------------------------
gi|294101185|ref|YP_003553043.1|  ..-------------------------------------.------------------------
gi|294102868|ref|YP_003554726.1|  ..-------------------------------------.------------------------
gi|294102500|ref|YP_003554358.1|  ..VET----------------------------------.------------------------
gi|294102409|ref|YP_003554267.1|  ..-------------------------------------.------------------------
gi|294102354|ref|YP_003554212.1|  ..-------------------------------------.------------------------
gi|294101565|ref|YP_003553423.1|  ..-------------------------------------.------------------------
gi|294101424|ref|YP_003553282.1|  ..-------------------------------------.------------------------
gi|294101976|ref|YP_003553834.1|  ..ESTGAINNGIFFMNLASDSAVERLLTPRMALTAAEYFaFEKGYDVLVIMTDMLYYCESLREI
gi|294101061|ref|YP_003552919.1|  ..-------------------------------------.------------------------
gi|294101048|ref|YP_003552906.1|  ..-------------------------------------.------------------------
gi|294101977|ref|YP_003553835.1|  pfHNAPLMERMVLIANTSNMPVAAREASVYLGMTLAEYF.RDMGYNTAIMADSTSRWAEALREI
gi|294101084|ref|YP_003552942.1|  ..-------------------------------------.------------------------
gi|294101565|ref|YP_003553423.1|  ..-------------------------------------.------------------------
gi|294101786|ref|YP_003553644.1|  ..-------------------------------------.------------------------
gi|294101493|ref|YP_003553351.1|  ..-------------------------------------.------------------------
gi|294101884|ref|YP_003553742.1|  ..-------------------------------------.------------------------
gi|294101894|ref|YP_003553752.1|  ..-------------------------------------.------------------------
gi|294101778|ref|YP_003553636.1|  ..EQARKYQPCIIFIDEM---------------------.------------------------
gi|294102313|ref|YP_003554171.1|  ..-------------------------------------.------------------------
gi|294102640|ref|YP_003554498.1|  ..-------------------------------------.------------------------
gi|294101376|ref|YP_003553234.1|  ..FD-----------------------------------.------------------------
gi|294102641|ref|YP_003554499.1|  ..-------------------------------------.------------------------
gi|294101359|ref|YP_003553217.1|  ..-----------------E-------------------.------------------------
gi|294102459|ref|YP_003554317.1|  ..DGE-------IIASTFDRPAEEHLRVANLALEKAKRL.VETGKDVVLLLDSITRLARASNLV
gi|294101785|ref|YP_003553643.1|  ..-------------------------------------.------------------------
gi|294101376|ref|YP_003553234.1|  ..KQA----------------------------------.------------------------
gi|294102074|ref|YP_003553932.1|  ..-------------------------------------.------------------------
gi|294102442|ref|YP_003554300.1|  ..-------------------------------------.------------------------
gi|294101577|ref|YP_003553435.1|  ..-------------------------------------.------------------------
gi|294101171|ref|YP_003553029.1|  ..-------------------------------------.------------------------
gi|294102413|ref|YP_003554271.1|  ..-------------------------------------.------------------------
gi|294102187|ref|YP_003554045.1|  ..-------------------------------------.------------------------
gi|294102332|ref|YP_003554190.1|  ..-------------------------------------.------------------------
gi|294102831|ref|YP_003554689.1|  ..-------------------------------------.-------LTMYDSRTRLA------
gi|294101321|ref|YP_003553179.1|  ..-------------------------------------.------------------------
gi|294101626|ref|YP_003553484.1|  ..-------------------------------------.------------------------
gi|294101069|ref|YP_003552927.1|  ..-------------------------------------.------------------------
gi|294102759|ref|YP_003554617.1|  ..-------------------------------------.------------------------
gi|294101055|ref|YP_003552913.1|  ..-------------------------------------.------------------------
gi|294101254|ref|YP_003553112.1|  ..-------------------------------------.------------------------
gi|294102760|ref|YP_003554618.1|  ..-------------------------------------.------------------------
gi|294101659|ref|YP_003553517.1|  ..-------------------------------------.------------------------
gi|294101172|ref|YP_003553030.1|  ..-------------------------------------.------------------------
gi|294102017|ref|YP_003553875.1|  ..-------------------------------------.------------------------
gi|294101748|ref|YP_003553606.1|  ..-------------------------------------.------------------------
gi|294102409|ref|YP_003554267.1|  ..----------------E--------------------.------------------------
gi|294102070|ref|YP_003553928.1|  ..-------------------------------------.------------------------
gi|294102390|ref|YP_003554248.1|  ..-------------------------------------.------------------------
gi|294101403|ref|YP_003553261.1|  ..-------------------------------------.------------------------
gi|294101730|ref|YP_003553588.1|  ..-------------------------------------.------------------------
gi|294102602|ref|YP_003554460.1|  ..-------------------------------------.------------------------
gi|294102663|ref|YP_003554521.1|  ..-------------------------------------.------------------------
gi|294101436|ref|YP_003553294.1|  ..-------------------------------------.------------------------
gi|294102150|ref|YP_003554008.1|  ..-------------------------------------.------------------------
gi|294101607|ref|YP_003553465.1|  ..EG-----------------------------------.------------------------
gi|294102035|ref|YP_003553893.1|  ..-------------------------------------.------------------------
gi|294102412|ref|YP_003554270.1|  ..-------------------------------------.------------------------
gi|294101660|ref|YP_003553518.1|  ..-------------------------------------.------------------------
gi|294102549|ref|YP_003554407.1|  ..-------------------------------------.------------------------
gi|294102841|ref|YP_003554699.1|  ..PQEGVRDKI----------------------------.------------------------
gi|294101272|ref|YP_003553130.1|  ..-------------------------------------.------------------------
gi|294101433|ref|YP_003553291.1|  ..-------------------------------------.-----S------------------
gi|294101963|ref|YP_003553821.1|  ..-------------------------------------.------------------------
gi|294101356|ref|YP_003553214.1|  ..-------------------------------------.------------------------
gi|294102542|ref|YP_003554400.1|  ..-------------------------------------.------------------------
gi|294101861|ref|YP_003553719.1|  ..-------------------------------------.------------------------
gi|294102400|ref|YP_003554258.1|  ..-------------------------------------.------------------------
gi|294102043|ref|YP_003553901.1|  ..-------------------------------------.------------------------
gi|294101077|ref|YP_003552935.1|  ..-------------------------------------.------------------------
gi|294102348|ref|YP_003554206.1|  ..-------------------------------------.------------------------
gi|294102040|ref|YP_003553898.1|  ..---------------------------TTAAKLAEQF.HRQGKKVILGAADTFRAAA-----
gi|294101613|ref|YP_003553471.1|  ..-------------------------------------.------------------------
gi|294101367|ref|YP_003553225.1|  ..-------------------------------------.------------------------
gi|294101893|ref|YP_003553751.1|  ..-------------------------------------.------------------------
gi|294101841|ref|YP_003553699.1|  ..-------------------------------------.------------------------
gi|294102070|ref|YP_003553928.1|  ..-------------------------------------.------------------------
gi|294102221|ref|YP_003554079.1|  ..-------------------------------------.------------------------
gi|294101356|ref|YP_003553214.1|  ..-------------------------------------.------------------------
gi|294101345|ref|YP_003553203.1|  ..-------------------------------------.------------------------
gi|294102145|ref|YP_003554003.1|  ..-------------------------------------.------------------------
gi|294101756|ref|YP_003553614.1|  ..YNEPEM-------------------------------.------------------------
gi|294102549|ref|YP_003554407.1|  ..-------------------------------------.------------------------
gi|294101372|ref|YP_003553230.1|  ..-------------------------------------.------------------------
gi|294101016|ref|YP_003552874.1|  ..-------------------------------------.------------------------
gi|294101780|ref|YP_003553638.1|  ..-------------------------------------.------------------------
gi|294101686|ref|YP_003553544.1|  ..-------------------------------------.------------------------
gi|294102507|ref|YP_003554365.1|  ..-------------------------------------.------------------------
gi|294101471|ref|YP_003553329.1|  ..-------------------------------------.------------------------
gi|294101845|ref|YP_003553703.1|  ..-------------------------------------.------------------------
gi|294101553|ref|YP_003553411.1|  ..AQQS---------------------------------.------------------------
gi|294101853|ref|YP_003553711.1|  ..-------------------------------------.------------------------
gi|294101780|ref|YP_003553638.1|  ..-------------------------------------.------------------------
gi|294102079|ref|YP_003553937.1|  ..-------------------------------------.------------------------
gi|294101472|ref|YP_003553330.1|  ..-------------------------------------.------------------------
gi|294102235|ref|YP_003554093.1|  ..-------------------------------------.------------------------
gi|294102390|ref|YP_003554248.1|  ..-------------------------------------.---P--------------------
gi|294101443|ref|YP_003553301.1|  ..KNLKILSGSAAI-------------------------.------------------------
gi|294101748|ref|YP_003553606.1|  ..-------------------------------------.------------------------
gi|294101649|ref|YP_003553507.1|  ..-------------------------------------.------------------------
gi|294101715|ref|YP_003553573.1|  ..-------------------------------------.------------------------
gi|294101925|ref|YP_003553783.1|  ..-------------------------------------.------------------------
gi|294101367|ref|YP_003553225.1|  ..-------------------------------------.------------------------
gi|294101751|ref|YP_003553609.1|  ..-------------------------------------.------------------------
gi|294101046|ref|YP_003552904.1|  ..-------------------------------------.------------------------
gi|294101779|ref|YP_003553637.1|  ..-------------------------------------.------------------------
gi|294101226|ref|YP_003553084.1|  ..--EGWLRYNSEVYRIIDVPGAYTLDPTNEAEQVARRM.VDEGADLAIIVLDAT---------
gi|294101892|ref|YP_003553750.1|  ..-------------------------------------.------------------------
gi|294102315|ref|YP_003554173.1|  ..-------------------------------------.------------------------
gi|294102188|ref|YP_003554046.1|  ..-------------------------------------.------------------------
gi|294102320|ref|YP_003554178.1|  ..-------------------------------------.------------------------
gi|294102169|ref|YP_003554027.1|  ..-------------------------------------.------------------------
gi|294101254|ref|YP_003553112.1|  ..-S-----------------------------------.------------------------
gi|294102077|ref|YP_003553935.1|  ..-------------------------------------.------------------------
gi|294102510|ref|YP_003554368.1|  ..-------------------------------------.------------------------
gi|294101748|ref|YP_003553606.1|  ..-------------------------------------.------------------------
gi|294101141|ref|YP_003552999.1|  ..-------------------------------------.------------------------
gi|294101018|ref|YP_003552876.1|  ..-------------------------------------.------------------------
gi|294101692|ref|YP_003553550.1|  ..-------------------------------------.------------------------
gi|294101032|ref|YP_003552890.1|  ..-------------------------------------.------------------------
gi|294101031|ref|YP_003552889.1|  ..-------------------------------------.------------------------
gi|294101431|ref|YP_003553289.1|  ..-------------------------------------.------------------------
gi|294102167|ref|YP_003554025.1|  ..-------------------------------------.------------------------
gi|294101458|ref|YP_003553316.1|  ..--------------------------P----------.------------------------
gi|294102320|ref|YP_003554178.1|  ..-------------------------------------.------------------------
gi|294101940|ref|YP_003553798.1|  ..-------------------------------------.------------------------
gi|294102120|ref|YP_003553978.1|  ..-------------------------------------.------------------------
gi|294101791|ref|YP_003553649.1|  ..-------------------------------------.------------------------
gi|294102136|ref|YP_003553994.1|  ..-------------------------------------.------------------------
gi|294101830|ref|YP_003553688.1|  ..-------------------------------------.------------------------
gi|294102042|ref|YP_003553900.1|  ..-------------------------------------.------L-----------------
gi|294102015|ref|YP_003553873.1|  ..-------------------------------------.------------------------
gi|294102787|ref|YP_003554645.1|  ..-------------------------------------.------------------------
gi|294102032|ref|YP_003553890.1|  ..-------------------------------------.------------------------
gi|294102010|ref|YP_003553868.1|  ..-------------------------------------.------------------------
gi|294101586|ref|YP_003553444.1|  ..-------------------------------------.------------------------
gi|294101458|ref|YP_003553316.1|  ..------------------------R------------.------------------------
gi|294102625|ref|YP_003554483.1|  ..-------------------------------------.-----------M------------
gi|294102478|ref|YP_003554336.1|  ..---------------------------------S---.------------------------
gi|294101874|ref|YP_003553732.1|  ..-------------------------------------.------------------------
gi|294102071|ref|YP_003553929.1|  ..-------------------------------------.------------------------


                                    190       200       210          220       230        240       
                                      |         |         |            |         |          |       
d1e79a3                             SLLLRRPPGREAYPGDVFYLHSRLLERAAK...MNDAFGGGSLTALPVIETQAGD.VSAYIPTN
gi|294102520|ref|YP_003554378.1|  ------------------------------...----------------------.--------
gi|294102529|ref|YP_003554387.1|  ------V-----------------------...----------------------.--------
gi|294102437|ref|YP_003554295.1|  ------------------------------...----------------------.--------
gi|294102168|ref|YP_003554026.1|  ------------------------------...----------------------.--------
gi|294101779|ref|YP_003553637.1|  ------------------------------...----------------------.--------
gi|294102457|ref|YP_003554315.1|  ------------------------------...----------------------.--------
gi|294101625|ref|YP_003553483.1|  ------------------------------...----------------------.--------
gi|294101185|ref|YP_003553043.1|  ------------------------------...----------------------.--------
gi|294102626|ref|YP_003554484.1|  ------------------------------...----------------------.--------
gi|294101765|ref|YP_003553623.1|  ------------------------------...----------------------.--------
gi|294102479|ref|YP_003554337.1|  ------------------------------...----------------------.--------
gi|294101904|ref|YP_003553762.1|  ------------------------------...----------------------.--------
gi|294102557|ref|YP_003554415.1|  ------------------------------...----------------------.--------
gi|294101807|ref|YP_003553665.1|  SAARKEVPGRRGYPGYLYTDLATMYERAGR...LKG--KKGSITQIPILTMPEDD.KTHPIPDL
gi|294101806|ref|YP_003553664.1|  SGRLEEMPGEEGYPAYLGTRLASFYERAGRaicLGSDGREGSVTAIGAVSPPGGD.LSEPVSQN
gi|294102649|ref|YP_003554507.1|  ------------------------------...----------------------.--------
gi|294101185|ref|YP_003553043.1|  ------------------------------...----------------------.--------
gi|294102868|ref|YP_003554726.1|  ------------------------------...----------------------.--------
gi|294102500|ref|YP_003554358.1|  ------------------------------...----------------------.--------
gi|294102409|ref|YP_003554267.1|  ------------------------------...----------------------.--------
gi|294102354|ref|YP_003554212.1|  ------------------------------...----------------------.--------
gi|294101565|ref|YP_003553423.1|  ------------------------------...----------------------.--------
gi|294101424|ref|YP_003553282.1|  ------------------------------...----------------------.--------
gi|294101976|ref|YP_003553834.1|  SAAREEVPGRRGYPGYMYSDLAEIYERAGC...VENC--QGSITQIPIITMPDDD.MTHPVVDL
gi|294101061|ref|YP_003552919.1|  ------------------------------...----------------------.--------
gi|294101048|ref|YP_003552906.1|  ------------------------------...----------------------.--------
gi|294101977|ref|YP_003553835.1|  GGRLEEMPGEEGYPAYLGTRLAQYYERAGRaklLGLPEREGSVTVINAVSPAGGD.FSEPVTQA
gi|294101084|ref|YP_003552942.1|  ------------------------------...----------------------.--------
gi|294101565|ref|YP_003553423.1|  ------------------------------...----------------------.--------
gi|294101786|ref|YP_003553644.1|  ------------------------------...----------------------.--------
gi|294101493|ref|YP_003553351.1|  ------------------------------...----------------------.--------
gi|294101884|ref|YP_003553742.1|  ------------------------------...----------------------.--------
gi|294101894|ref|YP_003553752.1|  ------------------------------...----------------------.--------
gi|294101778|ref|YP_003553636.1|  ------------------------------...----------------------.--------
gi|294102313|ref|YP_003554171.1|  ------------------------------...----------------------.--------
gi|294102640|ref|YP_003554498.1|  ------------------------------...----------------------.--------
gi|294101376|ref|YP_003553234.1|  ------------------------------...----------------------.--------
gi|294102641|ref|YP_003554499.1|  ------------------------------...----------------------.--------
gi|294101359|ref|YP_003553217.1|  ------------------------------...----------------------.--------
gi|294102459|ref|YP_003554317.1|  VPPSGRT-LSGGMDPAALYFPKRFFGAARN...IEE---GGSLTVIGTALVDTGSrMDDVIYEE
gi|294101785|ref|YP_003553643.1|  ------------------------------...----------------------.--------
gi|294101376|ref|YP_003553234.1|  ------------------------------...----------------------.--------
gi|294102074|ref|YP_003553932.1|  ------------------------------...----------------------.--------
gi|294102442|ref|YP_003554300.1|  ------------------------------...----------------------.--------
gi|294101577|ref|YP_003553435.1|  ------------------------------...----------------------.--------
gi|294101171|ref|YP_003553029.1|  ------------------------------...----------------------.--------
gi|294102413|ref|YP_003554271.1|  ------------------------------...----------------------.--------
gi|294102187|ref|YP_003554045.1|  ------------------------------...----------------------.--------
gi|294102332|ref|YP_003554190.1|  ------------------------------...----------------------.--------
gi|294102831|ref|YP_003554689.1|  ------------------------------...----------------------.--------
gi|294101321|ref|YP_003553179.1|  ------------------------------...----------------------.--------
gi|294101626|ref|YP_003553484.1|  ------------------------------...----------------------.--------
gi|294101069|ref|YP_003552927.1|  ------------------------------...----------------------.--------
gi|294102759|ref|YP_003554617.1|  ------------------------------...----------------------.--------
gi|294101055|ref|YP_003552913.1|  ------------------------------...----------------------.--------
gi|294101254|ref|YP_003553112.1|  ------------------------------...----------------------.--------
gi|294102760|ref|YP_003554618.1|  ------------------------------...----------------------.--------
gi|294101659|ref|YP_003553517.1|  ------------------------------...----------------------.--------
gi|294101172|ref|YP_003553030.1|  ------------------------------...----------------------.--------
gi|294102017|ref|YP_003553875.1|  ------------------------------...----------------------.--------
gi|294101748|ref|YP_003553606.1|  ------------------------------...----------------------.--------
gi|294102409|ref|YP_003554267.1|  ------------------------------...----------------------.--------
gi|294102070|ref|YP_003553928.1|  ------------------------------...----------------------.--------
gi|294102390|ref|YP_003554248.1|  ------------------------------...----------------------.--------
gi|294101403|ref|YP_003553261.1|  ------------------------------...----------------------.--------
gi|294101730|ref|YP_003553588.1|  ------------------------------...----------------------.--------
gi|294102602|ref|YP_003554460.1|  ------------------------------...----------------------.--------
gi|294102663|ref|YP_003554521.1|  ------------------------------...----------------------.--------
gi|294101436|ref|YP_003553294.1|  ------------------------------...----------------------.--------
gi|294102150|ref|YP_003554008.1|  ------------------------------...----------------------.--------
gi|294101607|ref|YP_003553465.1|  ------------------------------...----------------------.--------
gi|294102035|ref|YP_003553893.1|  ------------------------------...----------------------.--------
gi|294102412|ref|YP_003554270.1|  ------------------------------...----------------------.--------
gi|294101660|ref|YP_003553518.1|  ------------------------------...----------------------.--------
gi|294102549|ref|YP_003554407.1|  ------------------------------...----------------------.--------
gi|294102841|ref|YP_003554699.1|  ------------------------------...----------------------.--------
gi|294101272|ref|YP_003553130.1|  ------------------------------...----------------------.--------
gi|294101433|ref|YP_003553291.1|  ------------------------------...----------------------.--------
gi|294101963|ref|YP_003553821.1|  ------------------------------...----------------------.--------
gi|294101356|ref|YP_003553214.1|  ------------------------------...----------------------.--------
gi|294102542|ref|YP_003554400.1|  ------------------------------...----------------------.--------
gi|294101861|ref|YP_003553719.1|  ------------------------------...----------------------.--------
gi|294102400|ref|YP_003554258.1|  ------------------------------...----------------------.--------
gi|294102043|ref|YP_003553901.1|  ------------------------------...----------------------.--------
gi|294101077|ref|YP_003552935.1|  ------------------------------...----------------------.--------
gi|294102348|ref|YP_003554206.1|  ------------------------------...----------------------.--------
gi|294102040|ref|YP_003553898.1|  ------------------------------...----------------------.--------
gi|294101613|ref|YP_003553471.1|  ------------------------------...----------------------.--------
gi|294101367|ref|YP_003553225.1|  ------------------------------...----------------------.--------
gi|294101893|ref|YP_003553751.1|  ------------------------------...----------------------.--------
gi|294101841|ref|YP_003553699.1|  ------------------------------...----------------------.--------
gi|294102070|ref|YP_003553928.1|  ------------------------------...----------------------.--------
gi|294102221|ref|YP_003554079.1|  ------------------------------...----------------------.--------
gi|294101356|ref|YP_003553214.1|  ------------------------------...----------------------.--------
gi|294101345|ref|YP_003553203.1|  ------------------------------...----------------------.--------
gi|294102145|ref|YP_003554003.1|  ------------------------------...----------------------.--------
gi|294101756|ref|YP_003553614.1|  ------------------------------...----------------------.--------
gi|294102549|ref|YP_003554407.1|  ------------------------------...----------------------.--------
gi|294101372|ref|YP_003553230.1|  ------------------------------...----------------------.--------
gi|294101016|ref|YP_003552874.1|  ------------------------------...----------------------.--------
gi|294101780|ref|YP_003553638.1|  ------------------------------...----------------------.--------
gi|294101686|ref|YP_003553544.1|  ------------------------------...----------------------.--------
gi|294102507|ref|YP_003554365.1|  ------------------------------...----------------------.--------
gi|294101471|ref|YP_003553329.1|  ------------------------------...----------------------.--------
gi|294101845|ref|YP_003553703.1|  ------------------------------...----------------------.--------
gi|294101553|ref|YP_003553411.1|  ------------------------------...----------------------.--------
gi|294101853|ref|YP_003553711.1|  ------------------------------...----------------------.--------
gi|294101780|ref|YP_003553638.1|  ------------------------------...----------------------.--------
gi|294102079|ref|YP_003553937.1|  ------------------------------...----------------------.--------
gi|294101472|ref|YP_003553330.1|  ------------------------------...----------------------.--------
gi|294102235|ref|YP_003554093.1|  ------------------------------...----------------------.--------
gi|294102390|ref|YP_003554248.1|  ------------------------------...----------------------.--------
gi|294101443|ref|YP_003553301.1|  ------------------------------...----------------------.--------
gi|294101748|ref|YP_003553606.1|  --------------------Y---------...----------------------.--------
gi|294101649|ref|YP_003553507.1|  ------------------------------...----------------------.--------
gi|294101715|ref|YP_003553573.1|  ------------------------------...----------------------.--------
gi|294101925|ref|YP_003553783.1|  ------------------------------...----------------------.--------
gi|294101367|ref|YP_003553225.1|  ------------------------------...----------------------.--------
gi|294101751|ref|YP_003553609.1|  ------------------------------...----------------------.--------
gi|294101046|ref|YP_003552904.1|  ------------------------------...----------------------.--------
gi|294101779|ref|YP_003553637.1|  ------------------------------...----------------------.--------
gi|294101226|ref|YP_003553084.1|  ------------------------------...----------------------.--------
gi|294101892|ref|YP_003553750.1|  ------------------------------...----------------------.--------
gi|294102315|ref|YP_003554173.1|  ------------------------------...----------------------.--------
gi|294102188|ref|YP_003554046.1|  ------------------------------...----------------------.--------
gi|294102320|ref|YP_003554178.1|  ------------------------------...----------------------.--------
gi|294102169|ref|YP_003554027.1|  ------------------------------...----------------------.--------
gi|294101254|ref|YP_003553112.1|  ------------------------------...----------------------.--------
gi|294102077|ref|YP_003553935.1|  ------------------------------...----------------------.--------
gi|294102510|ref|YP_003554368.1|  ------------------------------...----------------------.--------
gi|294101748|ref|YP_003553606.1|  ------------------------------...----------------------.--------
gi|294101141|ref|YP_003552999.1|  ------------------------------...----------------------.--------
gi|294101018|ref|YP_003552876.1|  ------------------------------...----------------------.--------
gi|294101692|ref|YP_003553550.1|  ---------------------TELLERFRS...DLSSVLIGSVSFREGVDVPGEG.LTQVIID-
gi|294101032|ref|YP_003552890.1|  ------------------------------...----------------------.--------
gi|294101031|ref|YP_003552889.1|  ------------------------------...----------------------.--------
gi|294101431|ref|YP_003553289.1|  ------------------------------...----------------------.--------
gi|294102167|ref|YP_003554025.1|  ------------------------------...----------------------.--------
gi|294101458|ref|YP_003553316.1|  ------------------------------...----------------------.--------
gi|294102320|ref|YP_003554178.1|  ------------------------------...----------------------.--------
gi|294101940|ref|YP_003553798.1|  ------------------------------...----------------------.--------
gi|294102120|ref|YP_003553978.1|  ------------------------------...----------------------.--------
gi|294101791|ref|YP_003553649.1|  ------------------------------...----------------------.--------
gi|294102136|ref|YP_003553994.1|  ------------------------------...----------------------.--------
gi|294101830|ref|YP_003553688.1|  ------------------------------...----------------------.--------
gi|294102042|ref|YP_003553900.1|  ------------------------------...----------------------.--------
gi|294102015|ref|YP_003553873.1|  ------------------------------...----------------------.--------
gi|294102787|ref|YP_003554645.1|  ------------------------------...----------------------.--------
gi|294102032|ref|YP_003553890.1|  ------------------------------...----------------------.--------
gi|294102010|ref|YP_003553868.1|  ------------------------------...----------------------.--------
gi|294101586|ref|YP_003553444.1|  ------------------------------...----------------------.--------
gi|294101458|ref|YP_003553316.1|  ------------------------------...----------------------.--------
gi|294102625|ref|YP_003554483.1|  ------------------------------...----------------------.--------
gi|294102478|ref|YP_003554336.1|  ------------------------------...----------------------.--------
gi|294101874|ref|YP_003553732.1|  ------------------------------...----------------------.--------
gi|294102071|ref|YP_003553929.1|  ------------------------------...----------------------.--------


                                    250       260       270       280                               
                                      |         |         |         |                               
d1e79a3                             VISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAA-q.........................
gi|294102520|ref|YP_003554378.1|  --------------------------------------alryvnvglggktngvpresgfditv
gi|294102529|ref|YP_003554387.1|  --------------------------------------presgfditvasevmailclsanike
gi|294102437|ref|YP_003554295.1|  --------------------------------------vedekyvfhllpsgmlypcklcvvgn
gi|294102168|ref|YP_003554026.1|  --------------------------------------qvstfhsfglhflfrnsdqleflglr
gi|294101779|ref|YP_003553637.1|  --------------------------------------ktffphnavhyfvsyydyyqpeayip
gi|294102457|ref|YP_003554315.1|  --------------------------------------leairqmatrvgrqnvlychvtlvpy
gi|294101625|ref|YP_003553483.1|  --------------------------------------gsatmdwmeqerergitissaattci
gi|294101185|ref|YP_003553043.1|  --------------------------------------rgdvpeglkdrsifaldmgslvagak
gi|294102626|ref|YP_003554484.1|  --------------------------------------llqlamelpsqkvffqkaadridegy
gi|294101765|ref|YP_003553623.1|  --------------------------------------tlnvttiedpverfheginqvevder
gi|294102479|ref|YP_003554337.1|  --------------------------------------givpqdpvlmkgslafnisygfpqat
gi|294101904|ref|YP_003553762.1|  --------------------------------------egqvliggrdithlavnkrdigfvfq
gi|294102557|ref|YP_003554415.1|  --------------------------------------egdvffgdrrvndvapnhrnatmvfq
gi|294101807|ref|YP_003553665.1|  TGYITEGQIILSRGLHRKGIYPPVDVMPSLSRLKD---k.........................
gi|294101806|ref|YP_003553664.1|  TLRVTKVFWGLDASLAYQRHFPAINWLLSYSLYTD---t.........................
gi|294102649|ref|YP_003554507.1|  --------------------------------------epssgsicigdtditrlstpelrklr
gi|294101185|ref|YP_003553043.1|  --------------------------------------fdsednmiridmseymekfsvsrlig
gi|294102868|ref|YP_003554726.1|  --------------------------------------gsiilegedithlppekrptatvfqs
gi|294102500|ref|YP_003554358.1|  --------------------------------------avamvkrvkieevqgpaeeraewrlv
gi|294102409|ref|YP_003554267.1|  --------------------------------------sdvtygtnsefgfdylrdnmavakdq
gi|294102354|ref|YP_003554212.1|  --------------------------------------fsngdinrmgnvvdgntvadfgaeeq
gi|294101565|ref|YP_003553423.1|  --------------------------------------lfgsedamirldmsefmerhevgkli
gi|294101424|ref|YP_003553282.1|  --------------------------------------hsnkevatlvgmifqqfnlfphlsvl
gi|294101976|ref|YP_003553834.1|  SGYITEGQIVLDRGIHDRGAYPPINVLPSLSRLMN---k.........................
gi|294101061|ref|YP_003552919.1|  --------------------------------------dsgqiwlhgeevthskksinvlrqkm
gi|294101048|ref|YP_003552906.1|  --------------------------------------ptsgeiwvngqevsslpkkdltefrr
gi|294101977|ref|YP_003553835.1|  SLRLSGAFWALDKRLAQQRHFPAINWQQSYTLYE----gs........................
gi|294101084|ref|YP_003552942.1|  --------------------------------------yidsgtitiagvtvsrtgkekeldks
gi|294101565|ref|YP_003553423.1|  --------------------------------------aeilrgkkivqlnignlvagtkyrge
gi|294101786|ref|YP_003553644.1|  --------------------------------------ceptsgtvffdgedvlkfnkakmkkm
gi|294101493|ref|YP_003553351.1|  --------------------------------------dtpteghyyldgtdvstidenqladi
gi|294101884|ref|YP_003553742.1|  --------------------------------------kkktvgiiavdpsspfsggailadri
gi|294101894|ref|YP_003553752.1|  --------------------------------------nvpfamadattlteagyvgedvenil
gi|294101778|ref|YP_003553636.1|  --------------------------------------davgrhrgaglggghdereqtlnqll
gi|294102313|ref|YP_003554171.1|  --------------------------------------apsegsvvvidrnvenlshkesaqlr
gi|294102640|ref|YP_003554498.1|  --------------------------------------ieatggevlfkgqdalkfnnaqkref
gi|294101376|ref|YP_003553234.1|  --------------------------------------eaqahapaiifideidaiapkreemg
gi|294102641|ref|YP_003554499.1|  --------------------------------------qliqsppgeitngeiffdgqdvmkmt
gi|294101359|ref|YP_003553217.1|  --------------------------------------tveltrrlhdenfqamclhgemsqre
gi|294102459|ref|YP_003554317.1|  FKGTGNMELHLSRKLAEQRIFPAVDITKSGTRREEL--l.........................
gi|294101785|ref|YP_003553643.1|  --------------------------------------tppghiesgtilyknkdilgmtssei
gi|294101376|ref|YP_003553234.1|  --------------------------------------spsilyfdeieslvpirgrdsgagas
gi|294102074|ref|YP_003553932.1|  --------------------------------------pdlvysiscttrqprdgerdgvdyrf
gi|294102442|ref|YP_003554300.1|  --------------------------------------qtrgqvtvgdqnlrklrasqlpyyrr
gi|294101577|ref|YP_003553435.1|  --------------------------------------dsgrvmidskditpfpmfrrarigvg
gi|294101171|ref|YP_003553029.1|  --------------------------------------grilfdgeditplktyevirkgiart
gi|294102413|ref|YP_003554271.1|  --------------------------------------egniffnednitgfppnkvcesgiar
gi|294102187|ref|YP_003554045.1|  --------------------------------------pnrerivtiedaaelsmqqdhvvrme
gi|294102332|ref|YP_003554190.1|  --------------------------------------avieptagqmmlgddviyhdgwkvkd
gi|294102831|ref|YP_003554689.1|  --------------------------------------ndvveevrrqfgeivfstivprnvkl
gi|294101321|ref|YP_003553179.1|  --------------------------------------ergitinishveyqtenrhyahidcp
gi|294101626|ref|YP_003553484.1|  --------------------------------------ergitinishveyqtenrhyahidcp
gi|294101069|ref|YP_003552927.1|  --------------------------------------rpqkgtitledknmrrmsgreiarri
gi|294102759|ref|YP_003554617.1|  --------------------------------------ipgllpsntevsgavifdnlnlislr
gi|294101055|ref|YP_003552913.1|  --------------------------------------edergvtlsgqirldgedtftlspee
gi|294101254|ref|YP_003553112.1|  --------------------------------------ghilidgkkvsfsspkdaiaagigmv
gi|294102760|ref|YP_003554618.1|  --------------------------------------egnvelfgenidkcshsqlielrrrc
gi|294101659|ref|YP_003553517.1|  --------------------------------------vamvfqnpdnqivgtvveddtafgpe
gi|294101172|ref|YP_003553030.1|  --------------------------------------vrrekglinfsgaplaqrsydvvkqg
gi|294102017|ref|YP_003553875.1|  --------------------------------------maqmgafipaaeasmglmdrvftrig
gi|294101748|ref|YP_003553606.1|  --------------------------------------vlvpttilaqqhyhtfrsrmagfpir
gi|294102409|ref|YP_003554267.1|  --------------------------------------keaqivaqagrfgavtvatnmagrgt
gi|294102070|ref|YP_003553928.1|  --------------------------------------vlvsdipgttrdatdtviemkegkfr
gi|294102390|ref|YP_003554248.1|  --------------------------------------lqaveggyqgafmapteilaqqhyyr
gi|294101403|ref|YP_003553261.1|  --------------------------------------aggiaafidaehaldprlaaslgvdv
gi|294101730|ref|YP_003553588.1|  --------------------------------------nctgqkqsvepcndcpnclaingges
gi|294102602|ref|YP_003554460.1|  --------------------------------------rkgahieervmdsnelerergitira
gi|294102663|ref|YP_003554521.1|  --------------------------------------kvegdiylegkniysgatdvialrrq
gi|294101436|ref|YP_003553294.1|  --------------------------------------aevkpyasgktdpnramvsvpdprfe
gi|294102150|ref|YP_003554008.1|  --------------------------------------eirkmkaqlldsldlerergitiklv
gi|294101607|ref|YP_003553465.1|  --------------------------------------tcrlpqalirdkrvdnlfllpaaqtr
gi|294102035|ref|YP_003553893.1|  --------------------------------------mkvgiiqfmkgwpqygelaslarfpe
gi|294102412|ref|YP_003554270.1|  --------------------------------------kgkilytsnegveenilgktpefivk
gi|294101660|ref|YP_003553518.1|  --------------------------------------pekgevivegfvsrpksqdlrkirrl
gi|294102549|ref|YP_003554407.1|  --------------------------------------lysptagkfkidnkiltiktprdamk
gi|294102841|ref|YP_003554699.1|  --------------------------------------fpvsvfdvvlmgrlgigrrkifteed
gi|294101272|ref|YP_003553130.1|  --------------------------------------phlgqiaaymqqkdlllpwlslmqna
gi|294101433|ref|YP_003553291.1|  --------------------------------------vnlllddptkpvvwrgpiiasvikqf
gi|294101963|ref|YP_003553821.1|  --------------------------------------tareaggitqhigastvtyegknivf
gi|294101356|ref|YP_003553214.1|  --------------------------------------ptegnisygynvkmgffsqesaqnln
gi|294102542|ref|YP_003554400.1|  --------------------------------------etptegtvyfkkervetvsvnyrrsv
gi|294101861|ref|YP_003553719.1|  --------------------------------------rvttgpalekagdiaailsnlepfdv
gi|294102400|ref|YP_003554258.1|  --------------------------------------ggverkepilifslemsaeqlvqrml
gi|294102043|ref|YP_003553901.1|  --------------------------------------dtplpvainrikttrghfdriesetd
gi|294101077|ref|YP_003552935.1|  --------------------------------------kgdiivkgkviknqkdlrylrqtigf
gi|294102348|ref|YP_003554206.1|  --------------------------------------mglpdyipvkgsisflgeditswsit
gi|294102040|ref|YP_003553898.1|  --------------------------------------idqlkiwgertgsrviaqqqgsdsaa
gi|294101613|ref|YP_003553471.1|  --------------------------------------glrwvlgegspnclritrqsdllfqg
gi|294101367|ref|YP_003553225.1|  --------------------------------------ggyegkffingqeaqfkspfdaldag
gi|294101893|ref|YP_003553751.1|  --------------------------------------vrdeaeirghrrtyvgaqpgriiqkm
gi|294101841|ref|YP_003553699.1|  --------------------------------------pkiagypfttlspnlgilavdddriv
gi|294102070|ref|YP_003553928.1|  --------------------------------------reaivddmpgvtrdriygetewkgrq
gi|294102221|ref|YP_003554079.1|  --------------------------------------alsrlgiktlvvstdpahsladafnr
gi|294101356|ref|YP_003553214.1|  --------------------------------------lveiedtvllhylkkqagialvekel
gi|294101345|ref|YP_003553203.1|  --------------------------------------nplggeirvlesslaelshkkraqll
gi|294102145|ref|YP_003554003.1|  --------------------------------------cdrlneekkrgitielgfaplklhdg
gi|294101756|ref|YP_003553614.1|  --------------------------------------qivftdtpgihrprhklgealvkaav
gi|294102549|ref|YP_003554407.1|  --------------------------------------fvkegqllmgkrdithlpplkrrklg
gi|294101372|ref|YP_003553230.1|  --------------------------------------raivtaipgttrdlieevltyrgipi
gi|294101016|ref|YP_003552874.1|  --------------------------------------fiqsiknnrtqefkskyrsvdillid
gi|294101780|ref|YP_003553638.1|  --------------------------------------aegqrryveslsayarqflgiqkkpd
gi|294101686|ref|YP_003553544.1|  --------------------------------------argervlyisgeesasqvalrarrll
gi|294102507|ref|YP_003554365.1|  --------------------------------------pplsheelleslqihssarpdykpsl
gi|294101471|ref|YP_003553329.1|  --------------------------------------vpdrgkvlwkgqdirtlsktkkknlr
gi|294101845|ref|YP_003553703.1|  --------------------------------------lefasgkraqselirageeeaevial
gi|294101553|ref|YP_003553411.1|  --------------------------------------kvafygpsggtqdvikvakealayae
gi|294101853|ref|YP_003553711.1|  --------------------------------------kpeelrllmidpkrvelsiyehlphm
gi|294101780|ref|YP_003553638.1|  --------------------------------------rildkdfreragkhlsidgaeqfrnv
gi|294102079|ref|YP_003553937.1|  --------------------------------------lgldyldtgaiyralafylnamgfep
gi|294101472|ref|YP_003553330.1|  --------------------------------------akrlsvcgkvflkkqnllsvkekelk
gi|294102235|ref|YP_003554093.1|  --------------------------------------hvgnwpgvtverkeghfsyegmnftl
gi|294102390|ref|YP_003554248.1|  --------------------------------------qatvmviedadrfglsqlhqlrgrvg
gi|294101443|ref|YP_003553301.1|  --------------------------------------afvdeiyhfnksqqnallpsvekgdi
gi|294101748|ref|YP_003553606.1|  --------------------------------------petmplqketmerfeaisafsdigsg
gi|294101649|ref|YP_003553507.1|  --------------------------------------ahistgdilrqnvkektklgcqaqef
gi|294101715|ref|YP_003553573.1|  --------------------------------------wcgfplpakegtvvgnldnvfadigd
gi|294101925|ref|YP_003553783.1|  --------------------------------------srvilidphgeyasafpsakvfrina
gi|294101367|ref|YP_003553225.1|  --------------------------------------gimgmypsggtvtfdetpiilndprs
gi|294101751|ref|YP_003553609.1|  --------------------------------------aisrivlvrpaveageslgylpgdlr
gi|294101046|ref|YP_003552904.1|  --------------------------------------sriiftapikalsnerymdlrrmgfd
gi|294101779|ref|YP_003553637.1|  --------------------------------------eqiirptgvvdpevvvspatgqvddl
gi|294101226|ref|YP_003553084.1|  --------------------------------------alernlylafqamergihtivalnmv
gi|294101892|ref|YP_003553750.1|  --------------------------------------vgstpgktrsvnfykieaevdfflvd
gi|294102315|ref|YP_003554173.1|  --------------------------------------eealmdnipviaidpkgditnlllsf
gi|294102188|ref|YP_003554046.1|  ----------------D---------------------lmimptaknpvqaelvksgmgdrlie
gi|294102320|ref|YP_003554178.1|  --------------------------------------tlqknhliiftesketanylfeeink
gi|294102169|ref|YP_003554027.1|  --------------------------------------sfrfaviegdiatsrdaerlsklgvp
gi|294101254|ref|YP_003553112.1|  --------------------------------------ggnlqklmlgrelcdapkaliavhpt
gi|294102077|ref|YP_003553935.1|  --------------------------------------nlyvadqlfstldtyvrkvelsdghd
gi|294102510|ref|YP_003554368.1|  --------------------------------------gkkrapvggvpgitrgvswykgqdil
gi|294101748|ref|YP_003553606.1|  --------------------------------------fvsdfenlwegeivrllyelplsveg
gi|294101141|ref|YP_003552999.1|  --------------------------------------srhpisrfiflyptratategfrdyv
gi|294101018|ref|YP_003552876.1|  --------------------------------------sgwgpfrssrksflvnwdteekqayl
gi|294101692|ref|YP_003553550.1|  --------------------------------------ripfphpkdpvvqsrnelegrkafvt
gi|294101032|ref|YP_003552890.1|  --------------------------------------kgtaidldvdepdlglvlqiknpkke
gi|294101031|ref|YP_003552889.1|  --------------------------------------gkavfcdvdvdapnlqlllnpqdeqa
gi|294101431|ref|YP_003553289.1|  --------------------------------------lkiqlqvcglnptvisldnyfvdrek
gi|294102167|ref|YP_003554025.1|  --------------------------------------gatiidadalaheawkdttvlrrase
gi|294101458|ref|YP_003553316.1|  --------------------------------------ytantmltdrrnvvviadeahrsqyg
gi|294102320|ref|YP_003554178.1|  --------------------------------------lviappvllektnpgswpnvfsdfrv
gi|294101940|ref|YP_003553798.1|  --------------------------------------ttqrlfmrelevstnalhglikvnsp
gi|294102120|ref|YP_003553978.1|  --------------------------------------veildeiragfdegtaykiqqavkda
gi|294101791|ref|YP_003553649.1|  --------------------------------------glgdglgargvrspsftlineyegrl
gi|294102136|ref|YP_003553994.1|  --------------------------------------kpyygknrgdtlpfcpviylglgrlf
gi|294101830|ref|YP_003553688.1|  --------------------------------------qglfavdnippallpqllellsqhra
gi|294102042|ref|YP_003553900.1|  --------------------------------------vviqsadtlllpaansmlkiveeppe
gi|294102015|ref|YP_003553873.1|  --------------------------------------vgtdkvtfqtrqhilhhmldvvdpde
gi|294102787|ref|YP_003554645.1|  --------------------------------------ryslfgcpdgrssrnlyapphggkqk
gi|294102032|ref|YP_003553890.1|  --------------------------------------ekpapddwiyaynfsdpsrplainlp
gi|294102010|ref|YP_003553868.1|  --------------------------------------gekvtiadidiinpyfcirqvsdvle
gi|294101586|ref|YP_003553444.1|  --------------------------------------hvgyikhshekvlspmdtdtgkvlsq
gi|294101458|ref|YP_003553316.1|  --------------------------------------ikqiakdivehfekrdlaqeneggkg
gi|294102625|ref|YP_003554483.1|  --------------------------------------dhpefdesirrlqaalretehkvesl
gi|294102478|ref|YP_003554336.1|  --------------------------------------rdrlkdvealqkhnvelivaddafqh
gi|294101874|ref|YP_003553732.1|  --------------------------------------viargrimtgksakseknlvrairra
gi|294102071|ref|YP_003553929.1|  --------------------------------------aifaplpdpqlilvdeesspayrmqa


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  asevmailclsesikelkerlaqivvaytydgtavtagdlnaqgsmavvlkdalkpnlvqtleh
gi|294102529|ref|YP_003554387.1|  lkerlskivvgytyngtvvtagdlnahgsmaallkdalkpnlvqtlehvpafvhggpfaniahg
gi|294102437|ref|YP_003554295.1|  gvvvdpeqllkelhtlqeqgkdrarlmisgsahvvmpyhkildkadeqfrskdkkigttgrgig
gi|294102168|ref|YP_003554026.1|  kgfaifdrndsrslvkkimedlkldpkqidptnvldhiskaktegnhktlepvglegiehevyr
gi|294101779|ref|YP_003553637.1|  ssdtyiekdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavgekw
gi|294102457|ref|YP_003554315.1|  leaarelktkptqhsvqelrrigilpdiiicrshypicdemkekialfcnvpkeaviealdept
gi|294101625|ref|YP_003553483.1|  wrdcfvniidtpghvdftveversmrvldgavavfcavggvepqsetvwrqadkyhvpriafvn
gi|294101185|ref|YP_003553043.1|  yrgefeerlkavlneiktsegriilfidelhtivgagaaegaidagnmlkpmlargelhcigat
gi|294102626|ref|YP_003554484.1|  istihsfsmrvlkecglateldpesgtiappqeslfwkeaeealdrwdgnwfakssshlwaqri
gi|294101765|ref|YP_003553623.1|  agrtfevvlrsllrqdpdiilvgeirdsetahlvmraaltghlvlstlhtddaanaplrliemg
gi|294102479|ref|YP_003554337.1|  eedivkaaqiagihtfitslpegydtevgergvtlsggqrqrvaiaraiirnprilildeatss
gi|294101904|ref|YP_003553762.1|  nyalfphmsifdnvayglkvrglsrkeaelkvkevlnlvgligvderfphqlsggeqqrvalar
gi|294102557|ref|YP_003554415.1|  syaifphlnvyeniafglrlkkmeeskirekmegvidlvgltglesrqpsqlsggqqqrvalar
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  rrvgmifqhfnlltsrtvfqnvafpleiekwetdaiskrvtevldlvdlsdkaqsypsqlsggq
gi|294101185|ref|YP_003553043.1|  appgyvgyeeggqlteavrrrpysvilfdeiekahhdvfnvllqilddgrvtdsqghvvdfknt
gi|294102868|ref|YP_003554726.1|  yalfphmtvlqnviyglkfkkidrkkamqmgdemlakvglpdsasksidqlsggeqqrvalars
gi|294102500|ref|YP_003554358.1|  dallprperktsmpdfmkifsgkeaeetppqeedtirestrnkvyallkagklderevelevae
gi|294102409|ref|YP_003554267.1|  lvqrghhfcivdevdsilideartpliisgpsednvemyttadqiarqlkegrdfekdekernv
gi|294102354|ref|YP_003554212.1|  krqisintalvtlerngkrlylldtpgfadfigemrsamrvsdsalavvsglhgvevqtgkaye
gi|294101565|ref|YP_003553423.1|  gappgyvgydeggklteairrrpysvvlfdeiekahedvfnillqiledgrltdgqghtvdfrn
gi|294101424|ref|YP_003553282.1|  dnitlcpiqakgmkkkeaedlairllervglgdkvyakpsqlsggqqqrvaiaralamqpkiml
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  gmvfqnfylfdhltalrnveiallkvkgmdkkharekamlelervgmaafadhyptqlsggqaq
gi|294101048|ref|YP_003552906.1|  kqiamvfqhygllphktiidnvefglklqgisekerrersnvalervglkgwenyypsslsggm
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  fleachhmrqevgmvfqsfnlfphrtvlenvmlapmvvkkaseeeaheialrllekvglsehah
gi|294101565|ref|YP_003553423.1|  feermrkllkelretgdviifideihsiigaggaegavdaanilkpslsrgefqvigattldey
gi|294101786|ref|YP_003553644.1|  rsqmqiifqdpyaslnprmtvsqsiaapliiqgvykssekdkiqkkvdqtmdlvglakrfansy
gi|294101493|ref|YP_003553351.1|  rkntigfvfqgfnllprmtalenvelpmlysgisarkrheralhalqivdledranhqpqqlsg
gi|294101884|ref|YP_003553742.1|  rmqrhandpdvyirsmgtrgslggvsrstreavkildacgkdvviietvgvgqseidivkladt
gi|294101894|ref|YP_003553752.1|  vrllqaadydiqaaergiiyideldkitrksesasitrdvsgegvqqallkilegtlsnvppkg
gi|294101778|ref|YP_003553636.1|  veldgfdestgiiliaatnrpdildpallrpgrfdrhivvdrpdvkgreeilavhvrnkkiadd
gi|294102313|ref|YP_003554171.1|  nhhigfifqtynlfpvynvyeniefpllllkipqkerkekifdalewlgltdkidsrpsqlsgg
gi|294102640|ref|YP_003554498.1|  hkqaqivfqdpfsslnprmsvsqliaepllinkacgsrkevdnkvkelmdtvglaerlttsfph
gi|294101376|ref|YP_003553234.1|  gekqverrvvaqllalmdglesrgqvivigatnipntldpalrrpgrfdreisipipdrngrfe
gi|294102641|ref|YP_003554499.1|  eaekrdirgskiamifqdpmtslnpimtveeqimemislhsdfkgeavrkrahemlalvgirpe
gi|294101359|ref|YP_003553217.1|  rnmalsqfrsgrtpllvatnvaargldvegvshviqmglpdnretfvhrsgrtgraghegrnll
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  rkvrgeqvsmifqdpmtslnpimivgdqiaeaikthmhvssakatkkasemmelvgidpvrmsd
gi|294101376|ref|YP_003553234.1|  ftervisqflaemsgieelkgvtvlattnridlidpallssgrfdvvlelpmpdakarleifqi
gi|294102074|ref|YP_003553932.1|  lseeefkklveekkflewavvhehlygtlksdvekvleagvdvvleidvqgalqvknafddsvl
gi|294102442|ref|YP_003554300.1|  ylgvvfqdfkllphltawenvafvlesmgmprrmvqkrtnevvdqvglwrrrflyppqlsggeq
gi|294101577|ref|YP_003553435.1|  ylpqeasifrnltvkenieivlqelgkpqkeietmvshileelgltslasipgyalsggerrrv
gi|294101171|ref|YP_003553029.1|  fqnlrlfprssvlenvmtaaqqheaysfveavthfgkwrmketsirdrsmellnrvgladralq
gi|294102413|ref|YP_003554271.1|  tfqnirlfsnetvlqnvmigchvrqkskwwmapfpvpsmiqeekeireksmkllqsvslaqdan
gi|294102187|ref|YP_003554045.1|  srpvniegtgaitirmlvrnslrmrpdriivgecrgeeafdmlqamntghdgslttlhansprd
gi|294102332|ref|YP_003554190.1|  lralrrdhigfvfqapylipfldvtdnvallpmlagkpnaearqqaiellkaldvehrakamps
gi|294102831|ref|YP_003554689.1|  seapshampiayyeptctgakaymnfsmevaerwl.............................
gi|294101321|ref|YP_003553179.1|  ghadyiknmitgaaqmdgailvvsaadgpmpqtrehvllarqvnvpavvvfmnktdqvdddell
gi|294101626|ref|YP_003553484.1|  ghadyiknmitgaaqmdgailvvsaadgpmpqtrehvllarqvnvpavvvfmnktdqvdddell
gi|294101069|ref|YP_003552927.1|  gyvpqssekvrltafdaillgrrpyvgwrlaesdikkvdaiihtlgldelalryldemsggelq
gi|294102759|ref|YP_003554617.1|  pemlnairwkdialipqgamnsftpvltigkhieevlaihlglsgearrhrcrslleeadlews
gi|294101055|ref|YP_003552913.1|  vrrrigmvfqsptpfpfsiydnmayplryygygskkksknldviirnkledvglfeevkdslsm
gi|294101254|ref|YP_003553112.1|  hqhfmlipsqtvwenmilgleglpqllpkkeihqqiidisrqyglevdpdakiwqlsigeqqrv
gi|294102760|ref|YP_003554618.1|  gyvpqdpygslpptltvldavaepwiivngrksrleayskarrllktlgieeerillsrvrsgl
gi|294101659|ref|YP_003553517.1|  niglspleirqrvdwalsvtglshkmqnptyslsggekqrlavagalaldppclvldeptamld
gi|294101172|ref|YP_003553030.1|  islvpegrrvfapltvyenlmmgafprkepekvkqdlqwvfslfprleerrdqyagtlsggeqq
gi|294102017|ref|YP_003553875.1|  ardelsrgnstfmvemietanilhnvtdrsivvldeigrgtstydgmsiawavleyldhgcgsk
gi|294101748|ref|YP_003553606.1|  vevlsrfvstsrqkriledtkkglvdiligtqrllqkdiefkdlglliideehrfgvmhkeklk
gi|294102409|ref|YP_003554267.1|  divlggnpdflaketlrkegnvedldpskyqqlleeyrqicakerdevldkgglkiigterhes
gi|294102070|ref|YP_003553928.1|  fidtaglrkksridsdieyysfvrtlqavdrsdvallvmdasepttdqdkkmaaqviekgkgli
gi|294102390|ref|YP_003554248.1|  lhsfleplgvsvvlligslknrareltlqkistgeahvvvgthalfsdpvtfsnlgfavideqh
gi|294101403|ref|YP_003553261.1|  qslyvaqpdsgeqalyvldtlvrsgavdlvvvdsvaaltpqaeidgkigdsqlglqarlmsyal
gi|294101730|ref|YP_003553588.1|  ldvieidgasnnsvdevrelkahvslsafsslykvyiidevhmlslsafnallktleeppshvv
gi|294102602|ref|YP_003554460.1|  khctvewngyliniidtpghadfsgevervlstvdsvlllvdanegpmpqtryvlmralamglr
gi|294102663|ref|YP_003554521.1|  vgmvfqkpnpfpmaiydnvaygprlqgiksrekldeivkrsligaalwsevkdnlkssglglsg
gi|294101436|ref|YP_003553294.1|  hlvtifepkkqtpatvefvdlaglsrdaskgaglgnaflsfvaesdalvhvvrtfdnpevphpe
gi|294102150|ref|YP_003554008.1|  pvrmsykskdgneyilnlidtpghvdftyevsrsiascegallvvdasqgveaqtvanaymavd
gi|294101607|ref|YP_003553465.1|  tkdavspdqmvelcemlkkegfdfilldspagieggfknaaagatealvvttpeipsvrdadri
gi|294102035|ref|YP_003553893.1|  iqlvqtgrpdfvkkgsplqfdieeaqrglelakkwiekglfdivildeinvaldyelveldqvi
gi|294102412|ref|YP_003554270.1|  kgiamspegrrilphltveenlllgayirddkegiekdmdhvyslfprlrerawqkggtlsgge
gi|294101660|ref|YP_003553518.1|  vglvfqypeqqlfaetvfdevafaprnwgvseedlekvvnetllevgipldfldrnpfqlsgge
gi|294102549|ref|YP_003554407.1|  ygigmvhqhfmlvpslpvyknvvlgdepttrglifnhhgaieavrhlsaqyglnidplapvhsl
gi|294102841|ref|YP_003554699.1|  kkiamdvlehmglagrrndpmgdlsqgqrqrvliaralasrprillmdeplasidpeargvlye
gi|294101272|ref|YP_003553130.1|  mlpqvfskekhlrknkkakglferfglngfedylpgavsggmkqrcalirtlmfereivlldep
gi|294101433|ref|YP_003553291.1|  wedvawdktdfiivdlppgtadapltvmqtidldgflvvtspqelsvmvvekalnmtkmmevpl
gi|294101963|ref|YP_003553821.1|  ldtpgheaftamrargaqatdiailvvaaddglmpqtkeainharaagvpivvavnkidkpaar
gi|294101356|ref|YP_003553214.1|  ynrtiweeisntgylgtdtekrgllgaflfsgddiyklisvlsggeksrvallkllleetnlli
gi|294102542|ref|YP_003554400.1|  tlllqntyllkravwenvafglkvrgvrgkelmksmeealyfvglapsqfarrkwyelsggeaq
gi|294101861|ref|YP_003553719.1|  lfideihrlpanveeilypsmedfslhiivgkgplannicltlppftlvgattrlglltsplra
gi|294102400|ref|YP_003554258.1|  gseakvnihdirngsfaekdwekladaagrlsqaplfiddssmlstlefrararrfksrfenlg
gi|294102043|ref|YP_003553901.1|  gflnrvcegykelskrfphrivridgsqpteevsaqiwkvvevhls..................
gi|294101077|ref|YP_003552935.1|  lfqdpddqlfcptllddvlfgplngginkeeayeqainvlktlnidnlahtppyalsggqkrlg
gi|294102348|ref|YP_003554206.1|  drakagltlawqmparyegisirdylrigpqnssernleeamdfvqmsplfldraidkslsgge
gi|294102040|ref|YP_003553898.1|  vaydalqaarasgadvliidtagrlhskhnlmeeltkivrvierevgrdsmenllvldavmgqn
gi|294101613|ref|YP_003553471.1|  sislptatetevslciredpkictikrefspetgtslfvdgmrirlqdlddvkrqwhmegeqfa
gi|294101367|ref|YP_003553225.1|  igmvhqefslipgftaaenivlnrestqynflvesfgdrlrtlnteemrqrgenaieklnvvis
gi|294101893|ref|YP_003553751.1|  rqagtknpimlmdeidkigqdfrgdpasallevldpaqnsnftdhyiesafdlsnvifittanv
gi|294101841|ref|YP_003553699.1|  vadvpgliegahenkglgiyflrhiertrvlihvldlsvgtpedvlyqwevicsefkaykesll
gi|294102070|ref|YP_003553928.1|  fyivdtggllvrdehplvegirkqatlaieeshvilfvidgfngpnwmdedvahilrrsgkpvi
gi|294102221|ref|YP_003554079.1|  pigldvipvaenlwgieidaeeeakkymkaiqdkmlhivsaviveeikrqieiaymspgaeeaa
gi|294101356|ref|YP_003553214.1|  rateediaraakneeeyhsllkrhdhlshryeqlggyefaamaqkvmkglgfsdgdgqrytstf
gi|294101345|ref|YP_003553203.1|  sfvisgrpaiqgfsvfelvalgrhpytnwkgeledrdikavekalvevnawhlsgrdfaklsdg
gi|294102145|ref|YP_003554003.1|  rvvsivdvpghekfirqmvagasgidavmlvvaadegvmpqtrehlailnllgvhdgviviska
gi|294101756|ref|YP_003553614.1|  rslenadlilyvvevddisispeddriieilqevstpiflvvnkidqvqqserrlmavaslfke
gi|294102549|ref|YP_003554407.1|  layipedriktglaplaslkdnallgyqykppflkrnffqnfrsirefalhlmerynimaasen
gi|294101372|ref|YP_003553230.1|  rlvdtagigapgdeieamgiaraekammeadvriwvidgsepltpadlalvqkisatnhivtin
gi|294101016|ref|YP_003552874.1|  diqflgnkgssqeeffhtfnqlhvskkqivicsdrppkeiqniedrlvsrfewglvtdiqmpdl
gi|294101780|ref|YP_003553638.1|  vddisglspaisieqkgtshnprstvgtvteiydylrllygrlgvpycpscgkavirysldeiv
gi|294101686|ref|YP_003553544.1|  alhnnldlfcdtdldgalshveghgfvvldsvqamrssledgwpgtpsqvravaqqcidsakkt
gi|294102507|ref|YP_003554365.1|  eppfhivhptastvaicgggaslrpgeislahrgilfldeftefrrdllealrqpledgsivvs
gi|294101471|ref|YP_003553329.1|  pyfqkihqdpgssfpqnrlirtifedffrwgyhpalssekewwnalgegmekaslserllhryp
gi|294101845|ref|YP_003553703.1|  ffcprtlqlpeeisseegnlflkrvftrngrgktfiqgklfplslfnevaapllriqsqfaqle
gi|294101553|ref|YP_003553411.1|  dhlndviifdtagrlhvdedlmeelsrlkdlvnpheillvvdamtgqeavkvatsfheklsltg
gi|294101853|ref|YP_003553711.1|  lakpvtspkkaiqalawavremeqrydifakarvrnlagynekaipkdrlphiviivdeladlm
gi|294101780|ref|YP_003553638.1|  vlvdqspigrtprsnpatytglftlirelfaelpeskirgyapgrfsfnvrggrceacsgagsv
gi|294102079|ref|YP_003553937.1|  vespylteilskikvslsdgcvyingadvtehirsprvdsivssyaalptvrrcllsiqreqae
gi|294101472|ref|YP_003553330.1|  klwgrylflmpqepstalnpllsvfrqvrevfqhlrgmdrhtartatqnlfsalgitqeasrer
gi|294102235|ref|YP_003554093.1|  vdlpgiyslgaasideqvaseflikekpelaitvvdasnlerslylvvqmleagqpliialnma
gi|294102390|ref|YP_003554248.1|  rggnqsycvllsnpttregverlkvmcattdgfkiaeadlrlrgpgevcgvrqhgitdfrvadl
gi|294101443|ref|YP_003553301.1|  ilvgtttenpwfeinktllsrlvvfqlkplaeedlvqilykalkdeekglgalklavsedvitv
gi|294101748|ref|YP_003553606.1|  yslalqdlqirgsgdiigvsqhgqdervgyrfyykmleeeiar.....................
gi|294101649|ref|YP_003553507.1|  mnggklvpdeiivgmmgerlkekdcekgflldgfprtvpqaealdqllatmnlsldavilldvd
gi|294101715|ref|YP_003553573.1|  eqsieqnlstfsahlkniihilseatrsslvlldelgagtdpqegaalgialidtlrekksitl
gi|294101925|ref|YP_003553783.1|  psnplyipfwlmnfdelafflvgakptddqrveyrllrelittfkkencklksgdvtqefitad
gi|294101367|ref|YP_003553225.1|  plsvgiasvsedrrgvgllleepiswnviftalqmqqkylkpvlgglfkirdeeairevtkkyi
gi|294101751|ref|YP_003553609.1|  ekvepyvrplydafydlfsperflryidknvieiaplaymrgrtlndsfiildeaqnttpeqmk
gi|294101046|ref|YP_003552904.1|  vgietgdfkrneeapiicctqeiytlkytkephqkliidefhyifedpdrartyidgirgtapt
gi|294101779|ref|YP_003553637.1|  vdrlrgitargeralvttltkkssedlaeyladlqfkvkyihselnaferaelirdlrsgevsi
gi|294101226|ref|YP_003553084.1|  dearhrgisidveklekllgvpvvptvalsgqginriiqripearkghippl............
gi|294101892|ref|YP_003553750.1|  lpgygyaargfkekekwaklieqyitqretlqllvhlvdfrhgllkndqelqewisqigipslv
gi|294102315|ref|YP_003554173.1|  peqrsedflpwinienataegfppseyaareaekwkkglagwgidgdrikkmresvsfsiytpg
gi|294102188|ref|YP_003554046.1|  slsdrfdyivvdlhrnfgditielaegcqriwlvtdcsctgvknlhlvtglldqlriswiergv
gi|294102320|ref|YP_003554178.1|  eypkkvllftgdskeavrdkvianfdararskkgdyrilistevlsegvnlhrsnvvvnydipw
gi|294102169|ref|YP_003554027.1|  aiqinthggchleanlvskafkelpledldvifienvgnlvcpaefdigedmkvavssvpegad
gi|294101254|ref|YP_003553112.1|  wgldvaatqfvreqlllerdrgaavflvsedleellslsdrlavifkgeimgildhpe......
gi|294102077|ref|YP_003553935.1|  vlvsdtvgfirdlppaliaafrttleeisvsslillvldgsmpdvmetldvveetlsdigagai
gi|294102510|ref|YP_003554368.1|  avdspgildprshnevhrrl............................................
gi|294101748|ref|YP_003553606.1|  vrnkslllqrgetlskwkqekgilatspggllspfltgegvfplrremgeergrllrwlevagy
gi|294101141|ref|YP_003552999.1|  swapetdgtllhgtsnyelqgmfdnpdprsekefltndrlfavglwqkrlfsatvdqflgfmrh
gi|294101018|ref|YP_003552876.1|  rgyfsgetnldivatvgekniiqcdgkrithgnvrslipalaflpgdlaivdgapsvrrqfldr
gi|294101692|ref|YP_003553550.1|  vilpqakmflrqalgrlirsksdqgrvvil..................................
gi|294101032|ref|YP_003552890.1|  nvykvvpqieaarckgcgvcadncafgalnqfgthapvvnmqlchgcgvcelvcpqkaikdska
gi|294101031|ref|YP_003552889.1|  fsftgrkipeidterctvcggcvgfcrfnalekanngitllpwkcegcggcalvcphqaismhs
gi|294101431|ref|YP_003553289.1|  tpldeqgnydfevleaidldllesqlakllkgeevrvpefdfikgkkfpgatlrlnkhdvliie
gi|294102167|ref|YP_003554025.1|  rwgtqvllgnghinpsvvasivfsdmteyewvcdmihpfvriemerkvaslqgwviaeipllfe
gi|294101458|ref|YP_003553316.1|  fgaeivmgkteadvkygyakymrdslpnasyigftgtpveltdkntrvvfgdyidiydmtrave
gi|294102320|ref|YP_003554178.1|  padyesigrldnliergtekytniiideahrfrtettityeklaeicrgkrvilvtatpynnsp
gi|294101940|ref|YP_003553798.1|  rirearegmkkhlnrlevvgeesgqrwtidrlekhvalripslvvidyltllkrpgqsdleave
gi|294102120|ref|YP_003553978.1|  dcvaiddlgaqrkdkswvderlfslidaryrsgkqtiittnacsmsqlkemlgehgtrivsrlt
gi|294101791|ref|YP_003553649.1|  plahvdlyrlergdeyelglceyaddgfvlviewpdrlaeqpt.....................
gi|294102136|ref|YP_003553994.1|  pfgefqndeairgvkgelpstyqdeiktfyedftgisiessspqqmgdfktradfisdvegids
gi|294101830|ref|YP_003553688.1|  avqeglaavvdvrggrllndlfsvvdslkgtiplvqvlfldssdeslvrrfettrrrhplgdhi
gi|294102042|ref|YP_003553900.1|  hgvilfllendkflptlksrcwnlal......................................
gi|294102015|ref|YP_003553873.1|  vfsaadfvdksmaaierimnrgkiplfvggtpfyyhalfegvltkdlprdrkltdelekfaskh
gi|294102787|ref|YP_003554645.1|  gsliieslkgerfslvmngrnstfsgarngtsledllgyvdremyerifsvgledmqkirplnd
gi|294102032|ref|YP_003553890.1|  agkgkemgsafeellselkiaiskafeksqyedakaqlvknfqeqvnglmeevrawagekgfal
gi|294102010|ref|YP_003553868.1|  kkglsvitmpeqakwldmslvtpkvdwalhdestrllmdiggdaegalalkqfepiikkvgyrl
gi|294101586|ref|YP_003553444.1|  gipalywgvdgcryekpgeisiydiqnrigsnfdillleggksfpchkiw..............
gi|294101458|ref|YP_003553316.1|  mivamsrriaidlykeivalrpdwhsddlmsgkikvvitgsssdpsdwqafigskadretlakr
gi|294102625|ref|YP_003554483.1|  gelqdrigpagqvrfsgseavsflhhwtsmatiwlppaikgalslfigtppvleknslwimpni
gi|294102478|ref|YP_003554336.1|  rrlgrdvdivlvdaccpfgngrlvpagilreppkaiqrahivvitkadqvs.............
gi|294101874|ref|YP_003553732.1|  lfefpehreevvsflekqapctvmiiatstamalkivrilnlpqperfi...............
gi|294102071|ref|YP_003553929.1|  apllhi..........................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  vpafvhggpfaniahgcnsiqatkyglklsdyfiteagfgadlgaekffdikcregnlhpsavv
gi|294102529|ref|YP_003554387.1|  cnslqatkyglkladyfiteagfgadlgaekffdikcrignltpsavvivatvralkmhggvak
gi|294102437|ref|YP_003554295.1|  pcyvdkfnrcgiriedlfdpdilreklsfnlelknllltkvynaepvafddiyaqarawgkale
gi|294102168|ref|YP_003554026.1|  kyhdelrrqnavdfddllilplhllmvdeklreqeqsrldwilvdeyqdvnkpqyfllrrligt
gi|294101779|ref|YP_003553637.1|  drrgfmerlidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidpvsg
gi|294102457|ref|YP_003554315.1|  iyqvplslqaqefdrlvmrllsf.........................................
gi|294101625|ref|YP_003553483.1|  kmdrvgadfyqvvngirtrlgarsvplqlpigsedrfsgivdliqmkavffqddlgtapvvgei
gi|294101185|ref|YP_003553043.1|  tideyrkriekdaalarrfqpvlveqpdvedtisilrglkerlevhhgvrirdnalvgaavlsn
gi|294102626|ref|YP_003554484.1|  aklfsdplfmdsvntfgpnatvelaksslalfasqgqtpkdlwqwgsdlfsrdqdavdtarltl
gi|294101765|ref|YP_003553623.1|  vppflivsslkavvsqrlirllcplckkpdsnspvgcsycggrgfhgrvgvfeylpitervqel
gi|294102479|ref|YP_003554337.1|  ldvavesqiqeamekamegrtsfviahrlstvrsadrilvlskghivesgthdellekggiyrh
gi|294101904|ref|YP_003553762.1|  vlvidprvllmdeplsnldaklriymraeirkiqkklgitcihvthdqkealtiadrivvlnkg
gi|294102557|ref|YP_003554415.1|  aiimepalllfdeplsnldaklreqmrieirhlqkrlgitsvyvthdqaeamsisdrvvvmnkg
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  kqrvgiaralannpslllcdeatsaldpkttqsilalldeinrklgitivlvthemgvirqich
gi|294101185|ref|YP_003553043.1|  viimtsnigaplllegitgdgqikedareavmkelrqafrpeflnrvddvvlfkplqrheirqi
gi|294102868|ref|YP_003554726.1|  lvtepkvllldeplsnldaklrirmrreirqlqkgigitaiyvthdqeealalsdrivvmekge
gi|294102500|ref|YP_003554358.1|  sasmgipilggagmdsmgmninemlsgllpkktkkrrmkvsdgkkllqaeeaeklidmesvare
gi|294102409|ref|YP_003554267.1|  aftedgiarcenllkmpglfsdaansdlahrivqavkahvlfqkdvhyvvkdgeiiivdeftgr
gi|294102354|ref|YP_003554212.1|  yaedfsipvafvvskldrensdyartlddikkqlsdkavpfflpigkeasfkgvvdilnqkaye
gi|294101565|ref|YP_003553423.1|  aviimtsnigakdwvkgtslgfsisgeadgyfdwdktksdildavqktfrpefinrvdemvvfr
gi|294101424|ref|YP_003553282.1|  fdeptsaldpelvgevleviaqlaetgmtmviithemlfakdvsdriifmadgniveqgspqdi
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  rvsiaralamdpdvmlfdeptsaldpeligevlevmrnlakggmtmlvvthemgfacsvaneim
gi|294101048|ref|YP_003552906.1|  rqrvgiaralvmdtpillmdepfsgldplirremqdelirlqkelkktiffvthdldeamrmgd
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  kypatlsggqtqrgaiaralamnpkvmlydeptsaldpelvgevlqvmkdldnegmtqiivthq
gi|294101565|ref|YP_003553423.1|  rkyiekdaalerrfqpvmveepsvddtisileglrdryeshhrvkisddalvaaarlssryite
gi|294101786|ref|YP_003553644.1|  pheldggrrqrigiaraltlnpkfivcdepvsaldvsiqaqilnliqdlqvqfgltylfithdl
gi|294101493|ref|YP_003553351.1|  gqqqrvaiaralandapliladeptgnldsktgidvmklfvrlnvesgktiiqvtherdmalfg
gi|294101884|ref|YP_003553742.1|  vclvlvpgmgddiqimkagimeiadifvvnkadrpgaekietevklmldligktdwfppihmtv
gi|294101894|ref|YP_003553752.1|  grkhpyqdfiqmdtsnilficggafagieevigrrvnkkmigfggdilsvkehrnyelmrqvqp
gi|294101778|ref|YP_003553636.1|  vdlgvvarrtpgfvgadlanlvneaallaaragkslitmaefeegidr................
gi|294102313|ref|YP_003554171.1|  ecqrvavaravvkrpeliladeptanldsensynilemmvrlnkelettfifathdekvmkylr
gi|294102640|ref|YP_003554498.1|  eldggrrqrigvaralaldpefivldepvsaldvciqaqilnllgdlkkergytylfishnlsv
gi|294101376|ref|YP_003553234.1|  ilqihtrgmplaedvdlmrlsdithgfvgadlealakeaamsslrellpcidyeqavipyekll
gi|294102641|ref|YP_003554499.1|  rgkeyphqfsggmrqrvgiaialaceptlliadepttaldvtiqaqvldliknlqkivntslll
gi|294101359|ref|YP_003553217.1|  vlspkea.........................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  yphqfsggmkqrvviamalacnpkvliadepttaldvtiqaqvlemmnelkkkfnmatilithd
gi|294101376|ref|YP_003553234.1|  hlqkkplaedvhleelvrsteghsggdihficrkasalairdflkigekgapciekhhfeials
gi|294102074|ref|YP_003553932.1|  ifimppskeelerrlrnrgteeedtvqlrlsnalkemekmhmydyvvvndsvlraaleikriia
gi|294102442|ref|YP_003554300.1|  qrvaiaramanspaifiadeptgnldihtaedvmrllvalnaagatvimathdqylvdayrqrv
gi|294101577|ref|YP_003553435.1|  eiarclsimpdfllldepfsgidpiavydiqqiilslrakgygilltdhnvrdtlaitdrtyli
gi|294101171|ref|YP_003553029.1|  pagtlpygyqrrleiaralaldprlllldepaagmnpeevmalneliksihmefqlailviehh
gi|294102413|ref|YP_003554271.1|  vlssslpygaqrrleiaralatdpsfllldepaagmnpletvdlmsfirrirdefnltillieh
gi|294102187|ref|YP_003554045.1|  vlsrlesmvlmagmelpvraireqissgidlivhqerlkdgtrr....................
gi|294102332|ref|YP_003554190.1|  qlsggeqqrvaiarglvnrppviladeptapldseralavirilndmaqrfetavivvthdeki
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  dlvemeirellskydfpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapqre
gi|294101626|ref|YP_003553484.1|  dlvemeirellskydfpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapqre
gi|294101069|ref|YP_003552927.1|  kvtiaralvqeprillldepissldvknqieimetmkhiikghglsavmslhdltmalrygdrf
gi|294102759|ref|YP_003554617.1|  lanryphelsggqkqraaiatalacdpdflladepttaldvitqkeiiltlerlargrnmglll
gi|294101055|ref|YP_003552913.1|  natllsggqqqrlciaralavepeillldepcssldvkntqniemmlralcqqysiiivthnlf
gi|294101254|ref|YP_003553112.1|  ailqmlyrkaqvlildeptavltpqealrlfstiqqmtaeghgivfishkldevlslsdrisil
gi|294102760|ref|YP_003554618.1|  sggqrqrvsiarslilepalllcdeptsmqdastrseiihvlnervkegmamvfvthdlylarg
gi|294101659|ref|YP_003553517.1|  pqgrrdlldvlktlhaqgrtiiyithrleetvhcdralvlksgkvqwdgtiselfrhte.....
gi|294101172|ref|YP_003553030.1|  mlaigralmsrprlllldepslglapiiirdifkelrrinsegvtillveqnarqalllshrgy
gi|294102017|ref|YP_003553875.1|  pkvlfathyhelvaledhlnglknlsmavhegergisflykvvdgpadrsygievarlagippa
gi|294101748|ref|YP_003553606.1|  dtregldvltlsatpiprtlslslrglrsfsiistpp...........................
gi|294102409|ref|YP_003554267.1|  rridnqlrgrsgrqgdpgssrfylsleddllrlfgseriqgimeklgmeegeai..........
gi|294102070|ref|YP_003553928.1|  llinkwdtleaadklgdemrkrvrdempflshapllfvsaltkrglnkltqtiknvqenrsrri
gi|294102390|ref|YP_003554248.1|  rfgvlqknalrakganegqaphilvmtatpiprtltlsvygdlsvsvidempp...........
gi|294101403|ref|YP_003553261.1|  rrltsaisrsncvvvfinqlrakistgyssgpqetttggralkfyssvrvevkrgksinkgeda
gi|294101730|ref|YP_003553588.1|  filattephkvpvtirsrcqhipfrkidvqnivkslsmvahnenrnaeeealweiarqadgamr
gi|294102602|ref|YP_003554460.1|  pivfinkvdrphanpmsalnqtfdlfielgaaeeqldfpvlygsgldgwavrdlnkyahegmkh
gi|294102663|ref|YP_003554521.1|  gqqqrlciaraiatepevllmdeptsaldpmatarieelvrtlkerytviivthnmqqaarisd
gi|294101436|ref|YP_003553294.1|  dnidpardwnivemeliyrdlgvidnrlsrlaakkrllpeeeeekkllercqaflmeekplrel
gi|294102150|ref|YP_003554008.1|  qgleiipvinkidlpsahpesvqkeieevvgidadgailasakegigiqdilerivaqvpapeg
gi|294101607|ref|YP_003553465.1|  igllesmekkpirlvinrvkpsmvkegemldvqdvldvlaieligivpdddsvvksanrgeplt
gi|294102035|ref|YP_003553893.1|  dilkkrppfvevvltgrnppvalleyadlitemkeirhpfqkgitgrrgiey............
gi|294102412|ref|YP_003554270.1|  qqmlavgralmsrpdlvmmdepslglapmlvkevfdiireinaqgktvllveqnafaalkvahh
gi|294101660|ref|YP_003553518.1|  krrialasvlaaepaylvldeptagldatgrkdlikllskqkkkgrgiifvthdletalmssds
gi|294102549|ref|YP_003554407.1|  pvgiqqrveilkllyrkaeilifdeptavlspreieglfsiirefrkagktiifiahnlnevla
gi|294102841|ref|YP_003554699.1|  dlasfagnvtiilvshdlsviangatavacv.................................
gi|294101272|ref|YP_003553130.1|  lsaldaitrrslqslllslqkdfkktvlmithdidealyladtvlvltqapmkirdritlpsek
gi|294101433|ref|YP_003553291.1|  lgavenmsyvtcpdcgkaievfgpshvkeieekfslpvlgkfpldlelshlgdqgr........
gi|294101963|ref|YP_003553821.1|  pdrvrqqlsdvglvpeewggdsimvdvsaktgegiphllemvllvaemeelradp.........
gi|294101356|ref|YP_003553214.1|  ldeptnhldmrtrdifqqalteyhgtiiivshdryfldklvsrvieiregkileypgnysyfiq
gi|294102542|ref|YP_003554400.1|  rvalasrlaikpevllldeptasvdrvsaelikqgvrmcrekwgttlvlvshdvlwvkslsdrh
gi|294101861|ref|YP_003553719.1|  rfgiveqlalynvdetseivqrgakvlgieieeeaayeiarrsrgtprvairllkrvrdvaevr
gi|294102400|ref|YP_003554258.1|  livvdylqlmsfarridskqqevaeisralkgvareldvpvialsqlsraveqrnekmpqlsdl
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  alaavlamkpdlllldepssglderawqnlvdvlnqldmaliiashdipflehvtrrgyelssg
gi|294102348|ref|YP_003554206.1|  rkrielasiylmkprlaildepdsgvdllalrevlgllrlladqgsgvmvithredvaagcdrs
gi|294102040|ref|YP_003553898.1|  gfaqaesfhkalslngvilskydntakggvilaiahrlalpiryiglgesvddlrlfepqefvr
gi|294101613|ref|YP_003553471.1|  figqgevaeaihhrpqqrrsilealfgidqyrkkredanqklkfaseelarletlvseltsrrd
gi|294101367|ref|YP_003553225.1|  pdtlvsempvghkqfteiareidkkktqllvldeptavlteseaeillasmrklaalgiaivfi
gi|294101893|ref|YP_003553751.1|  thtipaplldrmevirlpgyvaeekihiakkhllpklfkehgltdkmisitsktvektirdytr
gi|294101841|ref|YP_003553699.1|  erpymvvgnkidierghenapaiesfmkarnipyyntsaitgegiaefmgnivalcrehtrphs
gi|294102070|ref|YP_003553928.1|  vvanklddgihedrvydayslgfehvvgisalhkryiddlmdmavsllpsdeee..........
gi|294102221|ref|YP_003554079.1|  ifdkfielmesignpydvivfdtaptghtlrlitlpeilgiwiehliekranamelmkvaakyd
gi|294101356|ref|YP_003553214.1|  sggwkmrislaamllsspdillldeptnhldtesmewledwllnfngtliaishdrhfldkict
gi|294101345|ref|YP_003553203.1|  esqrvliaralaqdtpillldeptafldlprkvellsllrqyawkmnkgvlmsvhdidlalrfa
gi|294102145|ref|YP_003554003.1|  dlvdeellelaiadvtdfvqgtflegkvvvpvssvtnknipllmeelaklidrvqprtrrgpff
gi|294101756|ref|YP_003553614.1|  klpivgalgvsakkgynidklvqilkdklpagfpwydeeiltdrperflageiirekvlllth.
gi|294102549|ref|YP_003554407.1|  iqagtlsggnmqrlvmareleqqpdfllvsqptrgvdiggisfihdrllslrragkailmisad
gi|294101372|ref|YP_003553230.1|  kadlplviseemingllpqspvfvisaekregiealkdai........................
gi|294101016|ref|YP_003552874.1|  etriailqkkaqirnyevpedvisflaqnvpsnirelegalnri....................
gi|294101780|ref|YP_003553638.1|  dvifrnypdqrleilspqvrgkkgefknlfaqnrekgfmrvrvdgtiywleeeialdknkrhti
gi|294101686|ref|YP_003553544.1|  gipfvvvghitkegriagpmllehmvdavllfsgedtsayrmirgtknrygntdelgifemtek
gi|294102507|ref|YP_003554365.1|  raagrvefpcrvlllaacnpcpcgwagdpvescscsayekeryskrlsgpildridlhvsvprl
gi|294101471|ref|YP_003553329.1|  cqlsggelqrfallrallfsplflvadeptsrldpsvqakvahmlveeahvksiavlfishdev
gi|294101845|ref|YP_003553703.1|  lldsdrqrdildsyggeeiiclknelrsvfsnallkekelrsvekkqkevidryenansilqsf
gi|294101553|ref|YP_003553411.1|  vvlskldgdarggaalairattqvpikfagvgegidaielfdakrmaqriigmgdvmglaekvq
gi|294101853|ref|YP_003553711.1|  ftaqkdvedyicrlaqmaratgihlllatqrpsvnvvtglikaniparvaftlpsqadsrtiid
gi|294101780|ref|YP_003553638.1|  kvsmlflpdvyvdcevcggtrynretlevrykgrniadvlnmtvddafeffkeipriasklali
gi|294102079|ref|YP_003553937.1|  egglvadgrdmgtvvfpdatikiyltasdsvrakrrhlqllergekvsfdevlrqiqnrdqfds
gi|294101472|ref|YP_003553330.1|  pgklsggmaqrallamalaspaefilldeptkgldssrkedatalvkgiinagktllcithdfs
gi|294102235|ref|YP_003554093.1|  dvaenkgirihreklekalgvpvvptvarerkgledlvkrvkdrfengvsl.............
gi|294102390|ref|YP_003554248.1|  lkd.............................................................
gi|294101443|ref|YP_003553301.1|  lakmaggdarqaltrlellassvaasgaaeltmah.............................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  devvvkrlcgrrmcrqcgeiyhvtfkpssqgmrcekcggelfqrdddketvirsrlkvyhdqta
gi|294101715|ref|YP_003553573.1|  atthhnpiksyalttphvetasmefnvetlaptyhllmgipgrsnaiyiaerygmpsevlqkar
gi|294101925|ref|YP_003553783.1|  spipfsarklwyemnwwlnasfestkkdeqkretkyeinkgdyenligaeftshlttannqpph
gi|294101367|ref|YP_003553225.1|  dtleikctgdyqrvqelsggnqqkvclakafalhpkllfvseptrgidvgakrvvldtlreynq
gi|294101751|ref|YP_003553609.1|  mfltrlgfgskavvtgditqidlpsgkksgliqvreilegikg.....................
gi|294101046|ref|YP_003552904.1|  tsilvmsatfsqpgvigryletitersftvyesqervtdlvyvpkkpaqlfsvhdalvfvfsqr
gi|294101779|ref|YP_003553637.1|  lvginllregmdlpevslvaildadregflrshrsliqimgraarntrgqvvlyadvetesirt
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  vftkadkiskgrhkgmlhsyirkglksievpfivsaqdksgvgefrqfltqyl...........
gi|294102315|ref|YP_003554173.1|  snsgikvnvlgsfrcpsekiindhdlflekvqnttstllsllniesdplsgrehlliskifeqs
gi|294102188|ref|YP_003554046.1|  ivnkaeredrsivekiqreygvkgllpfdeklekgwlkgeplilsqprspyskvireiaselvg
gi|294102320|ref|YP_003554178.1|  nptrmmqrvgrinrvdtpfdvihtfnffpttqsndqiklkeaaegkinafltllggdaellt..
gi|294102169|ref|YP_003554027.1|  kplkyphlfseakavlltkmdlapyvpfdmdlykndlqhlnprvecieiealngkgidrwvslv
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  prlivlnkidkidlslipflqtrlqgrskakvlpicalsgvgvtellqevey............
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ervdlvwtpgqyvvrgfivdiydpayalpirieffdeivesirsfhpqsqmsaatldeieihsi
gi|294101141|ref|YP_003552999.1|  dyrsscllplladsavvfdeihsfdqtlfsallgflrefnvpalcmtaslpinrldqlreaglk
gi|294101018|ref|YP_003552876.1|  lcallfplyvrkmsdcrralrhrvillrerkdpsltskvlaplvswiwstraaavdllkigiqe
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  sigimniknqesfwflegildigepnpvplihavlkkadslpfpqivdgppgnacpmvaaveqs
gi|294101031|ref|YP_003552889.1|  yeqgqywrgtttygplwharlhageensgmlvarlkkesrkealkegvpfividgppgiscpai
gi|294101431|ref|YP_003553289.1|  gihglnekvtavvpeemkfgifvspltginldehnrtsttdnrllrrmirdyrtrghsaertld
gi|294102167|ref|YP_003554025.1|  nripwwvdlsvyvtapldlrlarnevrgwnkeeierrerflrnaeekraeadlvirndssidtl
gi|294101458|ref|YP_003553316.1|  dgttvkifyesriakldlpeemkp........................................
gi|294102320|ref|YP_003554178.1|  kdilsllklfqkgqkstipnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlk
gi|294101940|ref|YP_003553798.1|  evmprlktltqrlkirtlilsqlgraskldqrkgatgghakgggiveelvhseieiqkdgldkn
gi|294102120|ref|YP_003553978.1|  ema.............................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ntisagednlfilltaiislkyyyeatalshevtsillvdeidatlhpsilykllklfedysnr
gi|294101830|ref|YP_003553688.1|  pvlegiqkerallapvreyadvvldtsglsirglkdrliae.......................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  gnqalhdqlsaidpkrasqlhvndvr......................................
gi|294102787|ref|YP_003554645.1|  rgiqsrffsagaglgtaslptflaslsnqekalyriqggarssaeinvflkkiqetkeqikllq
gi|294102032|ref|YP_003553890.1|  krtpqgfvnipmieettesgdvskrelqqeefeslseekqkelqgkseeisqrtldtlrkirdl
gi|294102010|ref|YP_003553868.1|  ilvvnafrpqtasvtriqkmmkkmesicglevgalisnshlmh.....................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  mkdrndelklvivrdmwltgfdvpsmhsmyvdkpmsghnlmqaiarvnrvfkekqgglvvdyi.
gi|294102625|ref|YP_003554483.1|  tasiwpgkmsessllpdrhklalhdltgterghlpllkekrdqrealfrrlvacgedllilssp
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ivatvralkmhggvakseltgenlealskgipnlekhienmqgfgvpvvvainrfptdteaelk
gi|294102529|ref|YP_003554387.1|  neltgenlealskgipnlekhienmkrfgipvvvainrfptdteaelelvkehcvalgvqqvls
gi|294102437|ref|YP_003554295.1|  pyvadvslalreamlegkgilfegaqgtlldvdhgtypfvtssspiaaggcvglgvgpsdvdrv
gi|294102168|ref|YP_003554026.1|  kgnimvvgdpdqsiygwrgadmtmilnfekdfpaakvvvldqnyrstgnilkaanaviisnerr
gi|294101779|ref|YP_003553637.1|  htlkqlpkasifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtrydmem
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  pgelmadvkkardllienladfdesvmesylegqdvpeetlrrairentiqqrivpvlcgsafk
gi|294101185|ref|YP_003553043.1|  ryitdrflpdkaidlvdeacamirteidslpaeldaasrkvmqleieeaalkkekdaaslerls
gi|294102626|ref|YP_003554484.1|  frrwedewhrflqpesgifynlnelggtgklcgnvrnlitrwqqqpskenlphfiqslieglkg
gi|294101765|ref|YP_003553623.1|  llhkapvqkirtqarkegmrtlvengmlkverglttyeeil.......................
gi|294102479|ref|YP_003554337.1|  lyelqf..........................................................
gi|294101904|ref|YP_003553762.1|  kieqvaapfelyanpatlfvadfigqanifkg................................
gi|294102557|ref|YP_003554415.1|  rieqvgtpielyarpsnsfvaafigkvnfmpak...............................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  rvavlehgqvvelgavkdvfmkpqsktaref.................................
gi|294101185|ref|YP_003553043.1|  vkllaqelqkrlkdhridlelseeavdyiadagydpvfgarplkrfivkqletrmarslvagev
gi|294102868|ref|YP_003554726.1|  iiqidtprniyfhaqnsfvadfigrsniit..................................
gi|294102500|ref|YP_003554358.1|  aldkaqeegiifideidkvvargtssgpdvsregvqrdllpivegstvqtkygtvktdhilfia
gi|294102409|ref|YP_003554267.1|  lmfgrrysdglhqaieakekvrvgresqtlatitlqnyfrmyrklagmtgtavteseefkeiyg
gi|294102354|ref|YP_003554212.1|  yvtdgsgsfkeisipaemvdevsaaresliesvveaddevmmmylegdeisheeivkvarkair
gi|294101565|ref|YP_003553423.1|  plskkemlvivdimlsdvrerlryqdidikvseeakafilekgynprygarplrrkiqqliedr
gi|294101424|ref|YP_003553282.1|  mvkpahprtqaf....................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  fmeegrilesgspdkllntpqyertrqf....................................
gi|294101048|ref|YP_003552906.1|  rmavmkngtivqmgapaqilanpadeyvarfvqdk.............................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  mrfarnasdyivfmdggeivemadgdvlfetpqnkrtkaf........................
gi|294101565|ref|YP_003553423.1|  rflpdkaidlideaaararlktmeipanlkdiehdleevrkekeaavtsqefekaarlrdterk
gi|294101786|ref|YP_003553644.1|  svvkhlstnimvmylgqvveladskklfknpvhpytktl.........................
gi|294101493|ref|YP_003553351.1|  sriitvkdgtivhderv...............................................
gi|294101884|ref|YP_003553742.1|  aekgdgvaelvegiekhgaflkqsihgikkqkrklaeeikdilsrdiaknv.............
gi|294101894|ref|YP_003553752.1|  edlmafgfipeligrlpvvvpleeldddalarilvepknalirqyqktfeiegvklffeqdaik
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  rkihlfdgrvaqde..................................................
gi|294102640|ref|YP_003554498.1|  vryvsdevavmylgqvvekagntilfkdplhpytqal...........................
gi|294101376|ref|YP_003553234.1|  smnvtmenfldalkevepsa............................................
gi|294102641|ref|YP_003554499.1|  ithdlgivaeicdevaimyagrlveysdirqlyskpmhpytqg.....................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  lgivaqtcekaaviyageiveygtvheifknmrhpyti..........................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  synl............................................................
gi|294102442|ref|YP_003554300.1|  velqegrivrdeekg.................................................
gi|294101577|ref|YP_003553435.1|  hqgeiviegspdevaqsevarkfy........................................
gi|294101171|ref|YP_003553029.1|  mdlvmeicpriicmnfgakiaegspeeiqansevlkaylge.......................
gi|294102413|ref|YP_003554271.1|  dmkvvmgiceyiwvldygkliaegnpdeiqsnprvieaylge......................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  iptfkriyhirdgvtyeeegq...........................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  tdkpflmpiedvftitgrgt............................................
gi|294101626|ref|YP_003553484.1|  tdkpflmpiedvftitgrgt............................................
gi|294101069|ref|YP_003552927.1|  vfmkkgeiryilardeis..............................................
gi|294102759|ref|YP_003554617.1|  vthdlplavqicdaiavmhegeiveegapadivtkprhrhttq.....................
gi|294101055|ref|YP_003552913.1|  qarrishrtffildgeiieagptkdlfenp..................................
gi|294101254|ref|YP_003553112.1|  rkgekt..........................................................
gi|294102760|ref|YP_003554618.1|  aakrgivllegecceensteallsapkhaytralv.............................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  vlqtgsiimagtsedllnsadirnaylg....................................
gi|294102017|ref|YP_003553875.1|  vlkrafhlletfe...................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  gttelnrlirdvlafqtlptsrkgrvlkiyyctqtsiepptfvffvndpeivsqsfnkhienki
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ighelwmkvvknkqappfrtahasliygkgv.................................
gi|294101730|ref|YP_003553588.1|  dalslleqvma.....................................................
gi|294102602|ref|YP_003554460.1|  lfetiaeyvpapkvnlhap.............................................
gi|294102663|ref|YP_003554521.1|  ytafflmgelieygktpklftspg........................................
gi|294101436|ref|YP_003553294.1|  glsedeqrklsgfafltlkpemivlnldetqteghvpgldaimsiakerglglvqvfgrmemem
gi|294102150|ref|YP_003554008.1|  dteaplqalifdsvynnyrg............................................
gi|294101607|ref|YP_003553465.1|  sgdtslasmafsniadrllgkev.........................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ayilevgsivlsgpgedllknprvkeayl...................................
gi|294101660|ref|YP_003553518.1|  ilvleggrevvqgapgkiieels.........................................
gi|294102549|ref|YP_003554407.1|  vsdvitvmrkgkhiatlprseat.........................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  prnldsseyiaik...................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  liltegelstss....................................................
gi|294101861|ref|YP_003553719.1|  qspsintavasvalnm................................................
gi|294102400|ref|YP_003554258.1|  rdsgaieqdadlvmllyrpgyydtaaspeeednratiriakhrngptgdvnlvfl.........
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ylmcdgriilegsaaavkry............................................
gi|294102040|ref|YP_003553898.1|  alle............................................................
gi|294101613|ref|YP_003553471.1|  eiaamvtiaekarrlldeldekrrgyyfsrraflerelysfqsrihalerrknraaewetiwke
gi|294101367|ref|YP_003553225.1|  shrlhevidvcdkivvlrdgqvvhettpak..................................
gi|294101893|ref|YP_003553751.1|  eagvrnlqrslatlcrkv..............................................
gi|294101841|ref|YP_003553699.1|  ei..............................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  kdlqekikedpiidtlqarrdkfalarkiltdkkntafyfvlnaeklpiietkraieilqkhdi
gi|294101356|ref|YP_003553214.1|  staelsqgaislykg.................................................
gi|294101345|ref|YP_003553203.1|  driwvmspshsftvgipedl............................................
gi|294102145|ref|YP_003554003.1|  mpidrafpisgfgt..................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ldeilslsdriavmnrgeivavlprkeasr..................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  evvidrlkvlddrkgriseaveaalslsggyvllvteggkeqlltenyacpdcgislpeieprl
gi|294101686|ref|YP_003553544.1|  gl..............................................................
gi|294102507|ref|YP_003554365.1|  lpkelisfedqsgedsetvrqrvcearekqrlrwrkygfhcnaelperiikrelnlgtdvrpfl
gi|294101471|ref|YP_003553329.1|  llnalcsriirl....................................................
gi|294101845|ref|YP_003553703.1|  ksispesnseaiwegrlerisksidehtkleqilarltggktgegiadsienlcleltqiispd
gi|294101553|ref|YP_003553411.1|  qvtsqedvakitkslkkdkltmedlllqfeqieklgpldkvidml...................
gi|294101853|ref|YP_003553711.1|  vsgaekllgkgdmlfvsprfpkpvrlqspyiedgksle..........................
gi|294101780|ref|YP_003553638.1|  qeaglgyirlgqsaltlsggeaqrvklakelskrftgptlylldepttglfytdvkkllhilhr
gi|294102079|ref|YP_003553937.1|  nreiaplcqasdaifvdtssmtedevvdylvrlvke............................
gi|294101472|ref|YP_003553330.1|  lpkqiggqtgvlfsgllvesgdsqivlqhpshpytqgl..........................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  plisyydekgllrkvnagtssssvmaeiealv................................
gi|294101715|ref|YP_003553573.1|  atlkeq..........................................................
gi|294101925|ref|YP_003553783.1|  vsqhkdfysyekkllarlkdsrfnfmfhpgdykdassskdlhnllnewigsenklaildlsgvp
gi|294101367|ref|YP_003553225.1|  krgttivmisseleelrsicdriaivnegkiagt..............................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  gtmdlaytiartrrrlpreqrsrlyelatildvpkvqmpllcgigiyhgsmlpkekllvesafr
gi|294101779|ref|YP_003553637.1|  svqetrrrreiqmlfnekhgiipqtis.....................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  wrngkdvdlpmiingiqtppfaqigvmptdtfyppserfklalalnqilaspafnqwmtgvple
gi|294102188|ref|YP_003554046.1|  ke..............................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  etwlke..........................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  taarekkleemipdschtvlfepsqienkaesy...............................
gi|294101141|ref|YP_003552999.1|  ifpesiasfpdlkekasamryrvkqckkeealeealkaykngekvlwvvntvkrcqeiamelqe
gi|294101018|ref|YP_003552876.1|  frillpsdivltferggaldlqdpmqdywesvrkwrekehitgvpqvgpqrddmiittkgqsvs
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  nfvilvteptpfglsdlalatetvrelhipagvvinrsdlgnieeaeifcknlalpilarlpfs
gi|294101031|ref|YP_003552889.1|  saltgatlavavtepslsglhdllrlsklcasldvplaivlnksdlseakgeeikneakkenwh
gi|294101431|ref|YP_003553289.1|  lwpsvikgareyifpyqssavamfnsslpyelavlrgyaqpllqtvpesssmhgearrllsmlk
gi|294102167|ref|YP_003554025.1|  eqslsr..........................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ylmvrrtraeie....................................................
gi|294101940|ref|YP_003553798.1|  gqprliatitkarhgtkgsfeleyig......................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ykiqiictshslsliefalarkynviylldn.................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  qqkdeylqkkeelektghqiesarknleairydlslmewvekarspwvemteaqrkleeigevl
gi|294102032|ref|YP_003553890.1|  ekalkeeigkleaeicrsaitpylqdvkekygtteilckwidalaediisnfnifvaaakdest
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  stdalgkplppspflg................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  lvhercaafgvpvalseiwakggeggielaerileavekpnsfhplydvaqspkekiekiakei
gi|294102529|ref|YP_003554387.1|  evwakggeggielaervleavekpntfhklydaslspkekiekiakeiygaksvaymaqaekdl
gi|294102437|ref|YP_003554295.1|  igvvkayctrvgegpfptedlgdhgqtlrdrggeygattgrprrcgwldmvalkyavrvngmss
gi|294102168|ref|YP_003554026.1|  rkknlwtardmgekiyvllapneyqeadfilsemhrlhnfcgyrygdmavlyrinamsriyeqk
gi|294101779|ref|YP_003553637.1|  laevgycsgienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdrarktt
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  nkgiqllldavvdylps...............................................
gi|294101185|ref|YP_003553043.1|  vlqkelqeareeadalraqyesekeviskvrkmreeidavkreiekaereydlnkaaelkhgrl
gi|294102626|ref|YP_003554484.1|  asgklaneiafhlkepvsqyrnrlikeepwitvftqgfdekeqayrscllgfsailwqlwdefr
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  regskvyvtvkdkalaf...............................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  agafssvkpsdlvpelqgrfpirvelqplgreelarilvepenslikqyqallsterievrfse
gi|294102409|ref|YP_003554267.1|  ldvivvptn.......................................................
gi|294102354|ref|YP_003554212.1|  erqifpvlpasgtanigvhqvldflgdmfps.................................
gi|294101565|ref|YP_003553423.1|  madmllegkikkgslvsidedk..........................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  iseeleekkkdwqsrryqekplvsfddiativsewtnipvtqlteeetqrllrm..........
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  aiakearkkntgarglrsimeylmldlmyeipsrsnevekiiitkevvek..............
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  remdtfdgtplrlywr................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  adlsedeqrefmadlgikeagrerliqeaysllglisffttgkdevkawtlkkdata.......
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  glsfyqslfnsyeqqkkvheerteslgfqretlrrqcfataltvksarerliaqkeekrhveev
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  giggvivnkvipeeagpffekrrvdqeqylkqidemfggfgvariplldsdikgieql......
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  fsfnnpygacpdcsglgshehfseehaidpvrsveegallpwkkkhymlrklytfsqskewdlt
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  irmadnlrlsgrgisrvlkvartiadldnssrvrvphisealay....................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  tekgskyqelgnnalvflqklsqsltvllseqslsdlyaeqeeienklgtlrklkrlagvrtle
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ivdqgntvvtiehnldvllssdyiidlgpeggmeggs...........................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  fevldiaiglitrfvydsmywgkyesytgknrplllayeeahtylnkndnnsysknaverifke
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  erildvvvgtnalalgvnlpaesvifaqlvqfhdnapiskneflqmagragrkglfdtgyvtwl
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  igsflhspegkprasiftvshlsdnermffismvlneivgwmrtqtgtpslrailyidevfgym
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  sfaenllcyhsrfrlkdrqkwhkkliekfrdpepmiaittqvcemsldlsasllisefapvtsl
gi|294101018|ref|YP_003552876.1|  ivmsrgqrrrtavalmlaagwaverklrrkpllildeiaaelddrgrnilidalvesswqvfaa
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  kevarayakgiapilidkqwqeaasdilnhvkevl.............................
gi|294101031|ref|YP_003552889.1|  flgsipfrpnvveaiskkeiplea........................................
gi|294101431|ref|YP_003553289.1|  fvpplpsenvpsnsilrefigggc........................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ffpdegllrfkkiheeegarereleelvfqcrnldkqlqafhipsiqkvleqkgairalaqnrn
gi|294102032|ref|YP_003553890.1|  eidfsrytinvfvandpengvpviwetnptyynltgkveyesrqgylytdfhkivsgafqkang
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ygakgvtytaqaekdleeihrlgkdnlvicmaktqasisdnpaligrpegfeltvrevrlsaga
gi|294102529|ref|YP_003554387.1|  eeihrlgkdnllvcmgktqasisdnpaligrpegfeltvrevrlsagagfivpitgsimtmpgl
gi|294102437|ref|YP_003554295.1|  ialtkldvltgfekikicthyevngekhenyltntsllakaspvyttldgwkedisgcrdfekl
gi|294102168|ref|YP_003554026.1|  ciekgvpyrvvrgtafydrkeikdvlsfmrlavnpldgaslgrianvptrgigkksqeklmegl
gi|294101779|ref|YP_003553637.1|  lvengfrlpscldnrplnwrefkkylrqvifisatpgdwerevstcvaeqiirp..........
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  pelqqqlkkeegahaagqegdqllreevtedeiaeivsrwtg......................
gi|294102626|ref|YP_003554484.1|  rrknrlsfddmiryamealehspsyaerfkeilvdefqdtnplqdrliqavrshsqrlfivgdl
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  daieeiaamaekmnaemenigarrlhtmveqlleeisftaperqgevvdinaqfvkerlsplme
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lskvdeeatlargtsysltqnlhkkkeevsalwqklsnlrsslraerqrrqeygneyarvegec
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  qpygtlpknvqnfilygsderlpmffsdrgerhqymgryegllpwlegrwnetesenvleelag
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  eltnyckeaemnltwlnesyrrseqsgaeakklrreasrlalelrkkrertarsleeavnhslr
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  grkfgvgalvisqrpseisetilaqvgtlialrltnsgdqsivkssspdnlnslidllpslrig
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ppvkeppskkplitllkqarafgigvvlatqnpvdldykglsnigtwfigrlqtqrdkdrvleg
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  iqrmgrcnryleiceggrilly..........................................
gi|294101018|ref|YP_003552876.1|  ta..............................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  riekeeeiiqnlsldilsmkqrldrevreihqswtiddlesldlsfgvsqkagdlekqkedfrn
gi|294102032|ref|YP_003553890.1|  gylvldaekvllnfmswealkralrtgeatienlgeqygaipisslrpqpipinvkvvmvgtpy
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  gfiiaitgsimtmpglpkvpaamkidvdndgnitg.............................
gi|294102529|ref|YP_003554387.1|  pkvpaamkidvdddgnitg.............................................
gi|294102437|ref|YP_003554295.1|  peaarryveyieketgvpvqligvgpgrsqtilr..............................
gi|294102168|ref|YP_003554026.1|  gaipemeaeqlwravadgkdlgltgkakigamelgrhmfniikrsgsfhdvllyildsieyedq
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  kqsiyrfrhadlslfgsyikkakyghgdyilldtsfrskeilvhevndlfssvwkdglgqelpl
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  dt..............................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  vkilsrlqarsealdknekeleeaknkvfvaeketetykkefeythlsykkiierhgeiyvqcq
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  yrvedicqtchgyrlrpealmvqlnhhtidelvempvdrllpvlkemefteneqkimgqvmiel
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  dmameditfsitlsdlgkikstgadeisflmasgmmppgpvmkiasggelsrlllalqlalpds
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  eavivgesikipsrirvklnnprp........................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  lerlenasgydrqfldkaitglkkrefllnnvhenspsif........................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  qhvirnetceqarkardearsllktrkehvekmernvsplsvqtlrekcgslrqfftrwhqiqn
gi|294102032|ref|YP_003553890.1|  lyallqyydpeflkmfkikaefdrdmprtfeseqqmaqficgfvrnegkipftvkavaeviewa
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  lkkddpegweervenirelgslvtsggdlaevlaevalftdlettdmddleavnfltlhaakgl
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  pfeslevphylsthelrqqctvdpfltyleggkegekirearlrqirrlallfsqyyeekrtvw
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  rlatslsqlkknvdvlenqletvlenteqrlypepvrvilaaqklgklpiqiklaaeafkceek
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ekrlsflvdvgvgylslmrradtlsggesqrirlatqigsklsgvlyvldeptiglhsrdtdrl
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  qlpgtlvfdeveaglggkaavlagyklkqlaekcrvilitheatiaalaeqhfvvarqenksfi
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  qikenemnldlfrqkkelqwggaaagtlglaflgagyrtgdifflktgitaiaaslgfiivdff
gi|294102032|ref|YP_003553890.1|  grlaehqnrvttefnkiieviveatawalsenatlvedrhvykaieekrfrsnliqeriqraye
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  efpvvflvgleeaifphfkclevqesleeerrlcyvgmtraeeklymsgarsrrlfgtvfrngl
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  dkqkeclrpvqwkdmailvpsrtswfpllekiffeefqlpiyfegstsyfsrseiqdliallnf
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  laapleaylggrqfwlfvksleeaqlgielvkqkragritflpleqchprnpdygfplpcqgtv
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  lrtlrsirdlgntvvvvehdretmlaadaivemgpgageqgg......................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  keiek...........................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  qkrkffnekeellcrlrknlveteeelshtveglaiecpkdylelekaemyiddcidgireydq
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  srflweipd.......................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  lddpgkelylmsflssplsslsleevrdlaldapkgyrlqafqekwphlarqiddwrlmahflg
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  gwatdliaseqlwspavnhllgdlliveeydvgmnlaragasfpivtlqgdvftvggsvsggkf
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  alqsqrdaeeelgrrqrkledcesslnsikklldqtdaewksfveekgfsaslkvehwtefesl
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  psavlasfleksdsflrafpawkrrgvaanmrkaidmarefeeaigtslpgcasylreamerqe
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  rktggaierrlqiedleknlkdkrgslervvsllqeaeelecviakerafwkekeqeaekklls
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  vkqlrgrlaqirdmekqlsssqeyisakeeeihslfrslslgpwsklslvspidiltsrleeae
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  kfaepdvsnekenvirvmtvhgskglefpvlavlglertssagekgslmpspkmgvalsripge
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  hsirferqreeivrlekersfflndvedsgkllkrtqhslkeleeaiasfgdfpdetelerela
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  eqwnqitmiqrekkrneeiyerahkawnesrtlkkelfeqakvhdepsflelgerwqrcndlkk
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  rnsgqaplawslsrlfeeqeeyeewqrlfyvactrardslilcghlpwrrdg............
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  sakgeeavlcekvksgevlinrieseaaqlterlrslsgelentelsldegldrlrelgvqsye
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  iienhrlsllaiaggnenltkvleelpkrtpaesqiligeskeqeqllsqqleelneerghlkt
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lwenikeidserarlsaeteslvertsllrercaeahervqieeekvkdsqrqvdsarlelnqi
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ridelekdkelsalflerekleeelrlalkewlavvacrcvleqtrqkheqerqpevfkkagdf
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  islwedayhypgtenisleeyeeeslahvrrlekkvrelgdydlgvlseneslknrlafltvqi
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  lelmtegryslistaseeggfsveleeksgflrkkedvwssgladqvylsirlalaelygkrme
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d1e79a3                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  edvhggigelqsliqstdervgllfgealkntderfnslfqrlfgggeahleleeglslweagv
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................