SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

P-loop containing nucleoside triphosphate hydrolases alignments in Aminobacterium colombiense DSM 12261

These alignments are sequences aligned to the 0051784 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  dieiarsakmkpivevaaqlgideeelelygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102529|ref|YP_003554387.1|  dieiaqnaelkpivevaaqlginedeleyygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102437|ref|YP_003554295.1|  veiiigaqwgdegkgrvvdalgnrvevfaryqgganaghtvivedekyvfhllpsgmlypcklc
gi|294102168|ref|YP_003554026.1|  dsildklnprqqeavrycdgpllvlagagsgktrvlahkiayliekgyaspkgilavtftnkaa
gi|294101779|ref|YP_003553637.1|  adwgpsgdqpeaieklveslkngtrfqt....................................
gi|294102457|ref|YP_003554315.1|  tkfifvtggvvsslgkgitaaslgvllkkrgfrvsiikldpylnvdagtmnpfqhgevfvtddg
gi|294101625|ref|YP_003553483.1|  emkki...........................................................
gi|294101185|ref|YP_003553043.1|  tyealdkygrdlvkmarlgkldpvigrdeevrrvirilsrktknnp..................
gi|294102626|ref|YP_003554484.1|  tqpgqfkaitadaplvavsagagtgktwtlawrfiwilvtgradtneiltltftekaalemaer
gi|294101765|ref|YP_003553623.1|  ydaafpakdivdfvdriineaakngasdihieglsawsrvrfridgycravysfsldfhpaiis
gi|294102479|ref|YP_003554337.1|  hpvplgviqgaikmedvwfaykdeqwvlkgvalevcpge.........................
gi|294101904|ref|YP_003553762.1|  islthltkiftkgkesfkavddvhldidage.................................
gi|294102557|ref|YP_003554415.1|  yikkivkdfgsyddpsnrvravdrvdlhvkeg................................
gi|294101807|ref|YP_003553665.1|  tlpvsrdmlgrifngrgepidggapilpdakldingmpmnpfsrdypsefiqtgistidgmnpm
gi|294101806|ref|YP_003553664.1|  vietiaviknesgeeknvvmlqrwpvrkprpvarrlppiiplttgqrvvdaffpiakggtacvp
gi|294102649|ref|YP_003554507.1|  misiqnlyktypceggdfea............................................
gi|294101185|ref|YP_003553043.1|  ipvtrlmegerekllkldeilhqrvigqdeavelvadavirars....................
gi|294102868|ref|YP_003554726.1|  lqlkqlnkkfghsyavrdfsfdinege.....................................
gi|294102500|ref|YP_003554358.1|  ltprmivecldryivgqekakravaialrnrmrrrnlprdlane....................
gi|294102409|ref|YP_003554267.1|  pneralkryrqiaddinglepeysaksdedlrslvadfkrranegesldnllvevfalvrevsr
gi|294102354|ref|YP_003554212.1|  kpe.............................................................
gi|294101565|ref|YP_003553423.1|  ipvtqlteeetqrllrmeeeihcrligqeeavsavar...........................
gi|294101424|ref|YP_003553282.1|  ievknlhksfgnlhvlqgvsmtvgege.....................................
gi|294101976|ref|YP_003553834.1|  kmpvglslvgqvlngrgrsidgtplsfidkdlpitgmpinpvrrtspnayvetgissidmmntl
gi|294101061|ref|YP_003552919.1|  ilrvedihksyggvevlrgisftvrkgetk..................................
gi|294101048|ref|YP_003552906.1|  dksedavvavrgvslaarqgev..........................................
gi|294101977|ref|YP_003553835.1|  engveltmkqrwevrrprpvlsrlsfdaplltgqrildtlfpiaiggaavlpggfgtgktvtqq
gi|294101084|ref|YP_003552942.1|  lihvenlyksfedgevlngisidihegd....................................
gi|294101565|ref|YP_003553423.1|  ptldqlgidlseksrkdeldpvigrdkeiqrviqilarrtknnp....................
gi|294101786|ref|YP_003553644.1|  llkvdhlkkhfytpygtlfavddvsfsikege................................
gi|294101493|ref|YP_003553351.1|  lvrvdniyktysmgevdvtalqgvsfsvkkgef...............................
gi|294101884|ref|YP_003553742.1|  aekalhgdiralariislveneapeseei...................................
gi|294101894|ref|YP_003553752.1|  dtpkpaevkkfldqyvigqedakkilsvavynhf..............................
gi|294101778|ref|YP_003553636.1|  dnrpkvtfddvagcdes...............................................
gi|294102313|ref|YP_003554171.1|  ivnikeltkrypmgdhtftalssvdlefkkgefc..............................
gi|294102640|ref|YP_003554498.1|  lldirnlkkyfnvskgllhavdditltitk..................................
gi|294101376|ref|YP_003553234.1|  isyedigglgpqi...................................................
gi|294102641|ref|YP_003554499.1|  lldirnlsvrfntdsgivhavnnlnlslrrgka...............................
gi|294101359|ref|YP_003553217.1|  skvlilsptrelsqqiwkeakwfgnyinvsaaslvggmdmsqqirslrdgsavvtgtpgrvldh
gi|294102459|ref|YP_003554317.1|  lrngdviwgmvrppkdqehyeallrvemvnfadpeaarkrphfgtltpifpdsrltletdpdei
gi|294101785|ref|YP_003553643.1|  ileirnlrvsyetedgtvealngidldl....................................
gi|294101376|ref|YP_003553234.1|  pdvtwsdiggleaikeelieavqwplkynsvye...............................
gi|294102074|ref|YP_003553932.1|  mf..............................................................
gi|294102442|ref|YP_003554300.1|  irlagvtkifqpdivaledvylsimqgef...................................
gi|294101577|ref|YP_003553435.1|  lkarkvckafkgrtvvssvdldvhmgei....................................
gi|294101171|ref|YP_003553029.1|  llelngvdkffggvhavqsmsfalneke....................................
gi|294102413|ref|YP_003554271.1|  vletkgltmcfggltavnsfnmavpkgs....................................
gi|294102187|ref|YP_003554045.1|  einrlhddllnevfgygpiqplldddtvteimvngceqvfverwgkieptdvffnndnhirrii
gi|294102332|ref|YP_003554190.1|  irisglrkrygsgdtavdalkmvnmhvapge.................................
gi|294102831|ref|YP_003554689.1|  mlsiavtnqkggvgktttcvnlsaelgrlgysvlavdmdpqgnctsglgiearaievslydvll
gi|294101321|ref|YP_003553179.1|  akp.............................................................
gi|294101626|ref|YP_003553484.1|  akp.............................................................
gi|294101069|ref|YP_003552927.1|  ilsvddlhfsygetpilknislsvknq.....................................
gi|294102759|ref|YP_003554617.1|  mieivdlsitykteshdvsavknaflsiprgritg.............................
gi|294101055|ref|YP_003552913.1|  ileihqlavafnnkkilkninaniyphqi...................................
gi|294101254|ref|YP_003553112.1|  plvqmqeitkefagivanhnidfdvnrgevh.................................
gi|294102760|ref|YP_003554618.1|  tdkvsvfypsrdgknsgqwalrnislslqqges...............................
gi|294101659|ref|YP_003553517.1|  tlqgvgfsypeadssaldqvsfqvrege....................................
gi|294101172|ref|YP_003553030.1|  nilldvqnlqvsygairalrgislqvkege..................................
gi|294102017|ref|YP_003553875.1|  yirpqinnglnlkieggrhpvieatfldlpfvpndivldgdeerialitgpnm...........
gi|294101748|ref|YP_003553606.1|  vldslrgtrwkkavektrervreevknlvrlyarrellkgyafpvaseiyrhfveafpyvetpd
gi|294102409|ref|YP_003554267.1|  pmvrsdfpdviyrtslekfhavaeeveetysngqpvlvgttsienseriskllkarkiphqvln
gi|294102070|ref|YP_003553928.1|  fehvvgisal......................................................
gi|294102390|ref|YP_003554248.1|  dplpdflrlkhafpplydsilemhypqgreswkkardrlayqelfvlqtgmalrrgersrlaek
gi|294101403|ref|YP_003553261.1|  redilelaiddirskfgegsimrlgdpfkvqvevistgilpldvalgigglpkgri........
gi|294101730|ref|YP_003553588.1|  ekrvshaylf......................................................
gi|294102602|ref|YP_003554460.1|  vqaek...........................................................
gi|294102663|ref|YP_003554521.1|  ivsnlnlfygknqvlhninmdifgktvt....................................
gi|294101436|ref|YP_003553294.1|  l...............................................................
gi|294102150|ref|YP_003554008.1|  slsrir..........................................................
gi|294101607|ref|YP_003553465.1|  prvivvtsgkggvgkttttanvsfalakagykvvaidadiglrnldvvmglenrvvynfidvie
gi|294102035|ref|YP_003553893.1|  rrfvqvymgdgkgkttaalglairaagwnmkvgiiqfmkgwpqygelaslarfpeiqlvqtgrp
gi|294102412|ref|YP_003554270.1|  lkieelhvyyggihavkgislhipkgk.....................................
gi|294101660|ref|YP_003553518.1|  msiiiknlthtyhpstpletvaleginlttekgq..............................
gi|294102549|ref|YP_003554407.1|  lwisrltktfgtlravddfsleiasgtvhs..................................
gi|294102841|ref|YP_003554699.1|  pavvfedvsfgyengtmvldqasfqvpqgef.................................
gi|294101272|ref|YP_003553130.1|  mlrlshlgkkynglpvidqfdldiekgsfs..................................
gi|294101433|ref|YP_003553291.1|  kkdvgkviavgsgkggvgkssiscllavalakkgfsvgildaditgpsvpklmgvtdspygspq
gi|294101963|ref|YP_003553821.1|  khme............................................................
gi|294101356|ref|YP_003553214.1|  dssekavaihfpqcprsgqevisvkdvkktygdnlifkdisfsvhrge................
gi|294102542|ref|YP_003554400.1|  rlknikhfysqrcvlqipsleigqgei.....................................
gi|294101861|ref|YP_003553719.1|  lrpsslqdfvgq....................................................
gi|294102400|ref|YP_003554258.1|  vtgfstgfyqfdrmtgglqpgslniiaarpsmgktalalniaqyggverkepilifslemsaeq
gi|294102043|ref|YP_003553901.1|  mfitlegidgcgkstqaaflkeqlqqkkkepvlwtrepggwvhgdfvrtlllekdlrhe.....
gi|294101077|ref|YP_003552935.1|  mpllrlksiafayprssplfthlsfeife...................................
gi|294102348|ref|YP_003554206.1|  llkvdsitvrrdnatilkdislrvesgevtg.................................
gi|294102040|ref|YP_003553898.1|  kspk............................................................
gi|294101613|ref|YP_003553471.1|  mfierlrlkgfksfggsheltfspgft.....................................
gi|294101367|ref|YP_003553225.1|  epllkmenigkayfgnrvlkdvsftlekgqi.................................
gi|294101893|ref|YP_003553751.1|  pwntyteenlditkaqrildedhyglvkvkerileflavrqlagkeak................
gi|294101841|ref|YP_003553699.1|  d...............................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  mvhhvkrqfvffggkggtgkttcaaayayalsrlgiktlvvstdpahsladafnrpigldvipv
gi|294101356|ref|YP_003553214.1|  iqlvnithfygeqglynslnwsithgskt...................................
gi|294101345|ref|YP_003553203.1|  pllatqdlsigygpkkgttlvagpiatslyege...............................
gi|294102145|ref|YP_003554003.1|  eislvlgt........................................................
gi|294101756|ref|YP_003553614.1|  p...............................................................
gi|294102549|ref|YP_003554407.1|  pflemtrltvsgdrgkdvvknltltvhrgei.................................
gi|294101372|ref|YP_003553230.1|  ytgeemveisthggtlvaqkclesligkgarlaepgeftrraflngkidlsqaeavlgiirsks
gi|294101016|ref|YP_003552874.1|  lnpnyifnsfvvgksnrlahaaslavaetpgeaynplfiwggvglgkthlmhaighyvlnknns
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  idesgcekprssdlmavniidvrppqrftsgipeldrvlggg......................
gi|294102507|ref|YP_003554365.1|  pnpdladikgqagakraleiaaagh.......................................
gi|294101471|ref|YP_003553329.1|  flrkggsqivlfshlsvsfkkge.........................................
gi|294101845|ref|YP_003553703.1|  mleelslrniggldsahlhf............................................
gi|294101553|ref|YP_003553411.1|  dvdykvvkslvdsirgrcigqevldsitpgqqvvaivyeelvslmgedvvpfiisskpp.....
gi|294101853|ref|YP_003553711.1|  lrveapipgkpyvgieipnpkrrgvllrrilesqafeqadynlplpmgvrvdsrpliigl....
gi|294101780|ref|YP_003553638.1|  ahhnlkeidvaipsrvfsc.............................................
gi|294102079|ref|YP_003553937.1|  mkn.............................................................
gi|294101472|ref|YP_003553330.1|  flsvenlsildeenkplvrnvsfsipsesvf.................................
gi|294102235|ref|YP_003554093.1|  i...............................................................
gi|294102390|ref|YP_003554248.1|  ppgrtpiqtrwlkkkeegrlwafirercsareriywvcplidesetlsvasvteryeylkklfp
gi|294101443|ref|YP_003553301.1|  qwerpladrmrpsslddfvgqnhllapgtplrqilqs...........................
gi|294101748|ref|YP_003553606.1|  ppynrvpvltmvgprkknlihravlqelnr..................................
gi|294101649|ref|YP_003553507.1|  m...............................................................
gi|294101715|ref|YP_003553573.1|  wtlpelskkpffvfydllhpllgekgipltiecgrsfhvlvvtgpntggktvalktvgmgiila
gi|294101925|ref|YP_003553783.1|  sieigkhsssdnlsvyvdihklilr.......................................
gi|294101367|ref|YP_003553225.1|  lagnilkvehlwvdmpgetvrdvsftvkegeifgigglagqgklgiangimgmypsggtvtfde
gi|294101751|ref|YP_003553609.1|  pvrpktggqklyieamrahdivfaigpagtgktylavchgvamlkagaisrivlvrpaveages
gi|294101046|ref|YP_003552904.1|  navlsaptgagktlvaylwagllttegkaqmpegisriiftapikalsnerymdlrrmgfdvgi
gi|294101779|ref|YP_003553637.1|  tllgvtgsgktftvanvlaqfdrpvlvlahnktlaaqlytefktffphnavhyfvsyydyyqpe
gi|294101226|ref|YP_003553084.1|  l...............................................................
gi|294101892|ref|YP_003553750.1|  pp..............................................................
gi|294102315|ref|YP_003554173.1|  sdnlvlydskdltthgm...............................................
gi|294102188|ref|YP_003554046.1|  eriavlscrggaggssfsislalqlasmgkrtalidgdlymgdvafllntpyelnwtswanecl
gi|294102320|ref|YP_003554178.1|  ekytniiideahrfrtettityeklaeicrgkrvilvtatpynnspkdilsllklfqkgqksti
gi|294102169|ref|YP_003554027.1|  svmaadeefarrmrd.................................................
gi|294101254|ref|YP_003553112.1|  kkitvlgdrgipvvkdlsidvrereilglagiagngqqelcealaglrplkegrimiddeelth
gi|294102077|ref|YP_003553935.1|  ryr.............................................................
gi|294102510|ref|YP_003554368.1|  hmakgkrkleelvqkldlilevrdaraphltsspmsdqlsricpvyivlsradlaeegatkawl
gi|294101748|ref|YP_003553606.1|  qvhlpvdggarawilggasvpllvvfsdqrqaedfvsdfenlwegeivrllyelplsvegvrnk
gi|294101141|ref|YP_003552999.1|  drtcllapcgsgktlaawkwgsgvasrhpisrfiflyptratategfrdyvswapetdgtllhg
gi|294101018|ref|YP_003552876.1|  lewaaglnl.......................................................
gi|294101692|ref|YP_003553550.1|  iwdsfmqqrntvfvaeaptgigktfallapalkwalpqekrilfltagitlqeqlirkdlprlk
gi|294101032|ref|YP_003552890.1|  mfrltvasgkggtgktciaaslalslskgtaidldvdepdlglvlqiknpkkenvykvvpqiea
gi|294101031|ref|YP_003552889.1|  pkeiviisgkggtgktcimaalcssfsgkavfcdvdvdapnlqlllnpqdeqafsftgrkipei
gi|294101431|ref|YP_003553289.1|  ektk............................................................
gi|294102167|ref|YP_003554025.1|  lv..............................................................
gi|294101458|ref|YP_003553316.1|  aplcipqlevlikgmflkdrfldiirhfvlfqsdgkeikkilagyhqyhavnkalqstqratme
gi|294102320|ref|YP_003554178.1|  fkrleyqeqavlnakkivleyggvfisdvvglgktyisamlagqldgrtlviappvllektnpg
gi|294101940|ref|YP_003553798.1|  rlgirrldtafdgvypgemlnlagaqgslktslalhgavnflqgnperrvlffsldmskeettq
gi|294102120|ref|YP_003553978.1|  rtakglamacvedgssl...............................................
gi|294101791|ref|YP_003553649.1|  hvys............................................................
gi|294102136|ref|YP_003553994.1|  mvkqidirkyrkmedlslvfsqginilsgtngtcktsllhivsnsfqevnkgcpwvtdasclta
gi|294101830|ref|YP_003553688.1|  rc..............................................................
gi|294102042|ref|YP_003553900.1|  iaidiarlllcekknacgqclsccswhekthpdlvlsgslekaptisecreiavelslypvvas
gi|294102015|ref|YP_003553873.1|  il..............................................................
gi|294102787|ref|YP_003554645.1|  mrfiefkirsfgllenmeghfpaglsl.....................................
gi|294102032|ref|YP_003553890.1|  lekfigqeravqaisfglsveskgynifvlgnpgsgrtsyslqrlhesakekpapddwiyaynf
gi|294102010|ref|YP_003553868.1|  tllaslirl.......................................................
gi|294101586|ref|YP_003553444.1|  yif.............................................................
gi|294101458|ref|YP_003553316.1|  vviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltdkntrvvfg
gi|294102625|ref|YP_003554483.1|  ivagsprmemetlarelvlwknkkgylsgqeilpaetpwqnigmvfdapllplaeevlqryrip
gi|294102478|ref|YP_003554336.1|  ipvisvgnitlggtnktpfvemlsrhfynmgvrvgivsrgyggrtsepvvikgtssereivgde
gi|294101874|ref|YP_003553732.1|  h...............................................................
gi|294102071|ref|YP_003553929.1|  lqehpgpaillfperalaeffysfletegveniflwpsvggkklweawnr..............


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  gegkttttvglaqglaklgkkvsialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102529|ref|YP_003554387.1|  gegkttttvglgqglaklgkrvcialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102437|ref|YP_003554295.1|  vvgngvvvdpeqllkelhtlqeqgkdrarlmisgsahvvmpyhkildkadeqfrskdkkigttg
gi|294102168|ref|YP_003554026.1|  remgervqalvgakasamqvstfhsfglhflfrnsdqleflglrkgfaifdrndsrslvkkime
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  aetdl...........................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  iknlllqlamelpsqkvffqkaadridegyistihsfsmrvlkecglateldpesgtiappqes
gi|294101765|ref|YP_003553623.1|  rikimasmdisdkrrpqdgqfniktgsqdfldvrvsslptvdgekialrlldsskipdniyqlg
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  vrgqklpifsgsglphnrmaaqiarqatvisghedf............................
gi|294101806|ref|YP_003553664.1|  gpfgsgktviqhqlakwaesdivvyvgcgergnemt............................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  rtlglrhfdvqlmggmalhegkitemktgegktlvatlavvlnalsgngvhvvtvndylakrda
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  vrgqklpifsgsglpaneiaaqivqqaavpgretdflvifaamgitrrearyfidtfestgain
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  slakwcnaeiiiyigcgergnemtevleefpelsdpfhnaplmerm..................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  irrgtldtsgikivvldegdhmldlgfk....................................
gi|294102459|ref|YP_003554317.1|  strlidlfapigkgqra...............................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  dkivaplgrrideaspmvdarlpdgsrvnavippvsidgptltvrkfrrepftaqdlialgtls
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ggasaqdalmatswqgvsllpatidlagaevelasvisretclrrhmanlnqfdvaiidcppsl
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  qlraeqeilqd.....................................................
gi|294102409|ref|YP_003554267.1|  akyheke.........................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  apilpesgrlkerflkeifpyplteaqkkvsleisqdmalnipmhrllq...............
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  gtcrlpqalirdkrvdnlfllpaaqtrtkdavspdqmvelcemlkkegfdfilld.........
gi|294102035|ref|YP_003553893.1|  dfvkkgsplqfdieeaqrglelakkwiekglfdivildeinvald...................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  giippassifdikvmsvnlllddptkpvvwrgpiiasvikqfwedv..................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  lvqrmlgseakvnihdirngsfaekdwekladaagrlsqaplfiddssmls.............
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  aenlwgieidaeeeakkymkaiqdkmlhivsaviv.............................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  eealraatrtlrgelssfakdiynemltisssievgldfpeedipfienegvesalytlkqgle
gi|294101016|ref|YP_003552874.1|  lkvtyvssekfinefiqsiknnrtqefks...................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  dlnv............................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  wcgfplpakegtvvgnldnvfadigdeqsieqnlstfsahlkniihi.................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  tpiilndprsplsvgiasvsedrrgvgllleepiswnviftalqmqqkylkpvlgglfkirdee
gi|294101751|ref|YP_003553609.1|  lgylpgdlrekv....................................................
gi|294101046|ref|YP_003552904.1|  etgdfkrneeapiicctqeiytlkytkephqkliidefhyifedpdrartyidgirgtapttsi
gi|294101779|ref|YP_003553637.1|  ayipssd.........................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  sgtvdgerylalgpkdlmimptaknpvqaelvksgmgdrliesls...................
gi|294102320|ref|YP_003554178.1|  pnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylmvrrtraeieeyfsrd
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  qppkqfiargvryipadrkgtglvpnmdikensilkkywnkpvargpmidwkavfs........
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  qffssikqkawafnflegriqllr........................................
gi|294101748|ref|YP_003553606.1|  slllqrgetlskwkqekgilatspggllspfltgeg............................
gi|294101141|ref|YP_003552999.1|  tsnyelqgmfdnpdprsekefltndrlfavglwqkrlfsatvdqflgfmrhdyrsscllpllad
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ellgydvsfgllkgrgnyvcvrralelehegflsfgdsgaasiylsewlkktqtgdlselklps
gi|294101032|ref|YP_003552890.1|  arckgcgvcadncafgalnqfgthapvvnmqlchgcgvcelvcpqkaikdskasigimniknqe
gi|294101031|ref|YP_003552889.1|  dterctvcggcvgfcrfnalekanngitllpwkcegcggcalvcphqaismhsyeqgqywrgtt
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  qgdrrvgviwhtqgsgkslsmvfyagklvideel..............................
gi|294102320|ref|YP_003554178.1|  swpnvfsdfrvpadyesigrldnliergtekytni.............................
gi|294101940|ref|YP_003553798.1|  rlfmrelevstnalhglikvnsprirearegmkkhlnrlevvgeesgqrwti............
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ikkvnklinpkietltkgdktyndpanq....................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  crlv............................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  sdpsrplainlpagkgkemgsafeellselkiaiskafeksqyedakaqlvknfqeqvnglmee
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  dyidiydmtravedgttvkifyesriakldlpeemkpqidseyeeiteyqeysqkerlkskwar
gi|294102625|ref|YP_003554483.1|  ysinegltvgqtalwdiarriwnagehgwplgetwdilrepclagreiatsppadiftlnekgw
gi|294102478|ref|YP_003554336.1|  plllasrlphvpvavsrdrlkdvealqkhnvelivaddafqhrrl...................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  aittahnllaalldnhlhqgnplnidprrvvfrrvidlneralryvnvglggktngvpresgfd
gi|294102529|ref|YP_003554387.1|  aitsahnllsalidnhlhqgnplnidprrvvfrrvvdlneralrhvivglggkadgvpresgfd
gi|294102437|ref|YP_003554295.1|  rgigpcyvdkfnrcgiriedlfdpdilreklsfnlelknllltkvynaepvafddiyaqarawg
gi|294102168|ref|YP_003554026.1|  dlkldpkqidptnvldhiskaktegnhktlepvglegiehevyrkyhdelrrqnavdfddllil
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  lfwkeaeealdrwdgnwfakssshlwaqriaklfsdplfmdsvntfgpnatvelaksslalfas
gi|294101765|ref|YP_003553623.1|  feqrdlellekllsqke...............................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ewmgpiyrflglsvkciyaymdqkerkeaylsdv..............................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ngiffmnlasdsaverlltprmaltaaeyfafekgydvlvimtdm...................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  desvsflrvat.....................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  glltinalvaahklvvpiqceyyalegvgqlahtiglvrdclnpdlav................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  dlldrcntgf......................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  airevtkk........................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  lvmsatfsqpgvi...................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ikeqglkfpkvakpvplfyelnekedfifnrtiehianqfkyarympmlyyknelnqlerqsqr
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  savvfdeihsfdqtlfsallgflrefnvpal.................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  dfpifprvaaqvrgclghrcpyrdrcfiqkalkkaqnwdvivsnyhmyfayvmngkgtfpvdfd
gi|294101032|ref|YP_003552890.1|  sfwflegildigepnpvplihavlkkadslpfpqivdgppgnacpmva................
gi|294101031|ref|YP_003552889.1|  tygplwharlhageensgmlvarlkkesrkealkegvpfividgppgiscp.............
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  vrawagekgfalkrtpqgfvnipmieettesgdvskrelqqeefeslseekqkelqgkseeisq
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  leaivgteqrikqiakdivehfekr.......................................
gi|294102625|ref|YP_003554483.1|  igflehaapergldsfkkmclfvktikkggtpveilsalyslaaenpswgkelslwam......
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  itvasevmailclsesikelkerlaqivvaytydgtavtagdlnaqgsmavvlkdalkpnlvqt
gi|294102529|ref|YP_003554387.1|  itvasevmailclsanikelkerlskivvgytyngtvvtagdlnahgsmaallkdalkpnlvqt
gi|294102437|ref|YP_003554295.1|  kalepyvadvslalreamlegkgilfegaqgtlldvdhgtypfvtssspiaaggcvglgvgpsd
gi|294102168|ref|YP_003554026.1|  plhllmvdeklreqeqsrldwilvdeyqdvnkpqyfllrrligtkgnimvv.............
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  qgqtpkdlwqwgsdlfsrdqdavdtarltlfrrwedewhrflqpesgifynlnelggtgklcgn
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  nmgrfmkillvkrlessffafrnt........................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  vlicdeahrmvdaarsissvrvswedlvrllrskgaataesflsnreeeqgvlrdelssvqeeg
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  rtldtlrkirdlekalkeeigkleaeicrsaitpylqdvkekygtteilckwidalaediisnf
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  lehvpafvhggpfaniahgcnsiqatkyglklsdyfiteagfgadlgaekffdikcregnlhps
gi|294102529|ref|YP_003554387.1|  lehvpafvhggpfaniahgcnslqatkyglkladyfiteagfgadlgaekffdikcrignltps
gi|294102437|ref|YP_003554295.1|  vdrvigvvkayctrvgegpfptedlgdhgqtlrdrggeygattgrprrcgwldmvalkyavrvn
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  vrnlitrwqqqpskenlphfiqslieglkgasgklaneiafhlkepvsqyrnrlikeepwitvf
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  rklfellevsiadgvlipvrn...........................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  nifvaaakdesteidfsrytinvfvandpengvpviwetnptyynlt.................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                 10         20      
                                                                                  |          |      
d2akab1                             .....................................----MEDLIP.LVNRLQDAFSaigqNA
gi|294102520|ref|YP_003554378.1|  avvivatvralkmhggvakseltgenlealskgipnl----------.----------....--
gi|294102529|ref|YP_003554387.1|  avvivatvralkmhggvakneltgenlealskgipnl----------.----------....--
gi|294102437|ref|YP_003554295.1|  .................................gmss----------.----------....--
gi|294102168|ref|YP_003554026.1|  .....................................----------.----------....--
gi|294101779|ref|YP_003553637.1|  .....................................----------.----------....--
gi|294102457|ref|YP_003554315.1|  .....................................----------.----------....--
gi|294101625|ref|YP_003553483.1|  .....................................----------.----------....--
gi|294101185|ref|YP_003553043.1|  .....................................----------.----------....--
gi|294102626|ref|YP_003554484.1|  tqgfdekeqayrscllgfsailwqlwdefrrrknrls----------.----------....--
gi|294101765|ref|YP_003553623.1|  .....................................----------.----------....--
gi|294102479|ref|YP_003554337.1|  .....................................----------.----------....--
gi|294101904|ref|YP_003553762.1|  .....................................----------.----------....--
gi|294102557|ref|YP_003554415.1|  .....................................----------.----------....--
gi|294101807|ref|YP_003553665.1|  .....................................----------.----------....--
gi|294101806|ref|YP_003553664.1|  .....................................----------.----------....--
gi|294102649|ref|YP_003554507.1|  .....................................----------.----LRNVSI....NI
gi|294101185|ref|YP_003553043.1|  .....................................----------.-------GIK....DP
gi|294102868|ref|YP_003554726.1|  .....................................----------.----------....--
gi|294102500|ref|YP_003554358.1|  .....................................----------.----------....--
gi|294102409|ref|YP_003554267.1|  .....................................----------.----------....--
gi|294102354|ref|YP_003554212.1|  .....................................----------.----------....--
gi|294101565|ref|YP_003553423.1|  .....................................----------.AIRRARSGMK....DP
gi|294101424|ref|YP_003553282.1|  .....................................----------.----------....--
gi|294101976|ref|YP_003553834.1|  .....................................----------.----------....--
gi|294101061|ref|YP_003552919.1|  .....................................----------.----------....--
gi|294101048|ref|YP_003552906.1|  .....................................----------.----------....--
gi|294101977|ref|YP_003553835.1|  .....................................----------.----------....--
gi|294101084|ref|YP_003552942.1|  .....................................----------.----------....--
gi|294101565|ref|YP_003553423.1|  .....................................----------.----------....--
gi|294101786|ref|YP_003553644.1|  .....................................----------.----------....--
gi|294101493|ref|YP_003553351.1|  .....................................----------.----------....--
gi|294101884|ref|YP_003553742.1|  .....................................----------.-----MKYLY....PH
gi|294101894|ref|YP_003553752.1|  .....................................---------K.RISTMSEEND....DI
gi|294101778|ref|YP_003553636.1|  .....................................----KEELSE.VIQFLRDPGKfr..AL
gi|294102313|ref|YP_003554171.1|  .....................................----------.----------....--
gi|294102640|ref|YP_003554498.1|  .....................................----------.----------....--
gi|294101376|ref|YP_003553234.1|  .....................................--QRVREMIE.LPLRFPQVFD....RL
gi|294102641|ref|YP_003554499.1|  .....................................----------.----------....--
gi|294101359|ref|YP_003553217.1|  .....................................----------.----------....--
gi|294102459|ref|YP_003554317.1|  .....................................----------.----------....--
gi|294101785|ref|YP_003553643.1|  .....................................----------.----------....--
gi|294101376|ref|YP_003553234.1|  .....................................----------.----------....KF
gi|294102074|ref|YP_003553932.1|  .....................................----------.----------....--
gi|294102442|ref|YP_003554300.1|  .....................................----------.----------....--
gi|294101577|ref|YP_003553435.1|  .....................................----------.----------....--
gi|294101171|ref|YP_003553029.1|  .....................................----------.----------....--
gi|294102413|ref|YP_003554271.1|  .....................................----------.----------....--
gi|294102187|ref|YP_003554045.1|  .....................................----------.----------....--
gi|294102332|ref|YP_003554190.1|  .....................................----------.----------....--
gi|294102831|ref|YP_003554689.1|  .....................................----------.----------....--
gi|294101321|ref|YP_003553179.1|  .....................................----------.----------....--
gi|294101626|ref|YP_003553484.1|  .....................................----------.----------....--
gi|294101069|ref|YP_003552927.1|  .....................................----------.----------....--
gi|294102759|ref|YP_003554617.1|  .....................................----------.----------....--
gi|294101055|ref|YP_003552913.1|  .....................................----------.----------....--
gi|294101254|ref|YP_003553112.1|  .....................................----------.----------....--
gi|294102760|ref|YP_003554618.1|  .....................................----------.----------....--
gi|294101659|ref|YP_003553517.1|  .....................................----------.----------....--
gi|294101172|ref|YP_003553030.1|  .....................................----------.----------....--
gi|294102017|ref|YP_003553875.1|  .....................................----------.----------....--
gi|294101748|ref|YP_003553606.1|  .....................................----------.-------M--....--
gi|294102409|ref|YP_003554267.1|  .....................................----------.----------....--
gi|294102070|ref|YP_003553928.1|  .....................................HKRYIDDLMDmAVSLLPSDEEe...ER
gi|294102390|ref|YP_003554248.1|  .....................................----------.----------....--
gi|294101403|ref|YP_003553261.1|  .....................................----------.----------....--
gi|294101730|ref|YP_003553588.1|  .....................................----------.----------....--
gi|294102602|ref|YP_003554460.1|  .....................................----------.----------....--
gi|294102663|ref|YP_003554521.1|  .....................................----------.----------....--
gi|294101436|ref|YP_003553294.1|  .....................................----------.----------....--
gi|294102150|ref|YP_003554008.1|  .....................................----------.----------....--
gi|294101607|ref|YP_003553465.1|  .....................................----------.----------....--
gi|294102035|ref|YP_003553893.1|  .....................................----------.----------....--
gi|294102412|ref|YP_003554270.1|  .....................................----------.----------....--
gi|294101660|ref|YP_003553518.1|  .....................................----------.----------....--
gi|294102549|ref|YP_003554407.1|  .....................................----------.----------....--
gi|294102841|ref|YP_003554699.1|  .....................................----------.----------....--
gi|294101272|ref|YP_003553130.1|  .....................................----------.----------....--
gi|294101433|ref|YP_003553291.1|  .....................................----------.----------....--
gi|294101963|ref|YP_003553821.1|  .....................................----------.----------....--
gi|294101356|ref|YP_003553214.1|  .....................................----------.----------....--
gi|294102542|ref|YP_003554400.1|  .....................................----------.----------....--
gi|294101861|ref|YP_003553719.1|  .....................................-----QKLKD.KLSIYVQAAR....QR
gi|294102400|ref|YP_003554258.1|  .....................................----------.----------....--
gi|294102043|ref|YP_003553901.1|  .....................................----------.----------....--
gi|294101077|ref|YP_003552935.1|  .....................................----------.----------....--
gi|294102348|ref|YP_003554206.1|  .....................................----------.----------....--
gi|294102040|ref|YP_003553898.1|  .....................................----------.----------....--
gi|294101613|ref|YP_003553471.1|  .....................................----------.----------....--
gi|294101367|ref|YP_003553225.1|  .....................................----------.----------....--
gi|294101893|ref|YP_003553751.1|  .....................................----------.----------....--
gi|294101841|ref|YP_003553699.1|  .....................................----------.----------....--
gi|294102070|ref|YP_003553928.1|  .....................................----------.----------....--
gi|294102221|ref|YP_003554079.1|  .....................................----------.----------....--
gi|294101356|ref|YP_003553214.1|  .....................................----------.----------....--
gi|294101345|ref|YP_003553203.1|  .....................................----------.----------....--
gi|294102145|ref|YP_003554003.1|  .....................................----------.----------....--
gi|294101756|ref|YP_003553614.1|  .....................................----------.----------....--
gi|294102549|ref|YP_003554407.1|  .....................................----------.----------....--
gi|294101372|ref|YP_003553230.1|  .....................................----------.----------....-L
gi|294101016|ref|YP_003552874.1|  .....................................----------.----------....--
gi|294101780|ref|YP_003553638.1|  .....................................----------.----------....--
gi|294101686|ref|YP_003553544.1|  .....................................----------.----------....--
gi|294102507|ref|YP_003554365.1|  .....................................----------.----------....--
gi|294101471|ref|YP_003553329.1|  .....................................----------.----------....--
gi|294101845|ref|YP_003553703.1|  .....................................----------.----------....--
gi|294101553|ref|YP_003553411.1|  .....................................----------.----------....--
gi|294101853|ref|YP_003553711.1|  .....................................----------.----------....--
gi|294101780|ref|YP_003553638.1|  .....................................----------.----------....--
gi|294102079|ref|YP_003553937.1|  .....................................----------.----------....--
gi|294101472|ref|YP_003553330.1|  .....................................----------.----------....--
gi|294102235|ref|YP_003554093.1|  .....................................----------.----------....--
gi|294102390|ref|YP_003554248.1|  .....................................----------.----------....--
gi|294101443|ref|YP_003553301.1|  .....................................----------.----------....--
gi|294101748|ref|YP_003553606.1|  .....................................----------.----------....--
gi|294101649|ref|YP_003553507.1|  .....................................----------.----------....--
gi|294101715|ref|YP_003553573.1|  .....................................----------.----------....--
gi|294101925|ref|YP_003553783.1|  .....................................----------.----------....--
gi|294101367|ref|YP_003553225.1|  .....................................----------.----------....--
gi|294101751|ref|YP_003553609.1|  .....................................----------.----------....--
gi|294101046|ref|YP_003552904.1|  .....................................----------.----------....--
gi|294101779|ref|YP_003553637.1|  .....................................----------.----------....--
gi|294101226|ref|YP_003553084.1|  .....................................----------.----------....--
gi|294101892|ref|YP_003553750.1|  .....................................----------.----------....--
gi|294102315|ref|YP_003554173.1|  .....................................----------.----------....--
gi|294102188|ref|YP_003554046.1|  .....................................----------.----------....--
gi|294102320|ref|YP_003554178.1|  .....................................----------.----------....--
gi|294102169|ref|YP_003554027.1|  .....................................----------.---------E....SH
gi|294101254|ref|YP_003553112.1|  .....................................----------.----------....--
gi|294102077|ref|YP_003553935.1|  .....................................----------.----------....RE
gi|294102510|ref|YP_003554368.1|  .....................................----------.------RDLAkl..RP
gi|294101748|ref|YP_003553606.1|  .....................................----------.----------....--
gi|294101141|ref|YP_003552999.1|  .....................................----------.----------....--
gi|294101018|ref|YP_003552876.1|  .....................................----------.----------....--
gi|294101692|ref|YP_003553550.1|  .....................................----------.----------....--
gi|294101032|ref|YP_003552890.1|  .....................................----------.----------....--
gi|294101031|ref|YP_003552889.1|  .....................................----------.----------....--
gi|294101431|ref|YP_003553289.1|  .....................................----------.----------....--
gi|294102167|ref|YP_003554025.1|  .....................................----------.----------....--
gi|294101458|ref|YP_003553316.1|  .....................................----------.----------....--
gi|294102320|ref|YP_003554178.1|  .....................................----------.----------....--
gi|294101940|ref|YP_003553798.1|  .....................................----------.----------....--
gi|294102120|ref|YP_003553978.1|  .....................................----------.----------....--
gi|294101791|ref|YP_003553649.1|  .....................................----------.----------....--
gi|294102136|ref|YP_003553994.1|  .....................................----------.----------....--
gi|294101830|ref|YP_003553688.1|  .....................................----------.----------....--
gi|294102042|ref|YP_003553900.1|  .....................................----------.----------....--
gi|294102015|ref|YP_003553873.1|  .....................................----------.----------....--
gi|294102787|ref|YP_003554645.1|  .....................................----------.----------....--
gi|294102032|ref|YP_003553890.1|  .....................................----------.----------....--
gi|294102010|ref|YP_003553868.1|  .....................................----------.----------....--
gi|294101586|ref|YP_003553444.1|  .....................................----------.----------....--
gi|294101458|ref|YP_003553316.1|  .....................................----------.----------....--
gi|294102625|ref|YP_003554483.1|  .....................................----------.----------....--
gi|294102478|ref|YP_003554336.1|  .....................................----------.----------....--
gi|294101874|ref|YP_003553732.1|  .....................................----------.----------....--
gi|294102071|ref|YP_003553929.1|  .....................................----------.----------....--


                                           30        40               50              60        70  
                                            |         |                |               |         |  
d2akab1                             DLDLPQ.IAVVGGQSAGKS.SVLENFV......GRD...F..LPRGSG.IVTRRPLVLQLVNST
gi|294102520|ref|YP_003554378.1|  ------.------------.-------......---...-..------.---------------
gi|294102529|ref|YP_003554387.1|  ------.------------.-------......---...-..------.---------------
gi|294102437|ref|YP_003554295.1|  ------.------------.-------......---...-..------.---------------
gi|294102168|ref|YP_003554026.1|  ------.----G-------.-------......---...-..------.---------------
gi|294101779|ref|YP_003553637.1|  ------.--LLGVTGSGKTfTVANVLA......QFD...R..-P----.---------------
gi|294102457|ref|YP_003554315.1|  ------.------------.-------......---...-..------.---------------
gi|294101625|ref|YP_003553483.1|  ----RN.IGIAAHIDAGKT.TTTERILfyt...GRN...YkmGETHEG.SATM-----------
gi|294101185|ref|YP_003553043.1|  ------.-VLIGDPGVGKT.AIVEGLA......QR-...-..------.---------------
gi|294102626|ref|YP_003554484.1|  ------.------------.-------......---...-..------.---------------
gi|294101765|ref|YP_003553623.1|  ----GL.ILVTGPTGSGKS.TTLHALI......KQV...N..ALTLNV.TTIE-----------
gi|294102479|ref|YP_003554337.1|  -----R.VAVVGETGGGKS.TLMDLI-......---...-..------.---------------
gi|294101904|ref|YP_003553762.1|  -----L.ITFLGPSGCGKT.TILRMIA......GFE...K..-PT---.---------------
gi|294102557|ref|YP_003554415.1|  ----EL.ITLLGPSGCGKT.TLLRMIA......GFE...D..PTEGDVfFGDRR----------
gi|294101807|ref|YP_003553665.1|  ------.------------.-------......---...-..------.---------------
gi|294101806|ref|YP_003553664.1|  ------.------------.-------......---...-..------.---------------
gi|294102649|ref|YP_003554507.1|  QSGEI-.FGIIGLSGAGKS.TLLRTLN......RLE...E..-PSSGS.ICIG-----------
gi|294101185|ref|YP_003553043.1|  RRPVGS.FIFLGPTGVGKT.ELAKTLA......EAL...F..------.---------------
gi|294102868|ref|YP_003554726.1|  -----L.VSLLGPSGCGKT.TTLRMIG......G--...-..------.---------------
gi|294102500|ref|YP_003554358.1|  -VAPKN.ILMVGPTGVGKT.EIARRLA......DLV...L..APFVKV.EAT------------
gi|294102409|ref|YP_003554267.1|  ------.------------.-------......---...-..------.---------------
gi|294102354|ref|YP_003554212.1|  --DIRS.VAIAAHGGAGKT.SLVEAILfs....NGD...I..NRMGN-.---------------
gi|294101565|ref|YP_003553423.1|  RRPVGS.FLFLGPTGVGKT.ELARRLA......DF-...-..------.---------------
gi|294101424|ref|YP_003553282.1|  -----V.VSVIGPSGSGKS.TLARCIC......RLE...D..------.---------------
gi|294101976|ref|YP_003553834.1|  ------.------------.-------......---...-..------.---------------
gi|294101061|ref|YP_003552919.1|  ------.-VFIGPSGTGKS.TLLRCIN......QLT...I..------.---------------
gi|294101048|ref|YP_003552906.1|  ------.FVIMGLSGSGKS.TLIRCVI......---...-..------.---------------
gi|294101977|ref|YP_003553835.1|  ------.V-----------.-------......---...-..------.---------------
gi|294101084|ref|YP_003552942.1|  -----L.VSIIGPSGCGKS.TFLRCLN......CLE...Y..-IDSGT.ITIAGVTVSRTGKEK
gi|294101565|ref|YP_003553423.1|  ------.-VLLGDPGVGKT.AIVEGLA......Q--...-..------.---------------
gi|294101786|ref|YP_003553644.1|  -----T.LGVVGESGCGKS.TLGRAVL......RLC...-..------.---------------
gi|294101493|ref|YP_003553351.1|  ------.LSIMGASGSGKS.TLMNIIG......CLD...-..------.---------------
gi|294101884|ref|YP_003553742.1|  TGKALV.IGITGSPGAGKS.TLVDKLI......LEF...R..-KKKKT.VG-------------
gi|294101894|ref|YP_003553752.1|  ELQKSN.VLLIGPTGSGKT.LLAQSLAkkl...NVP...F..AMADAT.T--------------
gi|294101778|ref|YP_003553636.1|  GAKVPKgVLLLGPPGTGKT.LLARAAA......GEA...-..------.---------------
gi|294102313|ref|YP_003554171.1|  ------.-GLIGPSGSGKT.TLLNIIG......ALD...A..PSEGSV.VVIDR----------
gi|294102640|ref|YP_003554498.1|  ---GQT.LGLVGESGCGKS.TLGRVVI......---...-..------.---------------
gi|294101376|ref|YP_003553234.1|  GVQPPKgVLLYGPPGTGKT.VIARAVA......NET...D..------.------VYFTHISGP
gi|294102641|ref|YP_003554499.1|  ------.LGFVGETGAGKT.TTA----......---...-..------.---------------
gi|294101359|ref|YP_003553217.1|  ------.------------.-------......---...-..------.---------------
gi|294102459|ref|YP_003554317.1|  ------.-LLVSPPKAGKT.TVLKKIA......NA-...-..------.---------------
gi|294101785|ref|YP_003553643.1|  -DEGVT.LGIVGETGAGKT.TLAKSIM......R--...-..------.---------------
gi|294101376|ref|YP_003553234.1|  NITPPQgILLHGPSGTGKT.LLVRALA......HESgvnF..I-----.---------------
gi|294102074|ref|YP_003553932.1|  ------.-VISGPSGAGKG.TVRKALF......EQM...P..DLVYSI.SCTTR----------
gi|294102442|ref|YP_003554300.1|  ------.VYLVGTTGSGKT.TLMRLIT......REL...I..QTRG--.---------------
gi|294101577|ref|YP_003553435.1|  ------.VGLLGPNGAGKT.TTFYMIV......G--...-..------.---------------
gi|294101171|ref|YP_003553029.1|  -----I.VGLIGPNGAGKT.TIFNVVT......GV-...-..------.---------------
gi|294102413|ref|YP_003554271.1|  -----I.VGLIGPNGAGKT.TVFNMIT......GFY...K..------.---------------
gi|294102187|ref|YP_003554045.1|  -EARYN.IIVTGGTGSGKT.TTLNVLS......---...-..------.---------------
gi|294102332|ref|YP_003554190.1|  -----V.VGLIGPSGSGKS.TLLKCL-......---...-..------.---------------
gi|294102831|ref|YP_003554689.1|  ------.------------.-------......---...-..------.---------------
gi|294101321|ref|YP_003553179.1|  ---HLN.VGTIGHIDHGKT.TLTAAIT......KCL...S..------.---------------
gi|294101626|ref|YP_003553484.1|  ---HLN.VGTIGHIDHGKT.TLTAAIT......KCL...S..------.---------------
gi|294101069|ref|YP_003552927.1|  ----EM.VMILGPNGSGKT.TLLRCLN......GIN...R..-PQKGT.I--------------
gi|294102759|ref|YP_003554617.1|  ------.--LVGESGSGKS.SLLMAIP......G--...-..------.---------------
gi|294101055|ref|YP_003552913.1|  ------.TAIIGPSGCGKS.TFLKSLN......---...-..------.---------------
gi|294101254|ref|YP_003553112.1|  ------.-ALLGENGAGKS.TLMNILY......GLY...N..------.---------------
gi|294102760|ref|YP_003554618.1|  ------.LALIGESGSGKT.SLLRVLL......GL-...-..------.---------------
gi|294101659|ref|YP_003553517.1|  -----W.LALLGSNGSGKS.TLAKHL-......---...-..------.---------------
gi|294101172|ref|YP_003553030.1|  -----I.VCVIGANGAGKS.TLMNALM......SE-...-..------.---------------
gi|294102017|ref|YP_003553875.1|  ------.--------AGKS.T------......---...-..------.---------------
gi|294101748|ref|YP_003553606.1|  ------.------------.-------......---...-..------.---------------
gi|294102409|ref|YP_003554267.1|  ------.------------.-------......---...-..------.---------------
gi|294102070|ref|YP_003553928.1|  DPEEIR.VSIVGRPNVGKS.SLVNALA......GSD...R..VLVSDI.PGTTR----------
gi|294102390|ref|YP_003554248.1|  ------.----GDVGSGKT.A------......---...-..------.---------------
gi|294101403|ref|YP_003553261.1|  ------.VEIFGPEGSGKT.TV-----......---...-..------.---------------
gi|294101730|ref|YP_003553588.1|  ------.---SGPRGCGKT.TLARLLAksl...NCT...G..QKQSVE.PCNDC----------
gi|294102602|ref|YP_003554460.1|  ---IRN.LAIIAHIDHGKT.TLIDSIF......KAAq..I..FRKGAH.IEER-----------
gi|294102663|ref|YP_003554521.1|  ------.-ALIGPSGCGKS.SFIRCLN......RMN...-..------.---------------
gi|294101436|ref|YP_003553294.1|  -----K.CGIVGLPLCGKS.TVFNVITra....GAE...V..KPYASG.KT-------------
gi|294102150|ref|YP_003554008.1|  -----N.FCIIAHIDHGKS.TLADRLI......EYTgt.V..------.---------------
gi|294101607|ref|YP_003553465.1|  ------.------------.-------......---...-..------.---------------
gi|294102035|ref|YP_003553893.1|  ------.------------.-------......---...-..------.---------------
gi|294102412|ref|YP_003554270.1|  -----I.VTLIGANGAGKS.STIRSIA......GLV...R..SAKGKI.LYTSN----------
gi|294101660|ref|YP_003553518.1|  -----W.LSIVGHTGSGKS.TLAQHL-......---...-..------.---------------
gi|294102549|ref|YP_003554407.1|  ------.--LVGENGAGKS.TVVKCVY......GLY...S..------.---------------
gi|294102841|ref|YP_003554699.1|  ------.LVIIGPNGGGKT.TLLRLIL......GLE...K..PARGKI.EV-------------
gi|294101272|ref|YP_003553130.1|  ------.-VLIGPSGCGKS.TLFDLLT......G--...-..------.---------------
gi|294101433|ref|YP_003553291.1|  ------.------------.-------......---...-..------.---------------
gi|294101963|ref|YP_003553821.1|  -PRPPI.VTVMGHVDHGKT.TLLDYIR......QTN...I..TAREAG.GITQ-----------
gi|294101356|ref|YP_003553214.1|  -----K.IALVGVNGAGKS.TLSRLIS......QSE...V..-PTEG-.---------------
gi|294102542|ref|YP_003554400.1|  ------.LGLLGANGSGKS.TLLRILA......FLE...-..------.---------------
gi|294101861|ref|YP_003553719.1|  KEALDH.ILFYGPPGLGKT.TLAGIIA......HEM...-..------.---------------
gi|294102400|ref|YP_003554258.1|  ------.------------.-------......---...-..------.---------------
gi|294102043|ref|YP_003553901.1|  ------.------------.-------......---...-..------.---------------
gi|294101077|ref|YP_003552935.1|  ---KEK.IYIRGENGAGKT.TLFSLIM......GLL...R..------.---------------
gi|294102348|ref|YP_003554206.1|  ------.--VLGRNGAGKS.SLAYALM......GLPd..Y..------.---------------
gi|294102040|ref|YP_003553898.1|  -----V.IVLVGVNGSGKT.TTAAKLAeqfhrqGKK...V..-I----.LG-------------
gi|294101613|ref|YP_003553471.1|  ------.-AIVGPNGSGKS.NILDGL-......---...-..------.---------------
gi|294101367|ref|YP_003553225.1|  ------.LGLVGENGAGKS.TLMNILF......GMP...V..------.---------------
gi|294101893|ref|YP_003553751.1|  ---GQV.LCFVGPPGVGKT.SLAQSIAral...GRR...F..------.---------------
gi|294101841|ref|YP_003553699.1|  ------.VGLVGLPNAGKS.SLLAAIS......NAR...P..KIAGYP.FTTL-----------
gi|294102070|ref|YP_003553928.1|  ------.IAIVGRPNVGKS.SLFNRIL......GRR...E..AIVDDM.PGVTR----------
gi|294102221|ref|YP_003554079.1|  ------.------------.-------......---...-..------.---------------
gi|294101356|ref|YP_003553214.1|  ------.-GLIGSNGTGKT.TLFKIIM......GL-...-..------.---------------
gi|294101345|ref|YP_003553203.1|  -----L.VCLIGPNGVGKT.TLLKTLA......GTQ...N..------.---------------
gi|294102145|ref|YP_003554003.1|  ------.---AGHIDHGKT.TLVKALT......GVS...C..------.---------------
gi|294101756|ref|YP_003553614.1|  ------.--IVGRPNVGKS.SLLNNIL......AYK...V..SIVSEK.PQTTR----------
gi|294102549|ref|YP_003554407.1|  ------.VGIAGITGNGQS.ELEEAIS......GLR...F..VKEGQL.---------------
gi|294101372|ref|YP_003553230.1|  LREGIR.VALVGRPNVGKS.SLLNALL......KES...R..AIVTAI.PGTTR----------
gi|294101016|ref|YP_003552874.1|  ------.------------.-------......---...-..------.---------------
gi|294101780|ref|YP_003553638.1|  ------.-VITGPSGSGKS.SL-----......---...-..------.---------------
gi|294101686|ref|YP_003553544.1|  WVSGGV.VLLGGQPGIGKS.TLLLQVC......GAM...A..------.---------------
gi|294102507|ref|YP_003554365.1|  ----HN.LLFIGSPGSGKT.MLARAIR......GI-...-..------.---------------
gi|294101471|ref|YP_003553329.1|  -----V.VGLVGPSGKGKT.TLGDILL......GL-...-..------.---------------
gi|294101845|ref|YP_003553703.1|  --KGRF.IAITGESGAGKS.SIVRAL-......---...-..------.---------------
gi|294101553|ref|YP_003553411.1|  ----TL.CMMVGLQGSGKT.TSAVKIA......KR-...-..------.------------IQN
gi|294101853|ref|YP_003553711.1|  -EDLPH.LLVAGTTGSGKS.VFVNS--......---...-..------.----CIAGLCYCRKP
gi|294101780|ref|YP_003553638.1|  ------.--ISGVSGSGKS.SLLY---......---...-..------.---------------
gi|294102079|ref|YP_003553937.1|  ----LV.VAIDGPAGAGKS.SVAKK--......---...-..------.---------------
gi|294101472|ref|YP_003553330.1|  ------.-FLVGETGSGKT.PIAQAIA......G--...-..------.---------------
gi|294102235|ref|YP_003554093.1|  -----T.LALAGNPNTGKT.SLFNLLT......GSR...Q..-HVGNW.PGVTV----------
gi|294102390|ref|YP_003554248.1|  ------.------------.-------......---...-..------.---------------
gi|294101443|ref|YP_003553301.1|  -GKVPS.CVLYGPPGVGKT.TLVRLMAmvt...ERS...L..LEINAV.SA-------------
gi|294101748|ref|YP_003553606.1|  ------.------------.-------......---...-..------.---------------
gi|294101649|ref|YP_003553507.1|  -----R.VILLGPPGAGK-.-------......---...-..------.---------------
gi|294101715|ref|YP_003553573.1|  ------.------------.-------......---...-..------.---------------
gi|294101925|ref|YP_003553783.1|  -----H.CAILGSTGSGKS.NTT----......---...-..------.---------------
gi|294101367|ref|YP_003553225.1|  ------.------------.-------......---...-..------.---------------
gi|294101751|ref|YP_003553609.1|  ------.------------.-------......---...-..------.---------------
gi|294101046|ref|YP_003552904.1|  ------.------------.-------......---...-..------.---------------
gi|294101779|ref|YP_003553637.1|  ------.------------.-------......---...-..------.---------------
gi|294101226|ref|YP_003553084.1|  ------.--LIGNPNVGKS.VIFSRLT......GVR...A..-ISSNY.PGTTV----------
gi|294101892|ref|YP_003553750.1|  -QTLPE.VAFVGRSNVGKS.MLLNALM......ERK...L..AHVGST.PG-------------
gi|294102315|ref|YP_003554173.1|  ------.--IIGMTGSGKT.GLGIALL......EE-...-..------.---------------
gi|294102188|ref|YP_003554046.1|  ------.------------.-------......---...-..------.---------------
gi|294102320|ref|YP_003554178.1|  ------.------------.-------......---...-..------.---------------
gi|294102169|ref|YP_003554027.1|  HRGILV.INIIGSPGAGKT.TLLEATK......KAAsfrF..AVIEGD.IATSR----------
gi|294101254|ref|YP_003553112.1|  ------.------------.-------......---...-..------.---------------
gi|294102077|ref|YP_003553935.1|  KAGIPT.VALTGYTNSGKS.TLLQQLS......HGR...N..LYVADQ.LFSTL----------
gi|294102510|ref|YP_003554368.1|  AHRELR.LAVVGIPNVGKS.LFLNLLV......GKK...R..APVGGV.PGITR----------
gi|294101748|ref|YP_003553606.1|  ------.------------.-------......---...-..------.---------------
gi|294101141|ref|YP_003552999.1|  ------.------------.-------......---...-..------.---------------
gi|294101018|ref|YP_003552876.1|  ------.--LVGNNGSGKT.NALEAI-......---...-..------.---------------
gi|294101692|ref|YP_003553550.1|  ------.------------.-------......---...-..------.---------------
gi|294101032|ref|YP_003552890.1|  ------.------------.-------......---...-..------.---------------
gi|294101031|ref|YP_003552889.1|  ------.------------.-------......---...-..------.---------------
gi|294101431|ref|YP_003553289.1|  -----V.IVIAGPSGSGKT.TTAKRL-......---...-..------.---------------
gi|294102167|ref|YP_003554025.1|  ------.LGVTGDVGAGKS.TV-----......---...-..------.---------------
gi|294101458|ref|YP_003553316.1|  ------.------------.-------......---...-..------.---------------
gi|294102320|ref|YP_003554178.1|  ------.------------.-------......---...-..------.---------------
gi|294101940|ref|YP_003553798.1|  ------.------------.-------......---...-..------.---------------
gi|294102120|ref|YP_003553978.1|  ------.-ILGGGTGVGKT.HLAIAM-......---...-..------.---------------
gi|294101791|ref|YP_003553649.1|  ---GLT.ILLYGDLGAGKT.VLVKGL-......---...-..------.---------------
gi|294102136|ref|YP_003553994.1|  ------.------------.-------......---...-..------.---------------
gi|294101830|ref|YP_003553688.1|  ------.LIITGMSGAGKS.TVLNILE......DQG...L..FAVDNI.PPALLPQLLEL----
gi|294102042|ref|YP_003553900.1|  ------.------------.-------......---...-..------.---------------
gi|294102015|ref|YP_003553873.1|  ------.-AIIGPTAVGKT.KL-----......---...-..------.---------------
gi|294102787|ref|YP_003554645.1|  ------.--ILGDNESGKT.TLMSFL-......---...-..------.---------------
gi|294102032|ref|YP_003553890.1|  ------.------------.-------......---...-..------.---------------
gi|294102010|ref|YP_003553868.1|  YEWPKA.VAVTGALGSGKT.-------......---...-..------.---------------
gi|294101586|ref|YP_003553444.1|  ------.-AVSGMKNSGKT.KLC----......---...-..------.---------------
gi|294101458|ref|YP_003553316.1|  ------.------------.-------......---...-..------.---------------
gi|294102625|ref|YP_003554483.1|  ------.------------.-------......---...-..------.---------------
gi|294102478|ref|YP_003554336.1|  ------.------------.-------......---...-..------.---------------
gi|294101874|ref|YP_003553732.1|  -----V.IAFVGPAGTGKS.-------......---...-..------.---------------
gi|294102071|ref|YP_003553929.1|  ------.------------.-------......---...-..------.---------------


                                          80                                              90       1
                                           |                                               |        
d2akab1                             TEYAEFLHCKGKKF......................................TDFEEVRLEIEA
gi|294102520|ref|YP_003554378.1|  --------------......................................------------
gi|294102529|ref|YP_003554387.1|  --------------......................................------------
gi|294102437|ref|YP_003554295.1|  --------------......................................------------
gi|294102168|ref|YP_003554026.1|  --------------......................................------------
gi|294101779|ref|YP_003553637.1|  --------------......................................------------
gi|294102457|ref|YP_003554315.1|  --------------......................................-DLGHYERFIDE
gi|294101625|ref|YP_003553483.1|  --------------......................................------------
gi|294101185|ref|YP_003553043.1|  --------------......................................------------
gi|294102626|ref|YP_003554484.1|  --------------......................................------------
gi|294101765|ref|YP_003553623.1|  --------------......................................------------
gi|294102479|ref|YP_003554337.1|  --------------......................................------------
gi|294101904|ref|YP_003553762.1|  --------------......................................------------
gi|294102557|ref|YP_003554415.1|  --------------......................................------------
gi|294101807|ref|YP_003553665.1|  --------------......................................------------
gi|294101806|ref|YP_003553664.1|  --------------......................................------------
gi|294102649|ref|YP_003554507.1|  --------------......................................------------
gi|294101185|ref|YP_003553043.1|  --------------......................................------------
gi|294102868|ref|YP_003554726.1|  --------------......................................------------
gi|294102500|ref|YP_003554358.1|  --------------......................................------------
gi|294102409|ref|YP_003554267.1|  -------T------......................................------------
gi|294102354|ref|YP_003554212.1|  -------------V......................................VDGNTVADFGAE
gi|294101565|ref|YP_003553423.1|  --------------......................................------------
gi|294101424|ref|YP_003553282.1|  --------------......................................------------
gi|294101976|ref|YP_003553834.1|  --------------......................................------------
gi|294101061|ref|YP_003552919.1|  --------------......................................------------
gi|294101048|ref|YP_003552906.1|  --------------......................................------------
gi|294101977|ref|YP_003553835.1|  --------------......................................------------
gi|294101084|ref|YP_003552942.1|  --------------......................................------------
gi|294101565|ref|YP_003553423.1|  --------------......................................------------
gi|294101786|ref|YP_003553644.1|  --------------......................................------------
gi|294101493|ref|YP_003553351.1|  --------------......................................------------
gi|294101884|ref|YP_003553742.1|  --------------......................................------------
gi|294101894|ref|YP_003553752.1|  --------------......................................------------
gi|294101778|ref|YP_003553636.1|  --------------......................................------------
gi|294102313|ref|YP_003554171.1|  --------------......................................----NVENLSH-
gi|294102640|ref|YP_003554498.1|  --------------......................................------------
gi|294101376|ref|YP_003553234.1|  EIIG----------......................................------------
gi|294102641|ref|YP_003554499.1|  --------------......................................------------
gi|294101359|ref|YP_003553217.1|  --------------......................................------------
gi|294102459|ref|YP_003554317.1|  --------------......................................------------
gi|294101785|ref|YP_003553643.1|  --------------......................................------------
gi|294101376|ref|YP_003553234.1|  --------------......................................------------
gi|294102074|ref|YP_003553932.1|  --------QPRDGE......................................RDGVDYRFLSEE
gi|294102442|ref|YP_003554300.1|  --------------......................................------------
gi|294101577|ref|YP_003553435.1|  --------------......................................------------
gi|294101171|ref|YP_003553029.1|  --------------......................................------------
gi|294102413|ref|YP_003554271.1|  --------------......................................------------
gi|294102187|ref|YP_003554045.1|  --------------......................................------------
gi|294102332|ref|YP_003554190.1|  --------------......................................------------
gi|294102831|ref|YP_003554689.1|  --------------......................................------------
gi|294101321|ref|YP_003553179.1|  -------TKGWSNF......................................EAYDMIDKAPEE
gi|294101626|ref|YP_003553484.1|  -------TKGWSNF......................................EAYDMIDKAPEE
gi|294101069|ref|YP_003552927.1|  --------------......................................------------
gi|294102759|ref|YP_003554617.1|  --------------......................................------------
gi|294101055|ref|YP_003552913.1|  --------------......................................------------
gi|294101254|ref|YP_003553112.1|  PDRGHILIDGKKVSfsspkdaiaagigmvhqhfmlipsqtvwenmilgleglPQLLPKKEIHQQ
gi|294102760|ref|YP_003554618.1|  --------------......................................------------
gi|294101659|ref|YP_003553517.1|  --------------......................................------------
gi|294101172|ref|YP_003553030.1|  --------------......................................------------
gi|294102017|ref|YP_003553875.1|  --------------......................................------------
gi|294101748|ref|YP_003553606.1|  --------------......................................------------
gi|294102409|ref|YP_003554267.1|  --------------......................................------------
gi|294102070|ref|YP_003553928.1|  --------------......................................------------
gi|294102390|ref|YP_003554248.1|  --------------......................................------------
gi|294101403|ref|YP_003553261.1|  --------------......................................------------
gi|294101730|ref|YP_003553588.1|  --------------......................................------------
gi|294102602|ref|YP_003554460.1|  -------------V......................................MDSNEL------
gi|294102663|ref|YP_003554521.1|  --------------......................................------------
gi|294101436|ref|YP_003553294.1|  --------------......................................-----------D
gi|294102150|ref|YP_003554008.1|  --------------......................................-EIRKMKAQLLD
gi|294101607|ref|YP_003553465.1|  --------------......................................------------
gi|294102035|ref|YP_003553893.1|  --------------......................................------------
gi|294102412|ref|YP_003554270.1|  --------------......................................------------
gi|294101660|ref|YP_003553518.1|  --------------......................................------------
gi|294102549|ref|YP_003554407.1|  --------------......................................------------
gi|294102841|ref|YP_003554699.1|  --------------......................................------------
gi|294101272|ref|YP_003553130.1|  --------------......................................------------
gi|294101433|ref|YP_003553291.1|  --------------......................................------------
gi|294101963|ref|YP_003553821.1|  --------------......................................------------
gi|294101356|ref|YP_003553214.1|  --------------......................................------------
gi|294102542|ref|YP_003554400.1|  --------------......................................------------
gi|294101861|ref|YP_003553719.1|  --------------......................................------------
gi|294102400|ref|YP_003554258.1|  --------------......................................------------
gi|294102043|ref|YP_003553901.1|  --------------......................................------------
gi|294101077|ref|YP_003552935.1|  --------------......................................------------
gi|294102348|ref|YP_003554206.1|  --------------......................................------------
gi|294102040|ref|YP_003553898.1|  -------AADTFRA......................................AAIDQLKIWGER
gi|294101613|ref|YP_003553471.1|  --------------......................................------------
gi|294101367|ref|YP_003553225.1|  --------------......................................------------
gi|294101893|ref|YP_003553751.1|  --------------......................................------------
gi|294101841|ref|YP_003553699.1|  --------------......................................------------
gi|294102070|ref|YP_003553928.1|  --------------......................................------------
gi|294102221|ref|YP_003554079.1|  --------------......................................---EEIKRQIEI
gi|294101356|ref|YP_003553214.1|  --------------......................................------------
gi|294101345|ref|YP_003553203.1|  --------------......................................------------
gi|294102145|ref|YP_003554003.1|  --------------......................................------------
gi|294101756|ref|YP_003553614.1|  --------------......................................------------
gi|294102549|ref|YP_003554407.1|  --------------......................................------------
gi|294101372|ref|YP_003553230.1|  --------------......................................------------
gi|294101016|ref|YP_003552874.1|  --------------......................................------------
gi|294101780|ref|YP_003553638.1|  --------------......................................------------
gi|294101686|ref|YP_003553544.1|  --------------......................................------------
gi|294102507|ref|YP_003554365.1|  --------------......................................------------
gi|294101471|ref|YP_003553329.1|  --------------......................................------------
gi|294101845|ref|YP_003553703.1|  --------------......................................------------
gi|294101553|ref|YP_003553411.1|  AHNPLVVACDLRRP......................................AAIEQLKVLAQQ
gi|294101853|ref|YP_003553711.1|  EELRLLMIDPKRVE......................................LS----------
gi|294101780|ref|YP_003553638.1|  --------------......................................------------
gi|294102079|ref|YP_003553937.1|  --------------......................................------------
gi|294101472|ref|YP_003553330.1|  --------------......................................------------
gi|294102235|ref|YP_003554093.1|  --------------......................................------------
gi|294102390|ref|YP_003554248.1|  --------------......................................------------
gi|294101443|ref|YP_003553301.1|  --------------......................................-KVSELRDLVEE
gi|294101748|ref|YP_003553606.1|  --------------......................................------------
gi|294101649|ref|YP_003553507.1|  --------------......................................------------
gi|294101715|ref|YP_003553573.1|  --------------......................................------------
gi|294101925|ref|YP_003553783.1|  --------------......................................------------
gi|294101367|ref|YP_003553225.1|  --------------......................................------------
gi|294101751|ref|YP_003553609.1|  E-------------......................................------------
gi|294101046|ref|YP_003552904.1|  ---G----------......................................------------
gi|294101779|ref|YP_003553637.1|  --------------......................................------------
gi|294101226|ref|YP_003553084.1|  --------------......................................------------
gi|294101892|ref|YP_003553750.1|  --------------......................................------------
gi|294102315|ref|YP_003554173.1|  --------------......................................------------
gi|294102188|ref|YP_003554046.1|  --------------......................................------------
gi|294102320|ref|YP_003554178.1|  --------------......................................------------
gi|294102169|ref|YP_003554027.1|  --------------......................................-DAERLSKLGVP
gi|294101254|ref|YP_003553112.1|  --------------......................................H-----------
gi|294102077|ref|YP_003553935.1|  --------------......................................------------
gi|294102510|ref|YP_003554368.1|  --------------......................................------------
gi|294101748|ref|YP_003553606.1|  --------------......................................------------
gi|294101141|ref|YP_003552999.1|  --------------......................................------------
gi|294101018|ref|YP_003552876.1|  --------------......................................------------
gi|294101692|ref|YP_003553550.1|  --------------......................................------------
gi|294101032|ref|YP_003552890.1|  --------------......................................------------
gi|294101031|ref|YP_003552889.1|  --------------......................................------------
gi|294101431|ref|YP_003553289.1|  --------------......................................------------
gi|294102167|ref|YP_003554025.1|  --------------......................................------------
gi|294101458|ref|YP_003553316.1|  --------------......................................------------
gi|294102320|ref|YP_003554178.1|  --------------......................................------------
gi|294101940|ref|YP_003553798.1|  --------------......................................------------
gi|294102120|ref|YP_003553978.1|  --------------......................................------------
gi|294101791|ref|YP_003553649.1|  --------------......................................------------
gi|294102136|ref|YP_003553994.1|  --------------......................................------------
gi|294101830|ref|YP_003553688.1|  --------------......................................------------
gi|294102042|ref|YP_003553900.1|  --------------......................................------------
gi|294102015|ref|YP_003553873.1|  --------------......................................------------
gi|294102787|ref|YP_003554645.1|  --------------......................................------------
gi|294102032|ref|YP_003553890.1|  --------------......................................------------
gi|294102010|ref|YP_003553868.1|  --------------......................................------------
gi|294101586|ref|YP_003553444.1|  --------------......................................------------
gi|294101458|ref|YP_003553316.1|  --------------......................................------------
gi|294102625|ref|YP_003554483.1|  --------------......................................-D----------
gi|294102478|ref|YP_003554336.1|  --------------......................................------------
gi|294101874|ref|YP_003553732.1|  --------------......................................------------
gi|294102071|ref|YP_003553929.1|  --------------......................................------------


                                    00                                                  110        1
                                     |                                                    |         
d2akab1                             ETDRVT.GTNK..........................................GISPVPIN.LR
gi|294102520|ref|YP_003554378.1|  ------.----..........................................--------.--
gi|294102529|ref|YP_003554387.1|  ------.----..........................................--------.--
gi|294102437|ref|YP_003554295.1|  ------.----..........................................--------.--
gi|294102168|ref|YP_003554026.1|  ------.----..........................................--------.--
gi|294101779|ref|YP_003553637.1|  ------.----..........................................--------.--
gi|294102457|ref|YP_003554315.1|  SLSADN.NVTT..........................................GKIYSTVI.SK
gi|294101625|ref|YP_003553483.1|  --DWMEqERER..........................................GITISSAA.TT
gi|294101185|ref|YP_003553043.1|  ------.----..........................................--------.--
gi|294102626|ref|YP_003554484.1|  ------.----..........................................--------.--
gi|294101765|ref|YP_003553623.1|  ------.----..........................................----DPVE.RF
gi|294102479|ref|YP_003554337.1|  ------.----..........................................--------.--
gi|294101904|ref|YP_003553762.1|  ------.----..........................................--------.--
gi|294102557|ref|YP_003554415.1|  ------.----..........................................--------.--
gi|294101807|ref|YP_003553665.1|  ------.----..........................................--------.--
gi|294101806|ref|YP_003553664.1|  ------.----..........................................--------.--
gi|294102649|ref|YP_003554507.1|  ------.----..........................................--------.--
gi|294101185|ref|YP_003553043.1|  ------.----..........................................--------.--
gi|294102868|ref|YP_003554726.1|  ------.----..........................................--------.--
gi|294102500|ref|YP_003554358.1|  ------.----..........................................--------.--
gi|294102409|ref|YP_003554267.1|  ------.----..........................................--------.--
gi|294102354|ref|YP_003554212.1|  E-----.-QKR..........................................QISINTAL.VT
gi|294101565|ref|YP_003553423.1|  ------.----..........................................--------.--
gi|294101424|ref|YP_003553282.1|  ------.----..........................................--------.--
gi|294101976|ref|YP_003553834.1|  ------.----..........................................--------.--
gi|294101061|ref|YP_003552919.1|  ------.----..........................................--------.--
gi|294101048|ref|YP_003552906.1|  ------.----..........................................--------.--
gi|294101977|ref|YP_003553835.1|  ------.----..........................................--------.--
gi|294101084|ref|YP_003552942.1|  ------.----..........................................--------.--
gi|294101565|ref|YP_003553423.1|  ------.----..........................................--------.--
gi|294101786|ref|YP_003553644.1|  ------.----..........................................--------.--
gi|294101493|ref|YP_003553351.1|  ------.----..........................................--------.--
gi|294101884|ref|YP_003553742.1|  ------.---IiavdpsspfsggailadrirmqrhandpdvyirsmgtrgslgGVSRSTREaVK
gi|294101894|ref|YP_003553752.1|  ------.----..........................................--------.--
gi|294101778|ref|YP_003553636.1|  ------.----..........................................--------.--
gi|294102313|ref|YP_003554171.1|  ------.----..........................................--------.--
gi|294102640|ref|YP_003554498.1|  ------.----..........................................--------.--
gi|294101376|ref|YP_003553234.1|  ------.----..........................................--------.--
gi|294102641|ref|YP_003554499.1|  ------.----..........................................--------.--
gi|294101359|ref|YP_003553217.1|  ------.----..........................................--------.--
gi|294102459|ref|YP_003554317.1|  ------.----..........................................--------.--
gi|294101785|ref|YP_003553643.1|  ------.----..........................................--------.--
gi|294101376|ref|YP_003553234.1|  ------.----..........................................--------.--
gi|294102074|ref|YP_003553932.1|  EFKKL-.----..........................................--------.--
gi|294102442|ref|YP_003554300.1|  ------.----..........................................--------.--
gi|294101577|ref|YP_003553435.1|  ------.----..........................................--------.--
gi|294101171|ref|YP_003553029.1|  ------.----..........................................--------.--
gi|294102413|ref|YP_003554271.1|  ------.----..........................................--------.--
gi|294102187|ref|YP_003554045.1|  ------.----..........................................--------.--
gi|294102332|ref|YP_003554190.1|  ------.----..........................................--------.--
gi|294102831|ref|YP_003554689.1|  ------.----..........................................--------.--
gi|294101321|ref|YP_003553179.1|  ------.-RER..........................................GITINISH.VE
gi|294101626|ref|YP_003553484.1|  ------.-RER..........................................GITINISH.VE
gi|294101069|ref|YP_003552927.1|  ------.----..........................................--------.--
gi|294102759|ref|YP_003554617.1|  ------.----..........................................--------.--
gi|294101055|ref|YP_003552913.1|  ------.----..........................................--------.--
gi|294101254|ref|YP_003553112.1|  IIDISR.QYGL..........................................EVDPDAKI.WQ
gi|294102760|ref|YP_003554618.1|  ------.----..........................................--------.--
gi|294101659|ref|YP_003553517.1|  ------.----..........................................--------.--
gi|294101172|ref|YP_003553030.1|  ------.----..........................................--------.--
gi|294102017|ref|YP_003553875.1|  ------.----..........................................--------.--
gi|294101748|ref|YP_003553606.1|  ------.----..........................................--------.--
gi|294102409|ref|YP_003554267.1|  ------.----..........................................--------.--
gi|294102070|ref|YP_003553928.1|  ------.----..........................................----DATD.TV
gi|294102390|ref|YP_003554248.1|  ------.----..........................................--------.--
gi|294101403|ref|YP_003553261.1|  ------.----..........................................--------.--
gi|294101730|ref|YP_003553588.1|  ------.----..........................................--------.--
gi|294102602|ref|YP_003554460.1|  ------.ERER..........................................GITIRAKH.CT
gi|294102663|ref|YP_003554521.1|  ------.----..........................................--------.--
gi|294101436|ref|YP_003553294.1|  PNRAMV.SVPD..........................................PRFEHLVT.IF
gi|294102150|ref|YP_003554008.1|  SLDLER.ERGI..........................................TIKLVPVR.MS
gi|294101607|ref|YP_003553465.1|  ------.----..........................................--------.--
gi|294102035|ref|YP_003553893.1|  ------.----..........................................--------.--
gi|294102412|ref|YP_003554270.1|  ------.----..........................................--------.--
gi|294101660|ref|YP_003553518.1|  ------.----..........................................--------.--
gi|294102549|ref|YP_003554407.1|  ------.----..........................................--------.--
gi|294102841|ref|YP_003554699.1|  ------.----..........................................--------.--
gi|294101272|ref|YP_003553130.1|  ------.----..........................................--------.--
gi|294101433|ref|YP_003553291.1|  ------.----..........................................--------.--
gi|294101963|ref|YP_003553821.1|  ------.----..........................................----HIGA.ST
gi|294101356|ref|YP_003553214.1|  ------.----..........................................--------.--
gi|294102542|ref|YP_003554400.1|  ------.----..........................................--------.--
gi|294101861|ref|YP_003553719.1|  ------.----..........................................--------.--
gi|294102400|ref|YP_003554258.1|  ------.----..........................................--------.--
gi|294102043|ref|YP_003553901.1|  ------.----..........................................--------.--
gi|294101077|ref|YP_003552935.1|  ------.----..........................................--------.--
gi|294102348|ref|YP_003554206.1|  ------.----..........................................--------.--
gi|294102040|ref|YP_003553898.1|  T-----.---Gsrviaqqqgsdsa.............................AVAYD--A.LQ
gi|294101613|ref|YP_003553471.1|  ------.----..........................................--------.--
gi|294101367|ref|YP_003553225.1|  ------.----..........................................--------.--
gi|294101893|ref|YP_003553751.1|  ------.----..........................................--------.--
gi|294101841|ref|YP_003553699.1|  ------.----..........................................----SPNL.GI
gi|294102070|ref|YP_003553928.1|  ------.----..........................................----DRIY.GE
gi|294102221|ref|YP_003554079.1|  AYMSPG.AEEA..........................................AIFDKFIE.LM
gi|294101356|ref|YP_003553214.1|  ------.----..........................................--------.--
gi|294101345|ref|YP_003553203.1|  ------.----..........................................--------.--
gi|294102145|ref|YP_003554003.1|  --DRLNeEKKR..........................................GITIELGF.AP
gi|294101756|ref|YP_003553614.1|  ------.----..........................................----NAIH.GI
gi|294102549|ref|YP_003554407.1|  ------.----..........................................--------.--
gi|294101372|ref|YP_003553230.1|  ------.----..........................................----DLIE.EV
gi|294101016|ref|YP_003552874.1|  ------.----..........................................--------.--
gi|294101780|ref|YP_003553638.1|  ------.----..........................................--------.--
gi|294101686|ref|YP_003553544.1|  ------.----..........................................--------.--
gi|294102507|ref|YP_003554365.1|  ------.----..........................................--------.--
gi|294101471|ref|YP_003553329.1|  ------.----..........................................--------.--
gi|294101845|ref|YP_003553703.1|  ------.----..........................................--------.--
gi|294101553|ref|YP_003553411.1|  SKVAFY.GPSG..........................................GTQDVIKV.AK
gi|294101853|ref|YP_003553711.1|  ------.----..........................................--------.--
gi|294101780|ref|YP_003553638.1|  ------.----..........................................--------.--
gi|294102079|ref|YP_003553937.1|  ------.----..........................................--------.--
gi|294101472|ref|YP_003553330.1|  ------.----..........................................--------.--
gi|294102235|ref|YP_003554093.1|  ------.----..........................................----ERKE.GH
gi|294102390|ref|YP_003554248.1|  ------.----..........................................--------.--
gi|294101443|ref|YP_003553301.1|  AKNLKI.----..........................................--------.--
gi|294101748|ref|YP_003553606.1|  ------.----..........................................--------.--
gi|294101649|ref|YP_003553507.1|  ------.----..........................................--------.--
gi|294101715|ref|YP_003553573.1|  ------.----..........................................--------.--
gi|294101925|ref|YP_003553783.1|  ------.----..........................................--------.--
gi|294101367|ref|YP_003553225.1|  ------.----..........................................--------.--
gi|294101751|ref|YP_003553609.1|  ------.----..........................................--------.--
gi|294101046|ref|YP_003552904.1|  ------.----..........................................--------.--
gi|294101779|ref|YP_003553637.1|  ------.----..........................................----T---.--
gi|294101226|ref|YP_003553084.1|  ------.----..........................................----GFLE.GW
gi|294101892|ref|YP_003553750.1|  ------.----..........................................----KTRS.VN
gi|294102315|ref|YP_003554173.1|  ------.----..........................................--------.--
gi|294102188|ref|YP_003554046.1|  ------.----..........................................--------.--
gi|294102320|ref|YP_003554178.1|  ------.----..........................................--------.--
gi|294102169|ref|YP_003554027.1|  AIQINT.HGGC..........................................-----HLE.AN
gi|294101254|ref|YP_003553112.1|  ------.----..........................................--------.--
gi|294102077|ref|YP_003553935.1|  ------.----..........................................----DTYV.RK
gi|294102510|ref|YP_003554368.1|  ------.----..........................................--------.-G
gi|294101748|ref|YP_003553606.1|  ------.----..........................................--------.--
gi|294101141|ref|YP_003552999.1|  ------.----..........................................--------.--
gi|294101018|ref|YP_003552876.1|  ------.----..........................................--------.--
gi|294101692|ref|YP_003553550.1|  ------.----..........................................--------.--
gi|294101032|ref|YP_003552890.1|  ------.----..........................................--------.--
gi|294101031|ref|YP_003552889.1|  ------.----..........................................--------.--
gi|294101431|ref|YP_003553289.1|  ------.----..........................................--------.--
gi|294102167|ref|YP_003554025.1|  ------.----..........................................--------.--
gi|294101458|ref|YP_003553316.1|  ------.----..........................................--------.--
gi|294102320|ref|YP_003554178.1|  ------.----..........................................--------.--
gi|294101940|ref|YP_003553798.1|  ------.----..........................................--------.--
gi|294102120|ref|YP_003553978.1|  ------.----..........................................--------.--
gi|294101791|ref|YP_003553649.1|  ------.----..........................................--------.--
gi|294102136|ref|YP_003553994.1|  ------.----..........................................--------.--
gi|294101830|ref|YP_003553688.1|  ------.----..........................................--------.--
gi|294102042|ref|YP_003553900.1|  ------.----..........................................--------.--
gi|294102015|ref|YP_003553873.1|  ------.----..........................................--------.--
gi|294102787|ref|YP_003554645.1|  ------.----..........................................--------.--
gi|294102032|ref|YP_003553890.1|  ------.----..........................................--------.--
gi|294102010|ref|YP_003553868.1|  ------.----..........................................--------.--
gi|294101586|ref|YP_003553444.1|  ------.----..........................................--------.--
gi|294101458|ref|YP_003553316.1|  ------.----..........................................--------.--
gi|294102625|ref|YP_003554483.1|  ------.----..........................................--------.--
gi|294102478|ref|YP_003554336.1|  ------.----..........................................--------.--
gi|294101874|ref|YP_003553732.1|  ------.----..........................................--------.--
gi|294102071|ref|YP_003553929.1|  ---T--.----..........................................--------.--


                                    20              130       140       150        160         170  
                                     |                |         |         |          |           |  
d2akab1                             VYSPHVL.......NLTLVDLPGMTKVPVGDQPPDIEFQIRDMLMQFV.TKENC..LILAVSPA
gi|294102520|ref|YP_003554378.1|  -------.......----------------------------------.-----..--------
gi|294102529|ref|YP_003554387.1|  -------.......----------------------------------.-----..--------
gi|294102437|ref|YP_003554295.1|  -------.......----------------------------------.-----..--------
gi|294102168|ref|YP_003554026.1|  -------.......----------------------------------.-----..--------
gi|294101779|ref|YP_003553637.1|  -------.......----------------------------------.-----..--------
gi|294102457|ref|YP_003554315.1|  ERHGCY-.......----------------------------------.-----..--------
gi|294101625|ref|YP_003553483.1|  CIWRDCF.......-VNIIDTPG-------------HVDFTVEVERSM.RVLD-..GAVAVFCA
gi|294101185|ref|YP_003553043.1|  -------.......----------------------------------.-----..--------
gi|294102626|ref|YP_003554484.1|  -------.......----------------------------------.-----..--------
gi|294101765|ref|YP_003553623.1|  HEGINQV.......----------------EVDERAGRTFEVV-----.-----..--------
gi|294102479|ref|YP_003554337.1|  -------.......----------------------------------.-----..--------
gi|294101904|ref|YP_003553762.1|  -------.......----------------------------------.-----..--------
gi|294102557|ref|YP_003554415.1|  -------.......----------------------------------.-----..--------
gi|294101807|ref|YP_003553665.1|  -------.......----------------------------------.-----..---AVVFA
gi|294101806|ref|YP_003553664.1|  -------.......----------------------------------.-----..--------
gi|294102649|ref|YP_003554507.1|  -------.......----------------------------------.-----..--------
gi|294101185|ref|YP_003553043.1|  -------.......----------------------------------.-----..--------
gi|294102868|ref|YP_003554726.1|  -------.......----------------------------------.-----..--------
gi|294102500|ref|YP_003554358.1|  -------.......----------------------------------.-----..--------
gi|294102409|ref|YP_003554267.1|  -------.......----------------------------------.-----..--------
gi|294102354|ref|YP_003554212.1|  LERNGKR.......-LYLLDTPG-------------FADFIGEMRSAM.RVSD-..SALAVVSG
gi|294101565|ref|YP_003553423.1|  -------.......----------------------------------.-----..--------
gi|294101424|ref|YP_003553282.1|  -------.......----------------------------------.-----..--------
gi|294101976|ref|YP_003553834.1|  -------.......----------------------------------.-----..--------
gi|294101061|ref|YP_003552919.1|  -------.......----------------------------------.-----..--------
gi|294101048|ref|YP_003552906.1|  -------.......----------------------------------.-----..--------
gi|294101977|ref|YP_003553835.1|  -------.......----------------------------------.-----..--------
gi|294101084|ref|YP_003552942.1|  -------.......----------------------------------.-----..--------
gi|294101565|ref|YP_003553423.1|  -------.......----------------------------------.-----..--------
gi|294101786|ref|YP_003553644.1|  -------.......----------------------------------.-----..--------
gi|294101493|ref|YP_003553351.1|  -------.......----------------------------------.-----..--------
gi|294101884|ref|YP_003553742.1|  ILDACGK.......DVVIIETVGVGQS----------------EIDIV.KLADT..VCLVLVPG
gi|294101894|ref|YP_003553752.1|  -------.......----------------------------------.-----..--------
gi|294101778|ref|YP_003553636.1|  -------.......----------------------------------.-----..--------
gi|294102313|ref|YP_003554171.1|  -------.......----------------------------------.-----..--------
gi|294102640|ref|YP_003554498.1|  -------.......----------------------------------.-----..--------
gi|294101376|ref|YP_003553234.1|  -------.......----------------------------------.-----..--------
gi|294102641|ref|YP_003554499.1|  -------.......----------------------------------.-----..--------
gi|294101359|ref|YP_003553217.1|  -------.......----------------------------------.-----..--------
gi|294102459|ref|YP_003554317.1|  -------.......----------------------------------.-----..--------
gi|294101785|ref|YP_003553643.1|  -------.......----------------------------------.-----..--------
gi|294101376|ref|YP_003553234.1|  -------.......----------------------------------.-----..--------
gi|294102074|ref|YP_003553932.1|  -------.......----------------------------------.-----..--------
gi|294102442|ref|YP_003554300.1|  -------.......----------------------------------.-----..--------
gi|294101577|ref|YP_003553435.1|  -------.......----------------------------------.-----..--------
gi|294101171|ref|YP_003553029.1|  -------.......----------------------------------.-----..--------
gi|294102413|ref|YP_003554271.1|  -------.......----------------------------------.-----..--------
gi|294102187|ref|YP_003554045.1|  -------.......----------------------------------.-----..--------
gi|294102332|ref|YP_003554190.1|  -------.......----------------------------------.-----..--------
gi|294102831|ref|YP_003554689.1|  -------.......----------------------------------.---D-..--------
gi|294101321|ref|YP_003553179.1|  YQTENRH.......-YAHIDCPG-------------HADYIKNMITGA.AQMD-..GAILVVSA
gi|294101626|ref|YP_003553484.1|  YQTENRH.......-YAHIDCPG-------------HADYIKNMITGA.AQMD-..GAILVVSA
gi|294101069|ref|YP_003552927.1|  -------.......----------------------------------.-----..--------
gi|294102759|ref|YP_003554617.1|  -------.......----------------------------------.-----..--------
gi|294101055|ref|YP_003552913.1|  -------.......----------------------------------.-----..--------
gi|294101254|ref|YP_003553112.1|  LSI----.......----------------------GEQQRVAILQML.YRKA-..QVLILDEP
gi|294102760|ref|YP_003554618.1|  -------.......----------------------------------.-----..--------
gi|294101659|ref|YP_003553517.1|  -------.......----------------------------------.-----..--------
gi|294101172|ref|YP_003553030.1|  -------.......----------------------------------.-----..--------
gi|294102017|ref|YP_003553875.1|  -------.......----------------------------------.-----..--------
gi|294101748|ref|YP_003553606.1|  -------.......----------------------------------.-----..--------
gi|294102409|ref|YP_003554267.1|  -------.......----------------------------------.-----..--------
gi|294102070|ref|YP_003553928.1|  IEMKEGK.......-FRFIDTAGLRK--KSRIDSDIEYYSFVRTLQAV.DRSD-..VALLVMDA
gi|294102390|ref|YP_003554248.1|  -------.......----------------------------------.-----..--------
gi|294101403|ref|YP_003553261.1|  -------.......----------------------------------.-----..--------
gi|294101730|ref|YP_003553588.1|  -------.......----------------------------------.-----..--------
gi|294102602|ref|YP_003554460.1|  VEWNGYL.......-INIIDTPG-------------HADFSGEVERVL.STVD-..SVLLLVDA
gi|294102663|ref|YP_003554521.1|  -------.......----------------------------------.-----..--------
gi|294101436|ref|YP_003553294.1|  EPKKQTPa......TVEFVDLAGLSR------DASKGAGLGNAFLSFV.AESD-..ALVHVV--
gi|294102150|ref|YP_003554008.1|  YKSKDGNey.....ILNLIDTPG-------------HVDFTYEVSRSI.ASCE-..GALLVVDA
gi|294101607|ref|YP_003553465.1|  -------.......------S---------------------------.-----..--------
gi|294102035|ref|YP_003553893.1|  -------.......----------------------------------.-----..--------
gi|294102412|ref|YP_003554270.1|  -------.......----------------------------------.-----..--------
gi|294101660|ref|YP_003553518.1|  -------.......----------------------------------.-----..--------
gi|294102549|ref|YP_003554407.1|  -------.......----------------------------------.-----..--------
gi|294102841|ref|YP_003554699.1|  -------.......----------------------------------.-----..--------
gi|294101272|ref|YP_003553130.1|  -------.......----------------------------------.-----..--------
gi|294101433|ref|YP_003553291.1|  -AW-DKT.......DFIIVDLPP-------------GTADAPLTVMQT.IDLD-..GFLVVTSP
gi|294101963|ref|YP_003553821.1|  VTY-EGK.......NIVFLDTPG-------------HEAFTAMRARGA.QATD-..IAILVVAA
gi|294101356|ref|YP_003553214.1|  -------.......----------------------------------.-----..--------
gi|294102542|ref|YP_003554400.1|  -------.......----------------------------------.-----..--------
gi|294101861|ref|YP_003553719.1|  -------.......----------------------------------.-----..--------
gi|294102400|ref|YP_003554258.1|  -------.......----------------------TLEFRARARRFK.SRFEN..LGLIVVDY
gi|294102043|ref|YP_003553901.1|  -------.......-------------------------L--------.-----..--------
gi|294101077|ref|YP_003552935.1|  -------.......----------------------------------.-----..--------
gi|294102348|ref|YP_003554206.1|  -------.......----------------------------------.-----..--------
gi|294102040|ref|YP_003553898.1|  AARASGA.......DVLIIDTAGRLHS-KHNLMEELTKIVRVIEREVG.RDSM-..ENLLVLDA
gi|294101613|ref|YP_003553471.1|  -------.......----------------------------------.-----..--------
gi|294101367|ref|YP_003553225.1|  -------.......----------------------------------.-----..--------
gi|294101893|ref|YP_003553751.1|  -------.......----------------------------------.-----..--------
gi|294101841|ref|YP_003553699.1|  LAVDDDR.......-IVVADVPGLIEGAHENKGLGIY------FLRHI.ERTR-..VLIHVLDL
gi|294102070|ref|YP_003553928.1|  TEWKGRQ.......-FYIVDTGGLLV----RDEHPLVEGIRKQATLAI.EESH-..VILFVIDG
gi|294102221|ref|YP_003554079.1|  ESIGNPY.......DVIVFDTAP-------------------------.-----..--------
gi|294101356|ref|YP_003553214.1|  -------.......----------------------------------.-----..--------
gi|294101345|ref|YP_003553203.1|  -------.......----------------------------------.-----..--------
gi|294102145|ref|YP_003554003.1|  LKLHDGR.......VVSIVDVPG-------------HEKFIRQMVAGA.SGID-..AVMLVVAA
gi|294101756|ref|YP_003553614.1|  YNEPEMQ.......-IVFTDTPGIHRP-----RHKLGEALVKAAVRSL.ENAD-..LILYVVEV
gi|294102549|ref|YP_003554407.1|  -------.......----------------------------------.-----..--------
gi|294101372|ref|YP_003553230.1|  LTYRGIP.......-IRLVDTAGIGAP-----GDEIEAMGIARAEKAM.MEAD-..VRIWVIDG
gi|294101016|ref|YP_003552874.1|  -------.......----------------------------------.-K---..--------
gi|294101780|ref|YP_003553638.1|  -------.......----------------------------------.-----..--------
gi|294101686|ref|YP_003553544.1|  -------.......----------------------------------.-----..--------
gi|294102507|ref|YP_003554365.1|  -------.......----------------------------------.-----..--------
gi|294101471|ref|YP_003553329.1|  -------.......----------------------------------.-----..--------
gi|294101845|ref|YP_003553703.1|  -------.......----------------------------------.-----..--------
gi|294101553|ref|YP_003553411.1|  EALAYAEdhln...DVIIFDTAGRLHV-----DEDLMEELSR--LKDL.VNPH-..EILLVVDA
gi|294101853|ref|YP_003553711.1|  -------.......----------------------------------.-----..--------
gi|294101780|ref|YP_003553638.1|  -------.......----------------------------------.-----..--------
gi|294102079|ref|YP_003553937.1|  -------.......----------------------------------.-----..--------
gi|294101472|ref|YP_003553330.1|  -------.......----------------------------------.-----..--------
gi|294102235|ref|YP_003554093.1|  FSYEGMN.......-FTLVDLPGIYSLGAASIDEQVASEFLI-----K.EKPE-..LAITVVDA
gi|294102390|ref|YP_003554248.1|  -------.......----------------------------------.-----..--------
gi|294101443|ref|YP_003553301.1|  -------.......----------------------------------.-----..--------
gi|294101748|ref|YP_003553606.1|  -------.......----------------------------------.-----..--------
gi|294101649|ref|YP_003553507.1|  -------.......----------------------------------.-----..--------
gi|294101715|ref|YP_003553573.1|  L------.......----------------------------------.-----..--------
gi|294101925|ref|YP_003553783.1|  -------.......----------------------------------.-----..--------
gi|294101367|ref|YP_003553225.1|  -------.......--------------------------------Y-.-----..--------
gi|294101751|ref|YP_003553609.1|  -------.......----------------------------------.-----..--------
gi|294101046|ref|YP_003552904.1|  -------.......----------------------------------.-----..--------
gi|294101779|ref|YP_003553637.1|  -------.......----------------------------------.-----..--------
gi|294101226|ref|YP_003553084.1|  LRYNSEV.......-YRIIDVPGAYTLDP-------TNEAEQVARRMVdEGAD-..LAIIVLDA
gi|294101892|ref|YP_003553750.1|  FYKIEAEv......DFFLVDLPGYGYAAR---GFKEKEKWAKLIEQYI.TQRETlqLLVHLVDF
gi|294102315|ref|YP_003554173.1|  -------.......----------------------------------.-----..--------
gi|294102188|ref|YP_003554046.1|  ----DRF.......DYIVVDL---------------HRNFGDITIELA.EGCQ-..RIWLVTDC
gi|294102320|ref|YP_003554178.1|  -------.......----------------------------------.-----..--------
gi|294102169|ref|YP_003554027.1|  LVSKAFKelpledlDVIFIENVGNLVC---PAEFDIGEDMKVAVSSVP.EGAD-..--------
gi|294101254|ref|YP_003553112.1|  -------.......----------------------------------.-----..--------
gi|294102077|ref|YP_003553935.1|  VELSDGH.......DVLVSDTVGFIR----DLPPALIAAFRT-TLEEI.SVSS-..LILLVLDG
gi|294102510|ref|YP_003554368.1|  VSWYKGQ.......DILAVDSPGILDP------RS-------------.-----..--------
gi|294101748|ref|YP_003553606.1|  -------.......----------------------------------.-----..--------
gi|294101141|ref|YP_003552999.1|  -------.......----------------------------------.-----..--------
gi|294101018|ref|YP_003552876.1|  -------.......----------------------------------.-----..--------
gi|294101692|ref|YP_003553550.1|  -------.......----------------------------------.-----..--------
gi|294101032|ref|YP_003552890.1|  -------.......--------------------------------AV.EQSN-..FVILVTEP
gi|294101031|ref|YP_003552889.1|  -------.......-----------------------------AISAL.TGAT-..LAVAVTEP
gi|294101431|ref|YP_003553289.1|  -------.......----------------------------------.-----..--------
gi|294102167|ref|YP_003554025.1|  -------.......----------------------------------.-----..--------
gi|294101458|ref|YP_003553316.1|  -------.......----------------------------------.-----..--------
gi|294102320|ref|YP_003554178.1|  -------.......----------------------------------.-----..----IIDE
gi|294101940|ref|YP_003553798.1|  -------.......----------------------------------.-----..--------
gi|294102120|ref|YP_003553978.1|  -------.......----------------------------------.-----..--------
gi|294101791|ref|YP_003553649.1|  -------.......----------------------------------.-----..--------
gi|294102136|ref|YP_003553994.1|  -------.......----------------------------------.-----..--------
gi|294101830|ref|YP_003553688.1|  -------.......----------------------------------.-----..--------
gi|294102042|ref|YP_003553900.1|  -------.......----------------------------------.-----..----V---
gi|294102015|ref|YP_003553873.1|  -------.......----------------------------------.-----..--------
gi|294102787|ref|YP_003554645.1|  -------.......----------------------------------.-----..--------
gi|294102032|ref|YP_003553890.1|  -------.......----------G-----------------------.-----..--------
gi|294102010|ref|YP_003553868.1|  -------.......----------------------------------.-----..--------
gi|294101586|ref|YP_003553444.1|  -------.......----------------------------------.-----..--------
gi|294101458|ref|YP_003553316.1|  -------.......----------------------------------.-----..--------
gi|294102625|ref|YP_003554483.1|  -------.......----------------------------------.-----..--------
gi|294102478|ref|YP_003554336.1|  -------.......----------------------------------.-GRD-..VDIVLVDA
gi|294101874|ref|YP_003553732.1|  -------.......----------------------------------.-----..--------
gi|294102071|ref|YP_003553929.1|  -------.......----------------------------------.-----..--------


                                          180       190                    200              210     
                                            |         |                      |                |     
d2akab1                             NS.DLANSDALKIAKEVDPQ.........G...QR.TIGVITKLDLMDEG.......TDARDVL
gi|294102520|ref|YP_003554378.1|  --.-------EKHIENMQGF.........G...VP.VVVAINRFPTDTE-.......-AELKLV
gi|294102529|ref|YP_003554387.1|  --.-------EKHIENMKRF.........G...IP.VVVAINRFPTDTE-.......-AELELV
gi|294102437|ref|YP_003554295.1|  --.-----------------.........-...--.--IALTKLD-----.......-------
gi|294102168|ref|YP_003554026.1|  --.-----------------.........-...--.--------------.......-------
gi|294101779|ref|YP_003553637.1|  --.-----------------.........-...--.--------------.......-------
gi|294102457|ref|YP_003554315.1|  --.-----------------.........-...--.--------------.......-------
gi|294101625|ref|YP_003553483.1|  VG.GVEPQS-ETVWRQADKY.........H...VP.RIAFVNKMDRVGA-.......-DFYQVV
gi|294101185|ref|YP_003553043.1|  --.-----------------.........-...--.--------------.......-------
gi|294102626|ref|YP_003554484.1|  --.---F-------------.........-...--.--------------.......-------
gi|294101765|ref|YP_003553623.1|  --.-----------------.........-...--.--------------.......-------
gi|294102479|ref|YP_003554337.1|  --.-----------------.........-...--.--------------.......-------
gi|294101904|ref|YP_003553762.1|  --.-----------------.........-...--.--------------.......-------
gi|294102557|ref|YP_003554415.1|  --.-----------------.........-...--.--------------.......-------
gi|294101807|ref|YP_003553665.1|  AM.GITFEEASFFMEDFRRT.........Gai.QR.TVMFVNLADD----.......-------
gi|294101806|ref|YP_003553664.1|  --.-----D-----------.........-...--.--------------.......-------
gi|294102649|ref|YP_003554507.1|  --.-----------------.........-...--.--------------.......-------
gi|294101185|ref|YP_003553043.1|  --.-----------------.........-...--.--------------.......-------
gi|294102868|ref|YP_003554726.1|  --.-----------------.........-...--.--------------.......-------
gi|294102500|ref|YP_003554358.1|  --.-----------------.........-...--.--------------.......-------
gi|294102409|ref|YP_003554267.1|  --.-----------------.........-...--.--------------.......-------
gi|294102354|ref|YP_003554212.1|  LH.GVEVQT-GKAYEYAEDF.........S...IP.VAFVVSKLDRENSDyartl..DDIKKQL
gi|294101565|ref|YP_003553423.1|  --.-----------------.........-...--.--------------.......-------
gi|294101424|ref|YP_003553282.1|  --.-----------------.........-...--.--------------.......-------
gi|294101976|ref|YP_003553834.1|  --.-----------------.........-...--.----------L---.......-------
gi|294101061|ref|YP_003552919.1|  --.-----------------.........-...--.--------------.......-------
gi|294101048|ref|YP_003552906.1|  --.-----------------.........-...--.--------------.......-------
gi|294101977|ref|YP_003553835.1|  --.-----------------.........-...--.--------------.......-------
gi|294101084|ref|YP_003552942.1|  --.-----------------.........-...--.--------------.......-------
gi|294101565|ref|YP_003553423.1|  --.-----------------.........-...--.--------------.......-------
gi|294101786|ref|YP_003553644.1|  --.-----------------.........-...--.--------------.......-------
gi|294101493|ref|YP_003553351.1|  --.-----------------.........-...--.--------------.......-------
gi|294101884|ref|YP_003553742.1|  MG.DDIQIMKAGIME-----.........-...IA.DIFVVNKADRPGAEki.....ETEVKLM
gi|294101894|ref|YP_003553752.1|  --.-----------------.........-...--.--------------.......-------
gi|294101778|ref|YP_003553636.1|  --.-----------------.........-...--.--------------.......-------
gi|294102313|ref|YP_003554171.1|  --.-----------------.........-...--.--------------.......-------
gi|294102640|ref|YP_003554498.1|  --.-----------------.........-...--.--------------.......-------
gi|294101376|ref|YP_003553234.1|  --.-----------------.........-...--.--------------.......-------
gi|294102641|ref|YP_003554499.1|  --.-----------------.........-...--.--------------.......-------
gi|294101359|ref|YP_003553217.1|  --.-----------------.........-...--.--------------.......-------
gi|294102459|ref|YP_003554317.1|  --.-----------------.........-...--.--------------.......-------
gi|294101785|ref|YP_003553643.1|  --.-----------------.........-...--.--------------.......-------
gi|294101376|ref|YP_003553234.1|  --.-----------------.........-...--.--------------.......-------
gi|294102074|ref|YP_003553932.1|  --.-----------------.........-...--.--------------.......-------
gi|294102442|ref|YP_003554300.1|  --.-----------------.........-...--.--------------.......-------
gi|294101577|ref|YP_003553435.1|  --.-----------------.........-...--.--------------.......-------
gi|294101171|ref|YP_003553029.1|  --.-----------------.........-...--.--------------.......-------
gi|294102413|ref|YP_003554271.1|  --.-----------------.........-...--.--------------.......-------
gi|294102187|ref|YP_003554045.1|  --.-----------------.........-...--.--------------.......-------
gi|294102332|ref|YP_003554190.1|  --.-----------------.........-...--.--------------.......-------
gi|294102831|ref|YP_003554689.1|  --.-----------------.........-...--.--------------.......-------
gi|294101321|ref|YP_003553179.1|  AD.GPMPQT-REHVLLARQV.........N...VPaVVVFMNKTDQVDDDelldlveMEIRELL
gi|294101626|ref|YP_003553484.1|  AD.GPMPQT-REHVLLARQV.........N...VPaVVVFMNKTDQVDDDelldlveMEIRELL
gi|294101069|ref|YP_003552927.1|  --.-----------------.........-...--.--------------.......-------
gi|294102759|ref|YP_003554617.1|  --.-----------------.........-...--.--------------.......-------
gi|294101055|ref|YP_003552913.1|  --.-----------------.........-...--.--------------.......-------
gi|294101254|ref|YP_003553112.1|  TA.VLTPQEALRLFSTIQQMtae......G...HG.IVFISHKLDEVLSL.......SDRISIL
gi|294102760|ref|YP_003554618.1|  --.-----------------.........-...--.--------------.......-------
gi|294101659|ref|YP_003553517.1|  --.-----------------.........-...--.--------------.......-------
gi|294101172|ref|YP_003553030.1|  --.-----------------.........-...--.--------------.......-------
gi|294102017|ref|YP_003553875.1|  --.-----------------.........-...--.--------------.......-------
gi|294101748|ref|YP_003553606.1|  --.-----------------.........-...--.--------------.......-------
gi|294102409|ref|YP_003554267.1|  --.-----------------.........-...--.--------------.......-------
gi|294102070|ref|YP_003553928.1|  SE.PTTDQD-KKMAAQVIEK.........G...KG.LILLINKWDTLEAAdklg...DEMRKRV
gi|294102390|ref|YP_003554248.1|  --.-----------------.........-...--.--------------.......-------
gi|294101403|ref|YP_003553261.1|  --.-----------------.........-...--.--------------.......-------
gi|294101730|ref|YP_003553588.1|  --.-----------------.........-...--.--------------.......-------
gi|294102602|ref|YP_003554460.1|  NE.GPMPQT-RYVLMRALAM.........G...LR.PIVFINKVDRPHANp......MSALNQT
gi|294102663|ref|YP_003554521.1|  --.-----------------.........-...--.--------------.......-------
gi|294101436|ref|YP_003553294.1|  --.-----------------.........-...--.--------------.......-------
gi|294102150|ref|YP_003554008.1|  SQ.GVEAQT-VANAYMAVDQ.........G...LE.IIPVINKIDLPSAHp......ESVQKEI
gi|294101607|ref|YP_003553465.1|  --.-----------------.........-...--.--------------.......-------
gi|294102035|ref|YP_003553893.1|  --.-Y---------------.........-...--.--------------.......-------
gi|294102412|ref|YP_003554270.1|  --.-----------------.........-...--.--------------.......-------
gi|294101660|ref|YP_003553518.1|  --.-----------------.........-...--.--------------.......-------
gi|294102549|ref|YP_003554407.1|  --.-----------------.........-...--.--------------.......-------
gi|294102841|ref|YP_003554699.1|  --.-----------------.........-...--.--------------.......-------
gi|294101272|ref|YP_003553130.1|  --.-----------------.........-...--.--------------.......-------
gi|294101433|ref|YP_003553291.1|  QE.LSVMVV-EKALNMTKMM.........E...VP.LLGA----------.......-------
gi|294101963|ref|YP_003553821.1|  DD.GLMPQT-KEAINHARAA.........G...VP.IVVAVNKIDKPAARp......DRVRQQL
gi|294101356|ref|YP_003553214.1|  --.-----------------.........-...--.--------------.......-------
gi|294102542|ref|YP_003554400.1|  --.-----------------.........-...--.--------------.......-------
gi|294101861|ref|YP_003553719.1|  --.-----------------.........-...--.--------------.......-------
gi|294102400|ref|YP_003554258.1|  LQ.LMSFAR-----------.........-...--.------RIDSKQQEv......AEISRAL
gi|294102043|ref|YP_003553901.1|  --.-----------------.........-...--.--------------.......-------
gi|294101077|ref|YP_003552935.1|  --.-----------------.........-...--.--------------.......-------
gi|294102348|ref|YP_003554206.1|  --.-----------------.........-...--.--------------.......-------
gi|294102040|ref|YP_003553898.1|  VM.-----------------.........-...--.--------------.......-------
gi|294101613|ref|YP_003553471.1|  --.-----------------.........-...--.--------------.......-------
gi|294101367|ref|YP_003553225.1|  --.-----------------.........-...--.--------------.......-------
gi|294101893|ref|YP_003553751.1|  --.-----------------.........-...--.--------------.......-------
gi|294101841|ref|YP_003553699.1|  SV.GTPEDV-LYQWEVICSEfkaykesllE...RP.YMVVGNKIDIERGHena....PAIESFM
gi|294102070|ref|YP_003553928.1|  FN.GPNWMD-EDVAHILRRS.........G...KP.VIVVANKLDDGIHE.......DRVYDAY
gi|294102221|ref|YP_003554079.1|  --.-----------------.........-...--.--------------.......-------
gi|294101356|ref|YP_003553214.1|  --.-----------------.........-...--.--------------.......-------
gi|294101345|ref|YP_003553203.1|  --.-----------------.........-...--.--------------.......-------
gi|294102145|ref|YP_003554003.1|  DE.GVMPQT-REHLAILNLL.........Gv..HD.GVIVISKADLVDEEll.....ELAIADV
gi|294101756|ref|YP_003553614.1|  DDiSISPED-DRIIEILQEV.........S...TP.IFLVVNKIDQVQQ-.......SERRLMA
gi|294102549|ref|YP_003554407.1|  --.-----------------.........-...--.--------------.......-------
gi|294101372|ref|YP_003553230.1|  SE.PLTPAD-LALVQKISAT.........-...-N.HIVTINKADLPLVIs......EE-----
gi|294101016|ref|YP_003552874.1|  --.-----------------.........-...--.--------------.......-------
gi|294101780|ref|YP_003553638.1|  --.-----------------.........-...--.--------------.......-------
gi|294101686|ref|YP_003553544.1|  --.-----------------.........-...--.--------------.......-------
gi|294102507|ref|YP_003554365.1|  --.-----------------.........-...--.--------------.......-------
gi|294101471|ref|YP_003553329.1|  --.-----------------.........-...--.--------------.......-------
gi|294101845|ref|YP_003553703.1|  --.-----------------.........-...--.--------------.......-------
gi|294101553|ref|YP_003553411.1|  --.-MTGQEAVKVATSFHEK.........L...SL.TGVVLSKLDGDARG.......GAALAIR
gi|294101853|ref|YP_003553711.1|  --.-----------------.........-...--.--------------.......-------
gi|294101780|ref|YP_003553638.1|  --.-----------------.........-...--.--------------.......-------
gi|294102079|ref|YP_003553937.1|  --.-----------------.........-...--.--------------.......-------
gi|294101472|ref|YP_003553330.1|  --.-----------------.........-...--.--------------.......-------
gi|294102235|ref|YP_003554093.1|  SN.LERS---LYLVVQMLEA.........G...QP.LIIALNMADVAEN-.......-KGIRIH
gi|294102390|ref|YP_003554248.1|  --.-----------------.........-...--.--------------.......-------
gi|294101443|ref|YP_003553301.1|  --.-----------------.........-...--.--------------.......-------
gi|294101748|ref|YP_003553606.1|  --.-----------------.........G...GQ.VFFVSNRINRLKGKy......E------
gi|294101649|ref|YP_003553507.1|  --.-----------------.........-...--.--------------.......-------
gi|294101715|ref|YP_003553573.1|  --.-----------------.........-...--.--------------.......-------
gi|294101925|ref|YP_003553783.1|  --.-----------------.........-...--.--------------.......-------
gi|294101367|ref|YP_003553225.1|  --.-----------------.........-...--.--------------.......-------
gi|294101751|ref|YP_003553609.1|  --.-----------------.........-...--.--------------.......-------
gi|294101046|ref|YP_003552904.1|  --.-----------------.........-...--.--------------.......-------
gi|294101779|ref|YP_003553637.1|  --.-----------------.........-...--.--------------.......-------
gi|294101226|ref|YP_003553084.1|  TA.LERN---LYLAFQAMER.........G...IH.TIVALNMVDEARH-.......-RGISID
gi|294101892|ref|YP_003553750.1|  RH.GLLKND-QELQEWISQI.........G...IP.SLVVFTKADKISK-.......GRHKGML
gi|294102315|ref|YP_003554173.1|  --.-----------------.........-...--.--------------.......-------
gi|294102188|ref|YP_003554046.1|  SC.TGVKNL-HLVTGLLDQL.........RiswIE.RGVIVNKAEREDRSiv.....E----K-
gi|294102320|ref|YP_003554178.1|  --.-----------------.........-...--.--------------.......--GQRFL
gi|294102169|ref|YP_003554027.1|  -K.PLKYPH---------LF.........S...EA.KAVLLTKMDLAPYV.......PFDMDLY
gi|294101254|ref|YP_003553112.1|  --.-----------------.........-...--.--------------.......-------
gi|294102077|ref|YP_003553935.1|  SM.PDVMET-LDVVEETLSDiga......Ga..IP.RLIVLNKIDKIDLS.......--LIPFL
gi|294102510|ref|YP_003554368.1|  --.-----------------.........-...--.--------------.......-------
gi|294101748|ref|YP_003553606.1|  --.-----------------.........-...--.--------------.......-------
gi|294101141|ref|YP_003552999.1|  --.-----------------.........-...--.--------------.......-------
gi|294101018|ref|YP_003552876.1|  --.-----------------.........-...--.--------------.......-------
gi|294101692|ref|YP_003553550.1|  --.-----------------.........-...--.--------------.......-------
gi|294101032|ref|YP_003552890.1|  -T.PFGLSDLALATETVREL.........H...IP.AGVVINRSDLGNI-.......EEAEIFC
gi|294101031|ref|YP_003552889.1|  SL.SGLHDL-LRLSKLCASL.........D...VP.LAIVLNKSDLSEAKg......EEIKNEA
gi|294101431|ref|YP_003553289.1|  --.-----------------.........-...--.--------------.......-------
gi|294102167|ref|YP_003554025.1|  --.-----------------.........-...--.--------------.......-------
gi|294101458|ref|YP_003553316.1|  --.-----------------.........E...NP.TIVVITDRNDLDD-.......QLFSTFL
gi|294102320|ref|YP_003554178.1|  AH.RFRTET-TITYEKLAEIcr.......G...KR.VILV----------.......-------
gi|294101940|ref|YP_003553798.1|  --.-----------------.........-...--.--------------.......-------
gi|294102120|ref|YP_003553978.1|  --.-----------------.........-...--.--------------.......-------
gi|294101791|ref|YP_003553649.1|  --.-----------------.........-...--.--------------.......-------
gi|294102136|ref|YP_003553994.1|  --.-----------------.........-...--.--------------.......------V
gi|294101830|ref|YP_003553688.1|  --.-----------------.........-...--.--------------.......-------
gi|294102042|ref|YP_003553900.1|  --.-----------------.........-...--.--------------.......-------
gi|294102015|ref|YP_003553873.1|  --.-----------------.........-...--.--------------.......-------
gi|294102787|ref|YP_003554645.1|  --.-----------------.........-...--.--------------.......-------
gi|294102032|ref|YP_003553890.1|  --.-----------------.........-...--.--------------.......-------
gi|294102010|ref|YP_003553868.1|  --.-----------------.........-...--.--------------.......-------
gi|294101586|ref|YP_003553444.1|  --.-----------------.........-...--.--------------.......-------
gi|294101458|ref|YP_003553316.1|  --.-----------------.........-...--.--------D-----.......-------
gi|294102625|ref|YP_003554483.1|  --.-----------------.........-...--.--------------.......-------
gi|294102478|ref|YP_003554336.1|  CC.PFGNGR-LVPAGILREPpkai.....Q...RA.HIVVITKADQV---.......-------
gi|294101874|ref|YP_003553732.1|  --.-----------------.........-...--.--------------.......-------
gi|294102071|ref|YP_003553929.1|  --.-----------------.........-...--.--------------.......-------


                                      220                                                           
                                        |                                                           
d2akab1                             ENKLLPL....RR...................................................
gi|294102520|ref|YP_003554378.1|  HERCAAF....G-...................................................
gi|294102529|ref|YP_003554387.1|  KEHCVAL....GV...................................................
gi|294102437|ref|YP_003554295.1|  -------....--...................................................
gi|294102168|ref|YP_003554026.1|  -------....--...................................................
gi|294101779|ref|YP_003553637.1|  -------....--...................................................
gi|294102457|ref|YP_003554315.1|  -------....--...................................................
gi|294101625|ref|YP_003553483.1|  NGIRTRL....GArsvplqlpigsedrfsgivdliqmkavffqddlgtapvvgeipgelmadvk
gi|294101185|ref|YP_003553043.1|  -------....--...................................................
gi|294102626|ref|YP_003554484.1|  -------....--...................................................
gi|294101765|ref|YP_003553623.1|  -------....--...................................................
gi|294102479|ref|YP_003554337.1|  -------....--...................................................
gi|294101904|ref|YP_003553762.1|  -------....--...................................................
gi|294102557|ref|YP_003554415.1|  -------....--...................................................
gi|294101807|ref|YP_003553665.1|  -------....--...................................................
gi|294101806|ref|YP_003553664.1|  -------....--...................................................
gi|294102649|ref|YP_003554507.1|  -------....--...................................................
gi|294101185|ref|YP_003553043.1|  -------....--...................................................
gi|294102868|ref|YP_003554726.1|  -------....--...................................................
gi|294102500|ref|YP_003554358.1|  -------....--...................................................
gi|294102409|ref|YP_003554267.1|  -------....--...................................................
gi|294102354|ref|YP_003554212.1|  SDKAVPF....FL...................................................
gi|294101565|ref|YP_003553423.1|  -------....--...................................................
gi|294101424|ref|YP_003553282.1|  -------....--...................................................
gi|294101976|ref|YP_003553834.1|  -------....--...................................................
gi|294101061|ref|YP_003552919.1|  -------....--...................................................
gi|294101048|ref|YP_003552906.1|  -------....--...................................................
gi|294101977|ref|YP_003553835.1|  -------....--...................................................
gi|294101084|ref|YP_003552942.1|  -------....--...................................................
gi|294101565|ref|YP_003553423.1|  -------....--...................................................
gi|294101786|ref|YP_003553644.1|  -------....--...................................................
gi|294101493|ref|YP_003553351.1|  -------....--...................................................
gi|294101884|ref|YP_003553742.1|  LDLIGKTd...W-...................................................
gi|294101894|ref|YP_003553752.1|  -------....--...................................................
gi|294101778|ref|YP_003553636.1|  -------....--...................................................
gi|294102313|ref|YP_003554171.1|  -------....--...................................................
gi|294102640|ref|YP_003554498.1|  -------....--...................................................
gi|294101376|ref|YP_003553234.1|  -------....--...................................................
gi|294102641|ref|YP_003554499.1|  -------....--...................................................
gi|294101359|ref|YP_003553217.1|  -------....--...................................................
gi|294102459|ref|YP_003554317.1|  -------....--...................................................
gi|294101785|ref|YP_003553643.1|  -------....--...................................................
gi|294101376|ref|YP_003553234.1|  -------....--...................................................
gi|294102074|ref|YP_003553932.1|  -------....--...................................................
gi|294102442|ref|YP_003554300.1|  -------....--...................................................
gi|294101577|ref|YP_003553435.1|  -------....--...................................................
gi|294101171|ref|YP_003553029.1|  -------....--...................................................
gi|294102413|ref|YP_003554271.1|  -------....--...................................................
gi|294102187|ref|YP_003554045.1|  -------....--...................................................
gi|294102332|ref|YP_003554190.1|  -------....--...................................................
gi|294102831|ref|YP_003554689.1|  -------....--...................................................
gi|294101321|ref|YP_003553179.1|  SKYDFPG....D-...................................................
gi|294101626|ref|YP_003553484.1|  SKYDFPG....D-...................................................
gi|294101069|ref|YP_003552927.1|  -------....--...................................................
gi|294102759|ref|YP_003554617.1|  -------....--...................................................
gi|294101055|ref|YP_003552913.1|  -------....--...................................................
gi|294101254|ref|YP_003553112.1|  -------....--...................................................
gi|294102760|ref|YP_003554618.1|  -------....--...................................................
gi|294101659|ref|YP_003553517.1|  -------....--...................................................
gi|294101172|ref|YP_003553030.1|  -------....--...................................................
gi|294102017|ref|YP_003553875.1|  -------....--...................................................
gi|294101748|ref|YP_003553606.1|  -------....--...................................................
gi|294102409|ref|YP_003554267.1|  -------....--...................................................
gi|294102070|ref|YP_003553928.1|  RDEMPFL....S-...................................................
gi|294102390|ref|YP_003554248.1|  -------....--...................................................
gi|294101403|ref|YP_003553261.1|  -------....--...................................................
gi|294101730|ref|YP_003553588.1|  -------....--...................................................
gi|294102602|ref|YP_003554460.1|  FDLFIELgaaeEQ...................................................
gi|294102663|ref|YP_003554521.1|  -------....--...................................................
gi|294101436|ref|YP_003553294.1|  -------....--...................................................
gi|294102150|ref|YP_003554008.1|  EEV---V....GI...................................................
gi|294101607|ref|YP_003553465.1|  -------....--...................................................
gi|294102035|ref|YP_003553893.1|  -------....--...................................................
gi|294102412|ref|YP_003554270.1|  -------....--...................................................
gi|294101660|ref|YP_003553518.1|  -------....--...................................................
gi|294102549|ref|YP_003554407.1|  -------....--...................................................
gi|294102841|ref|YP_003554699.1|  -------....--...................................................
gi|294101272|ref|YP_003553130.1|  -------....--...................................................
gi|294101433|ref|YP_003553291.1|  -------....--...................................................
gi|294101963|ref|YP_003553821.1|  SDVGLVPee..WG...................................................
gi|294101356|ref|YP_003553214.1|  -------....--...................................................
gi|294102542|ref|YP_003554400.1|  -------....--...................................................
gi|294101861|ref|YP_003553719.1|  -------....--...................................................
gi|294102400|ref|YP_003554258.1|  KGVAREL....--...................................................
gi|294102043|ref|YP_003553901.1|  -------....--...................................................
gi|294101077|ref|YP_003552935.1|  -------....--...................................................
gi|294102348|ref|YP_003554206.1|  -------....--...................................................
gi|294102040|ref|YP_003553898.1|  -------....--...................................................
gi|294101613|ref|YP_003553471.1|  -------....--...................................................
gi|294101367|ref|YP_003553225.1|  -------....--...................................................
gi|294101893|ref|YP_003553751.1|  -------....--...................................................
gi|294101841|ref|YP_003553699.1|  KAR----....--...................................................
gi|294102070|ref|YP_003553928.1|  S------....-L...................................................
gi|294102221|ref|YP_003554079.1|  -------....--...................................................
gi|294101356|ref|YP_003553214.1|  -------....--...................................................
gi|294101345|ref|YP_003553203.1|  -------....--...................................................
gi|294102145|ref|YP_003554003.1|  TDFVQGT....FL...................................................
gi|294101756|ref|YP_003553614.1|  VASLFKE....KL...................................................
gi|294102549|ref|YP_003554407.1|  -------....--...................................................
gi|294101372|ref|YP_003553230.1|  ---MING....LL...................................................
gi|294101016|ref|YP_003552874.1|  -------....--...................................................
gi|294101780|ref|YP_003553638.1|  -------....--...................................................
gi|294101686|ref|YP_003553544.1|  -------....--...................................................
gi|294102507|ref|YP_003554365.1|  -------....--...................................................
gi|294101471|ref|YP_003553329.1|  -------....--...................................................
gi|294101845|ref|YP_003553703.1|  -------....--...................................................
gi|294101553|ref|YP_003553411.1|  ATT----....--...................................................
gi|294101853|ref|YP_003553711.1|  -------....--...................................................
gi|294101780|ref|YP_003553638.1|  -------....--...................................................
gi|294102079|ref|YP_003553937.1|  -------....--...................................................
gi|294101472|ref|YP_003553330.1|  -------....--...................................................
gi|294102235|ref|YP_003554093.1|  REKLEKA....L-...................................................
gi|294102390|ref|YP_003554248.1|  -------....--...................................................
gi|294101443|ref|YP_003553301.1|  -------....--...................................................
gi|294101748|ref|YP_003553606.1|  -------....--...................................................
gi|294101649|ref|YP_003553507.1|  -------....--...................................................
gi|294101715|ref|YP_003553573.1|  -------....--...................................................
gi|294101925|ref|YP_003553783.1|  -------....--...................................................
gi|294101367|ref|YP_003553225.1|  -------....--...................................................
gi|294101751|ref|YP_003553609.1|  -------....--...................................................
gi|294101046|ref|YP_003552904.1|  -------....--...................................................
gi|294101779|ref|YP_003553637.1|  -------....--...................................................
gi|294101226|ref|YP_003553084.1|  VEKLEKL....L-...................................................
gi|294101892|ref|YP_003553750.1|  HSYIRKG....LK...................................................
gi|294102315|ref|YP_003554173.1|  -------....--...................................................
gi|294102188|ref|YP_003554046.1|  -------....--...................................................
gi|294102320|ref|YP_003554178.1|  NSYNMFL....KE...................................................
gi|294102169|ref|YP_003554027.1|  KNDLQHL....N-...................................................
gi|294101254|ref|YP_003553112.1|  -------....--...................................................
gi|294102077|ref|YP_003553935.1|  QTRLQGR....S-...................................................
gi|294102510|ref|YP_003554368.1|  -------....--...................................................
gi|294101748|ref|YP_003553606.1|  -------....--...................................................
gi|294101141|ref|YP_003552999.1|  -------....--...................................................
gi|294101018|ref|YP_003552876.1|  -------....--...................................................
gi|294101692|ref|YP_003553550.1|  -E-----....--...................................................
gi|294101032|ref|YP_003552890.1|  KNL----....--...................................................
gi|294101031|ref|YP_003552889.1|  KKENWHF....--...................................................
gi|294101431|ref|YP_003553289.1|  -------....--...................................................
gi|294102167|ref|YP_003554025.1|  -------....--...................................................
gi|294101458|ref|YP_003553316.1|  KSEELLR....N-...................................................
gi|294102320|ref|YP_003554178.1|  -------....--...................................................
gi|294101940|ref|YP_003553798.1|  -------....--...................................................
gi|294102120|ref|YP_003553978.1|  -------....--...................................................
gi|294101791|ref|YP_003553649.1|  -------....--...................................................
gi|294102136|ref|YP_003553994.1|  -------....--...................................................
gi|294101830|ref|YP_003553688.1|  -------....--...................................................
gi|294102042|ref|YP_003553900.1|  -------....--...................................................
gi|294102015|ref|YP_003553873.1|  -------....--...................................................
gi|294102787|ref|YP_003554645.1|  -------....--...................................................
gi|294102032|ref|YP_003553890.1|  -------....--...................................................
gi|294102010|ref|YP_003553868.1|  -------....--...................................................
gi|294101586|ref|YP_003553444.1|  -------....--...................................................
gi|294101458|ref|YP_003553316.1|  -------....--...................................................
gi|294102625|ref|YP_003554483.1|  -------....--...................................................
gi|294102478|ref|YP_003554336.1|  -------....--...................................................
gi|294101874|ref|YP_003553732.1|  -------....--...................................................
gi|294102071|ref|YP_003553929.1|  -------....--...................................................


                                                                                  230             24
                                                                                    |               
d2akab1                             ...........................................GYIGVVNRSQK......DIDG
gi|294102520|ref|YP_003554378.1|  ...........................................VPVALSEIWAK......GGEG
gi|294102529|ref|YP_003554387.1|  ...........................................-QQVLSEVWAK......GGEG
gi|294102437|ref|YP_003554295.1|  ...........................................-----------......----
gi|294102168|ref|YP_003554026.1|  ...........................................-----------......----
gi|294101779|ref|YP_003553637.1|  ...........................................-----------......----
gi|294102457|ref|YP_003554315.1|  ...........................................-----------......----
gi|294101625|ref|YP_003553483.1|  kardllienladfdesvmesylegqdvpeetlrrairentiqqRIVPVLCGSAF......KNKG
gi|294101185|ref|YP_003553043.1|  ...........................................-----------......----
gi|294102626|ref|YP_003554484.1|  ...........................................-----------......----
gi|294101765|ref|YP_003553623.1|  ...........................................-----------......----
gi|294102479|ref|YP_003554337.1|  ...........................................-----------......----
gi|294101904|ref|YP_003553762.1|  ...........................................-----------......----
gi|294102557|ref|YP_003554415.1|  ...........................................-----------......----
gi|294101807|ref|YP_003553665.1|  ...........................................-----------......----
gi|294101806|ref|YP_003553664.1|  ...........................................-----------......----
gi|294102649|ref|YP_003554507.1|  ...........................................-----------......----
gi|294101185|ref|YP_003553043.1|  ...........................................-----------......----
gi|294102868|ref|YP_003554726.1|  ...........................................-----------......----
gi|294102500|ref|YP_003554358.1|  ...........................................-----------......----
gi|294102409|ref|YP_003554267.1|  ...........................................-----------......----
gi|294102354|ref|YP_003554212.1|  ...........................................-----------......----
gi|294101565|ref|YP_003553423.1|  ...........................................-----------......----
gi|294101424|ref|YP_003553282.1|  ...........................................-----------......----
gi|294101976|ref|YP_003553834.1|  ...........................................-----------......----
gi|294101061|ref|YP_003552919.1|  ...........................................-----------......----
gi|294101048|ref|YP_003552906.1|  ...........................................-----------......----
gi|294101977|ref|YP_003553835.1|  ...........................................-----------......----
gi|294101084|ref|YP_003552942.1|  ...........................................-----------......----
gi|294101565|ref|YP_003553423.1|  ...........................................-----------......----
gi|294101786|ref|YP_003553644.1|  ...........................................-----------......----
gi|294101493|ref|YP_003553351.1|  ...........................................-----------......----
gi|294101884|ref|YP_003553742.1|  ...........................................-FPPIHMTVAE......KGDG
gi|294101894|ref|YP_003553752.1|  ...........................................-----------......----
gi|294101778|ref|YP_003553636.1|  ...........................................-----------......----
gi|294102313|ref|YP_003554171.1|  ...........................................-----------......----
gi|294102640|ref|YP_003554498.1|  ...........................................-----------......----
gi|294101376|ref|YP_003553234.1|  ...........................................-----------......----
gi|294102641|ref|YP_003554499.1|  ...........................................-----------......----
gi|294101359|ref|YP_003553217.1|  ...........................................-----------......----
gi|294102459|ref|YP_003554317.1|  ...........................................-----------......----
gi|294101785|ref|YP_003553643.1|  ...........................................-----------......----
gi|294101376|ref|YP_003553234.1|  ...........................................-----------......----
gi|294102074|ref|YP_003553932.1|  ...........................................-----------......----
gi|294102442|ref|YP_003554300.1|  ...........................................-----------......----
gi|294101577|ref|YP_003553435.1|  ...........................................-----------......----
gi|294101171|ref|YP_003553029.1|  ...........................................-----------......----
gi|294102413|ref|YP_003554271.1|  ...........................................-----------......----
gi|294102187|ref|YP_003554045.1|  ...........................................-----------......----
gi|294102332|ref|YP_003554190.1|  ...........................................-----------......----
gi|294102831|ref|YP_003554689.1|  ...........................................-----------......----
gi|294101321|ref|YP_003553179.1|  ...........................................-DVPIIRGSALkvleegTGEE
gi|294101626|ref|YP_003553484.1|  ...........................................-DVPIIRGSALkvleegTGEE
gi|294101069|ref|YP_003552927.1|  ...........................................-----------......----
gi|294102759|ref|YP_003554617.1|  ...........................................-----------......----
gi|294101055|ref|YP_003552913.1|  ...........................................-----------......----
gi|294101254|ref|YP_003553112.1|  ...........................................-----------......----
gi|294102760|ref|YP_003554618.1|  ...........................................-----------......----
gi|294101659|ref|YP_003553517.1|  ...........................................-----------......----
gi|294101172|ref|YP_003553030.1|  ...........................................-----------......----
gi|294102017|ref|YP_003553875.1|  ...........................................-----------......----
gi|294101748|ref|YP_003553606.1|  ...........................................-----------......----
gi|294102409|ref|YP_003554267.1|  ...........................................-----------......----
gi|294102070|ref|YP_003553928.1|  ...........................................-HAPLLFVSAL......TKRG
gi|294102390|ref|YP_003554248.1|  ...........................................-----------......----
gi|294101403|ref|YP_003553261.1|  ...........................................-----------......----
gi|294101730|ref|YP_003553588.1|  ...........................................-----------......----
gi|294102602|ref|YP_003554460.1|  ...........................................LDFPVLYGSGL......DGWA
gi|294102663|ref|YP_003554521.1|  ...........................................-----------......----
gi|294101436|ref|YP_003553294.1|  ...........................................-----------......----
gi|294102150|ref|YP_003554008.1|  ...........................................DADGAILASAK......EGIG
gi|294101607|ref|YP_003553465.1|  ...........................................-----------......----
gi|294102035|ref|YP_003553893.1|  ...........................................-----------......----
gi|294102412|ref|YP_003554270.1|  ...........................................-----------......----
gi|294101660|ref|YP_003553518.1|  ...........................................-----------......----
gi|294102549|ref|YP_003554407.1|  ...........................................-----------......----
gi|294102841|ref|YP_003554699.1|  ...........................................-----------......----
gi|294101272|ref|YP_003553130.1|  ...........................................-----------......----
gi|294101433|ref|YP_003553291.1|  ...........................................-----------......----
gi|294101963|ref|YP_003553821.1|  ...........................................GDSIMVDVSAK......TGEG
gi|294101356|ref|YP_003553214.1|  ...........................................-----------......----
gi|294102542|ref|YP_003554400.1|  ...........................................-----------......----
gi|294101861|ref|YP_003553719.1|  ...........................................-----------......----
gi|294102400|ref|YP_003554258.1|  ...........................................-DVPVIALSQL......S---
gi|294102043|ref|YP_003553901.1|  ...........................................-----------......----
gi|294101077|ref|YP_003552935.1|  ...........................................-----------......----
gi|294102348|ref|YP_003554206.1|  ...........................................-----------......----
gi|294102040|ref|YP_003553898.1|  ...........................................-----------......----
gi|294101613|ref|YP_003553471.1|  ...........................................-----------......----
gi|294101367|ref|YP_003553225.1|  ...........................................-----------......----
gi|294101893|ref|YP_003553751.1|  ...........................................-----------......----
gi|294101841|ref|YP_003553699.1|  ...........................................-NIPYYNTSAI......TGEG
gi|294102070|ref|YP_003553928.1|  ...........................................GFEHVVGISAL......HKRY
gi|294102221|ref|YP_003554079.1|  ...........................................-----------......----
gi|294101356|ref|YP_003553214.1|  ...........................................-----------......----
gi|294101345|ref|YP_003553203.1|  ...........................................-----------......----
gi|294102145|ref|YP_003554003.1|  ...........................................EGKVVVPVSSV......TNKN
gi|294101756|ref|YP_003553614.1|  ...........................................PIVGALGVSAK......KGYN
gi|294102549|ref|YP_003554407.1|  ...........................................-----------......----
gi|294101372|ref|YP_003553230.1|  ...........................................PQSPVFVISAE......KREG
gi|294101016|ref|YP_003552874.1|  ...........................................-----------......----
gi|294101780|ref|YP_003553638.1|  ...........................................-----------......----
gi|294101686|ref|YP_003553544.1|  ...........................................-----------......----
gi|294102507|ref|YP_003554365.1|  ...........................................-----------......----
gi|294101471|ref|YP_003553329.1|  ...........................................-----------......----
gi|294101845|ref|YP_003553703.1|  ...........................................-----------......----
gi|294101553|ref|YP_003553411.1|  ...........................................-QVPIKF----......----
gi|294101853|ref|YP_003553711.1|  ...........................................-----------......----
gi|294101780|ref|YP_003553638.1|  ...........................................-----------......----
gi|294102079|ref|YP_003553937.1|  ...........................................-----------......----
gi|294101472|ref|YP_003553330.1|  ...........................................-----------......----
gi|294102235|ref|YP_003554093.1|  ...........................................-GVPVVPTVAR......ERKG
gi|294102390|ref|YP_003554248.1|  ...........................................G----------......----
gi|294101443|ref|YP_003553301.1|  ...........................................-----------......----
gi|294101748|ref|YP_003553606.1|  ...........................................-----------......----
gi|294101649|ref|YP_003553507.1|  ...........................................-----------......----
gi|294101715|ref|YP_003553573.1|  ...........................................-----------......----
gi|294101925|ref|YP_003553783.1|  ...........................................-----------......----
gi|294101367|ref|YP_003553225.1|  ...........................................-----------......----
gi|294101751|ref|YP_003553609.1|  ...........................................-----------......----
gi|294101046|ref|YP_003552904.1|  ...........................................-----------......----
gi|294101779|ref|YP_003553637.1|  ...........................................-----------......----
gi|294101226|ref|YP_003553084.1|  ...........................................-GVPVVPTVAL......SGQG
gi|294101892|ref|YP_003553750.1|  ...........................................SIEVPFIVSAQ......DKSG
gi|294102315|ref|YP_003554173.1|  ...........................................-----------......----
gi|294102188|ref|YP_003554046.1|  ...........................................-----------......----
gi|294102320|ref|YP_003554178.1|  ...........................................LDDGFIYVSKK......YSNK
gi|294102169|ref|YP_003554027.1|  ...........................................PRVECIEIEAL......NGKG
gi|294101254|ref|YP_003553112.1|  ...........................................-----------......----
gi|294102077|ref|YP_003553935.1|  ...........................................-KAKVLPICAL......SGVG
gi|294102510|ref|YP_003554368.1|  ...........................................-----------......----
gi|294101748|ref|YP_003553606.1|  ...........................................-----------......----
gi|294101141|ref|YP_003552999.1|  ...........................................-----CMTASL......PINR
gi|294101018|ref|YP_003552876.1|  ...........................................-----------......----
gi|294101692|ref|YP_003553550.1|  ...........................................-----------......----
gi|294101032|ref|YP_003552890.1|  ...........................................-----------......----
gi|294101031|ref|YP_003552889.1|  ...........................................-----------......----
gi|294101431|ref|YP_003553289.1|  ...........................................-----------......----
gi|294102167|ref|YP_003554025.1|  ...........................................-----------......----
gi|294101458|ref|YP_003553316.1|  ...........................................-----TPVQAQ......DRVH
gi|294102320|ref|YP_003554178.1|  ...........................................-TATPYNNSPK......DILS
gi|294101940|ref|YP_003553798.1|  ...........................................-----------......----
gi|294102120|ref|YP_003553978.1|  ...........................................-----------......----
gi|294101791|ref|YP_003553649.1|  ...........................................-----------......----
gi|294102136|ref|YP_003553994.1|  ...........................................-----------......----
gi|294101830|ref|YP_003553688.1|  ...........................................-----------......----
gi|294102042|ref|YP_003553900.1|  ...........................................-----------......----
gi|294102015|ref|YP_003553873.1|  ...........................................-----------......----
gi|294102787|ref|YP_003554645.1|  ...........................................-----------......----
gi|294102032|ref|YP_003553890.1|  ...........................................-----------......----
gi|294102010|ref|YP_003553868.1|  ...........................................-----------......----
gi|294101586|ref|YP_003553444.1|  ...........................................-----------......----
gi|294101458|ref|YP_003553316.1|  ...........................................-----------......----
gi|294102625|ref|YP_003554483.1|  ...........................................-----------......----
gi|294102478|ref|YP_003554336.1|  ...........................................-----------......----
gi|294101874|ref|YP_003553732.1|  ...........................................-----------......----
gi|294102071|ref|YP_003553929.1|  ...........................................-----------......----


                                    0       250       260       270       280       290             
                                    |         |         |         |         |         |             
d2akab1                             KKDITAALAAERKFFLSHPSYRHLADRMGTPYLQKVLNQQLTNHIRDTLPG.LRNKLQSQ-l..
gi|294102520|ref|YP_003554378.1|  GIELAERILEAVEK-------------------------------------.---------pns
gi|294102529|ref|YP_003554387.1|  GIELAERVLEAV---------------------------------------.---------ekp
gi|294102437|ref|YP_003554295.1|  ---------------------------------------------------.---------vlt
gi|294102168|ref|YP_003554026.1|  ---------------------------------------------------.---------dpd
gi|294101779|ref|YP_003553637.1|  ---------------------------------------------------.---------vlv
gi|294102457|ref|YP_003554315.1|  ---------------------------------------------------.---------lgg
gi|294101625|ref|YP_003553483.1|  IQLLLDAVVDYLP--------------------------------------.---------s..
gi|294101185|ref|YP_003553043.1|  ---------------------------------------------------.---------ivr
gi|294102626|ref|YP_003554484.1|  ---------------------------------------------------.---------ddm
gi|294101765|ref|YP_003553623.1|  ---------------------------------------------------.---------lrs
gi|294102479|ref|YP_003554337.1|  ---------------------------------------------------.---------prf
gi|294101904|ref|YP_003553762.1|  ---------------------------------------------------.---------egq
gi|294102557|ref|YP_003554415.1|  ---------------------------------------------------.---------vnd
gi|294101807|ref|YP_003553665.1|  ---------------------------------------------------.---------pai
gi|294101806|ref|YP_003553664.1|  ---------------------------------------------------.---------vll
gi|294102649|ref|YP_003554507.1|  ---------------------------------------------------.---------dtd
gi|294101185|ref|YP_003553043.1|  ---------------------------------------------------.---------dse
gi|294102868|ref|YP_003554726.1|  ---------------------------------------------------.---------flq
gi|294102500|ref|YP_003554358.1|  ---------------------------------------------------.---------kft
gi|294102409|ref|YP_003554267.1|  ---------------------------------------------------.---------ygt
gi|294102354|ref|YP_003554212.1|  ---------------------------------------------------.---------pig
gi|294101565|ref|YP_003553423.1|  ---------------------------------------------------.---------lfg
gi|294101424|ref|YP_003553282.1|  ---------------------------------------------------.---------ind
gi|294101976|ref|YP_003553834.1|  ---------------------------------------------------.---------yyc
gi|294101061|ref|YP_003552919.1|  ---------------------------------------------------.---------pds
gi|294101048|ref|YP_003552906.1|  ---------------------------------------------------.---------rli
gi|294101977|ref|YP_003553835.1|  ---------------------------------------------------.---------lia
gi|294101084|ref|YP_003552942.1|  ---------------------------------------------------.---------eld
gi|294101565|ref|YP_003553423.1|  ---------------------------------------------------.---------kiq
gi|294101786|ref|YP_003553644.1|  ---------------------------------------------------.---------ept
gi|294101493|ref|YP_003553351.1|  ---------------------------------------------------.---------tpt
gi|294101884|ref|YP_003553742.1|  VAELVEGIEKHGAFLKQSIHGIKKQKRKLAEEIKD----------------.---------ils
gi|294101894|ref|YP_003553752.1|  ---------------------------------------------------.---------lte
gi|294101778|ref|YP_003553636.1|  ---------------------------------------------------.---------dvp
gi|294102313|ref|YP_003554171.1|  ---------------------------------------------------.---------kes
gi|294102640|ref|YP_003554498.1|  ---------------------------------------------------.---------gli
gi|294101376|ref|YP_003553234.1|  ---------------------------------------------------.---------kfy
gi|294102641|ref|YP_003554499.1|  ---------------------------------------------------.---------lav
gi|294101359|ref|YP_003553217.1|  --E------------------------------------------------.---------ele
gi|294102459|ref|YP_003554317.1|  ---------------------------------------------------.---------vtv
gi|294101785|ref|YP_003553643.1|  ---------------------------------------------------.---------iip
gi|294101376|ref|YP_003553234.1|  ---------------------------------------------------.---------pvk
gi|294102074|ref|YP_003553932.1|  ---------------------------------------------------.---------vee
gi|294102442|ref|YP_003554300.1|  ---------------------------------------------------.---------qvt
gi|294101577|ref|YP_003553435.1|  ---------------------------------------------------.---------lik
gi|294101171|ref|YP_003553029.1|  ---------------------------------------------------.---------ydp
gi|294102413|ref|YP_003554271.1|  ---------------------------------------------------.---------pte
gi|294102187|ref|YP_003554045.1|  ---------------------------------------------------.---------sfi
gi|294102332|ref|YP_003554190.1|  ---------------------------------------------------.---------gav
gi|294102831|ref|YP_003554689.1|  ---------------------------------------------------.---------gvl
gi|294101321|ref|YP_003553179.1|  NDPVSKCIWE-----------------------------------------.---------lma
gi|294101626|ref|YP_003553484.1|  NDPVSKCIWE-----------------------------------------.---------lma
gi|294101069|ref|YP_003552927.1|  ---------------------------------------------------.---------tle
gi|294102759|ref|YP_003554617.1|  ---------------------------------------------------.---------llp
gi|294101055|ref|YP_003552913.1|  ---------------------------------------------------.---------rlv
gi|294101254|ref|YP_003553112.1|  ---------------------------------------------------.---------rkg
gi|294102760|ref|YP_003554618.1|  ---------------------------------------------------.---------isp
gi|294101659|ref|YP_003553517.1|  ---------------------------------------------------.---------nal
gi|294101172|ref|YP_003553030.1|  ---------------------------------------------------.---------vrr
gi|294102017|ref|YP_003553875.1|  ---------------------------------------------------.---------ylr
gi|294101748|ref|YP_003553606.1|  ---------------------------------------------------.---------ess
gi|294102409|ref|YP_003554267.1|  -----------------------------------------A---------.---------qiv
gi|294102070|ref|YP_003553928.1|  LNKLTQTIKN---------VQENRSRRIGTTELNRLIRDVLAFQTLPTSRKgRVLKI----yyc
gi|294102390|ref|YP_003554248.1|  ---------------------------------------------------.---------vav
gi|294101403|ref|YP_003553261.1|  ---------------------------------------------------.---------alh
gi|294101730|ref|YP_003553588.1|  ---------------------------------------------------.---------pnc
gi|294102602|ref|YP_003554460.1|  VRDLNKYAHEGMKHL------------------------------------.---------fet
gi|294102663|ref|YP_003554521.1|  ---------------------------------------------------.---------dfi
gi|294101436|ref|YP_003553294.1|  ---------------------------------------------------.---------rtf
gi|294102150|ref|YP_003554008.1|  IQDILERIVAQVP--------------------------------------.---------ape
gi|294101607|ref|YP_003553465.1|  ---------------------------------------------------.---------pag
gi|294102035|ref|YP_003553893.1|  ---------------------------------------------------.---------elv
gi|294102412|ref|YP_003554270.1|  ---------------------------------------------------.---------egv
gi|294101660|ref|YP_003553518.1|  ---------------------------------------------------.---------nal
gi|294102549|ref|YP_003554407.1|  ---------------------------------------------------.---------pta
gi|294102841|ref|YP_003554699.1|  ---------------------------------------------------.---------lgt
gi|294101272|ref|YP_003553130.1|  ---------------------------------------------------.---------tie
gi|294101433|ref|YP_003553291.1|  ---------------------------------------------------.---------ven
gi|294101963|ref|YP_003553821.1|  IPHLLEMVL------------------------------------------.---------lva
gi|294101356|ref|YP_003553214.1|  ---------------------------------------------------.---------nis
gi|294102542|ref|YP_003554400.1|  ---------------------------------------------------.---------tpt
gi|294101861|ref|YP_003553719.1|  ---------------------------------------------------.---------ggq
gi|294102400|ref|YP_003554258.1|  ---------------------------------------------------.---------rav
gi|294102043|ref|YP_003553901.1|  ---------------------------------------------------.---------sel
gi|294101077|ref|YP_003552935.1|  ---------------------------------------------------.---------pqk
gi|294102348|ref|YP_003554206.1|  ---------------------------------------------------.---------ipv
gi|294102040|ref|YP_003553898.1|  ---------------------------------------------------.---------gqn
gi|294101613|ref|YP_003553471.1|  ---------------------------------------------------.---------rwv
gi|294101367|ref|YP_003553225.1|  ---------------------------------------------------.---------iqe
gi|294101893|ref|YP_003553751.1|  ---------------------------------------------------.---------vnf
gi|294101841|ref|YP_003553699.1|  IAEFMGNIVALCRE-------------------------------------.---------htr
gi|294102070|ref|YP_003553928.1|  IDDLMDMAVSLLP--------------------------------------.---------sde
gi|294102221|ref|YP_003554079.1|  ---------------------------------------------------.---------tgh
gi|294101356|ref|YP_003553214.1|  ---------------------------------------------------.---------vep
gi|294101345|ref|YP_003553203.1|  ---------------------------------------------------.---------plg
gi|294102145|ref|YP_003554003.1|  IPLLMEELAKLI---------------------------------------.---------drv
gi|294101756|ref|YP_003553614.1|  IDKLVQILKDKLPAGFPWYDEEILTDRPERFLAGEIIREKVL---------.---------llt
gi|294102549|ref|YP_003554407.1|  ---------------------------------------------------.---------lmg
gi|294101372|ref|YP_003553230.1|  IEALKDAI-------------------------------------------.---------...
gi|294101016|ref|YP_003552874.1|  ---------------------------------------------------.---------yrs
gi|294101780|ref|YP_003553638.1|  ---------------------------------------------------.---------afd
gi|294101686|ref|YP_003553544.1|  ---------------------------------------------------.---------arg
gi|294102507|ref|YP_003554365.1|  ---------------------------------------------------.---------vpp
gi|294101471|ref|YP_003553329.1|  ---------------------------------------------------.---------ivp
gi|294101845|ref|YP_003553703.1|  ---------------------------------------------------.---------efa
gi|294101553|ref|YP_003553411.1|  ---------------------------------------------------.---------agv
gi|294101853|ref|YP_003553711.1|  ---------------------------------------------------.---------iye
gi|294101780|ref|YP_003553638.1|  ---------------------------------------------------.---------dvl
gi|294102079|ref|YP_003553937.1|  ---------------------------------------------------.---------vae
gi|294101472|ref|YP_003553330.1|  ---------------------------------------------------.---------tla
gi|294102235|ref|YP_003554093.1|  LEDLVKRVKDRFEN-------------------------------------.---------gvs
gi|294102390|ref|YP_003554248.1|  ---------------------------------------------------.---------llh
gi|294101443|ref|YP_003553301.1|  ---------------------------------------------------.---------lsg
gi|294101748|ref|YP_003553606.1|  ---------------------------------------------------.---------elk
gi|294101649|ref|YP_003553507.1|  ---------------------------------------------------.---------gtq
gi|294101715|ref|YP_003553573.1|  ---------------------------------------------------.---------sea
gi|294101925|ref|YP_003553783.1|  ---------------------------------------------------.---------vsi
gi|294101367|ref|YP_003553225.1|  ---------------------------------------------------.---------idt
gi|294101751|ref|YP_003553609.1|  ---------------------------------------------------.---------pyv
gi|294101046|ref|YP_003552904.1|  ---------------------------------------------------.---------ryl
gi|294101779|ref|YP_003553637.1|  ---------------------------------------------------.---------yie
gi|294101226|ref|YP_003553084.1|  INRIIQRIPE-----------------------------------------.---------ark
gi|294101892|ref|YP_003553750.1|  VGEFRQFLTQYL---------------------------------------.---------...
gi|294102315|ref|YP_003554173.1|  ------AL-------------------------------------------.---------mdn
gi|294102188|ref|YP_003554046.1|  ---------------------------------------------------.---------iqr
gi|294102320|ref|YP_003554178.1|  IFELLESDDDE----------------------------------------.---------alq
gi|294102169|ref|YP_003554027.1|  IDRWVSLVETWL---------------------------------------.---------ke.
gi|294101254|ref|YP_003553112.1|  ---------------------------------------------------.---------ain
gi|294102077|ref|YP_003553935.1|  VTELLQEVE------------------------------------------.---------y..
gi|294102510|ref|YP_003554368.1|  ---------------------------------------------------.---------hne
gi|294101748|ref|YP_003553606.1|  V--------------------------------------------------.---------fpl
gi|294101141|ref|YP_003552999.1|  LDQLREAGLKIFPESI-----------------------------------.---------asf
gi|294101018|ref|YP_003552876.1|  ---------------------------------------------------.---------hil
gi|294101692|ref|YP_003553550.1|  ---------------------------------------------------.---------ely
gi|294101032|ref|YP_003552890.1|  ---------------------------------------------------.---------alp
gi|294101031|ref|YP_003552889.1|  ---------------------------------------------------.---------lgs
gi|294101431|ref|YP_003553289.1|  ---------------------------------------------------.---------kiq
gi|294102167|ref|YP_003554025.1|  ---------------------------------------------------.---------sqi
gi|294101458|ref|YP_003553316.1|  LREL-----------------------------------------------.---------lnn
gi|294102320|ref|YP_003554178.1|  LLKLFQKGQK-----------------------------------------.---------sti
gi|294101940|ref|YP_003553798.1|  --------------------------------------D------------.---------rle
gi|294102120|ref|YP_003553978.1|  ---------------------------------------------------.---------iqe
gi|294101791|ref|YP_003553649.1|  ---------------------------------------------------.---------gdg
gi|294102136|ref|YP_003553994.1|  ---------------------------------------------------.---------kgt
gi|294101830|ref|YP_003553688.1|  ---------------------------------------------------.---------lsq
gi|294102042|ref|YP_003553900.1|  ---------------------------------------------------.---------iqs
gi|294102015|ref|YP_003553873.1|  ---------------------------------------------------.---------sle
gi|294102787|ref|YP_003554645.1|  ---------------------------------------------------.---------rys
gi|294102032|ref|YP_003553890.1|  ---------------------------------------------------.---------kve
gi|294102010|ref|YP_003553868.1|  ---------------------------------------------------.---------ewv
gi|294101586|ref|YP_003553444.1|  ---------------------------------------------------.---------lll
gi|294101458|ref|YP_003553316.1|  ---------------------------------------------------.---------laq
gi|294102625|ref|YP_003554483.1|  ---------------------------------------------------.---------hpe
gi|294102478|ref|YP_003554336.1|  ---------------------------------------------------.---------s..
gi|294101874|ref|YP_003553732.1|  ---------------------------------------------------.---------qra
gi|294102071|ref|YP_003553929.1|  ---------------------------------------------------.---------rsg


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  fhplydvaqspkekiekiakeiygakgvtytaqaekdleeihrlgkdnlvicmaktqasisdnp
gi|294102529|ref|YP_003554387.1|  ntfhklydaslspkekiekiakeiygaksvaymaqaekdleeihrlgkdnllvcmgktqasisd
gi|294102437|ref|YP_003554295.1|  gfekikicthyevngekhenyltntsllakaspvyttldgwkedisgcrdfeklpeaarryvey
gi|294102168|ref|YP_003554026.1|  qsiygwrgadmtmilnfekdfpaakvvvldqnyrstgnilkaanaviisnerrrkknlwtardm
gi|294101779|ref|YP_003553637.1|  lahnktlaaqlytefktffphnavhyfvsyydyyqpeayipssdtyiekdasindrieklrlaa
gi|294102457|ref|YP_003554315.1|  tvqviphitneiqdrilkaaddndiviaeiggtvgdiegqpfleairqmatrvgrqnvlychvt
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  gdvpeglkdrsifaldmgslvagakyrgefeerlkavlneiktsegriilfidelhtivgagaa
gi|294102626|ref|YP_003554484.1|  iryamealehspsyaerfkeilvdefqdtnplqdrliqavrshsqrlfivgdlkqsiyrfrhad
gi|294101765|ref|YP_003553623.1|  llrqdpdiilvgeirdsetahlvmraaltghlvlstlhtddaanaplrliemgvppflivsslk
gi|294102479|ref|YP_003554337.1|  ydpsrgkvsvdgcdvrtldltelrkqigivpqdpvlmkgslafnisygfpqateedivkaaqia
gi|294101904|ref|YP_003553762.1|  vliggrdithlavnkrdigfvfqnyalfphmsifdnvayglkvrglsrkeaelkvkevlnlvgl
gi|294102557|ref|YP_003554415.1|  vapnhrnatmvfqsyaifphlnvyeniafglrlkkmeeskirekmegvidlvgltglesrqpsq
gi|294101807|ref|YP_003553665.1|  erittprlaltaaeylafeqdmhvvviltdltnycealreisaarkevpgrrgypgylytdlat
gi|294101806|ref|YP_003553664.1|  efpeledprsgeplmkrtvliantsnmpvaareasiytaitmaeyyrdmgysvalmadstsrwa
gi|294102649|ref|YP_003554507.1|  itrlstpelrklrrrvgmifqhfnlltsrtvfqnvafpleiekwetdaiskrvtevldlvdlsd
gi|294101185|ref|YP_003553043.1|  dnmiridmseymekfsvsrligappgyvgyeeggqlteavrrrpysvilfdeiekahhdvfnvl
gi|294102868|ref|YP_003554726.1|  pdegsiilegedithlppekrptatvfqsyalfphmtvlqnviyglkfkkidrkkamqmgdeml
gi|294102500|ref|YP_003554358.1|  evgyvgrdvdsmirdlvetavamvkrvkieevqgpaeeraewrlvdallprperktsmpdfmki
gi|294102409|ref|YP_003554267.1|  nsefgfdylrdnmavakdqlvqrghhfcivdevdsilideartpliisgpsednvemyttadqi
gi|294102354|ref|YP_003554212.1|  keasfkgvvdilnqkayeyvtdgsgsfkeisipaemvdevsaaresliesvveaddevmmmyle
gi|294101565|ref|YP_003553423.1|  sedamirldmsefmerhevgkligappgyvgydeggklteairrrpysvvlfdeiekahedvfn
gi|294101424|ref|YP_003553282.1|  geiylygqrvdngkhsnkevatlvgmifqqfnlfphlsvldnitlcpiqakgmkkkeaedlair
gi|294101976|ref|YP_003553834.1|  eslreisaareevpgrrgypgymysdlaeiyeragcvencqgsitqipiitmpdddmthpvvdl
gi|294101061|ref|YP_003552919.1|  gqiwlhgeevthskksinvlrqkmgmvfqnfylfdhltalrnveiallkvkgmdkkharekaml
gi|294101048|ref|YP_003552906.1|  eptsgeiwvngqevsslpkkdltefrrkqiamvfqhygllphktiidnvefglklqgisekerr
gi|294101977|ref|YP_003553835.1|  ntsnmpvaareasvylgmtlaeyfrdmgyntaimadstsrwaealreiggrleempgeegypay
gi|294101084|ref|YP_003552942.1|  ksfleachhmrqevgmvfqsfnlfphrtvlenvmlapmvvkkaseeeaheialrllekvglseh
gi|294101565|ref|YP_003553423.1|  dgniaeilrgkkivqlnignlvagtkyrgefeermrkllkelretgdviifideihsiigagga
gi|294101786|ref|YP_003553644.1|  sgtvffdgedvlkfnkakmkkmrsqmqiifqdpyaslnprmtvsqsiaapliiqgvykssekdk
gi|294101493|ref|YP_003553351.1|  eghyyldgtdvstidenqladirkntigfvfqgfnllprmtalenvelpmlysgisarkrhera
gi|294101884|ref|YP_003553742.1|  rdiaknv.........................................................
gi|294101894|ref|YP_003553752.1|  agyvgedvenilvrllqaadydiqaaergiiyideldkitrksesasitrdvsgegvqqallki
gi|294101778|ref|YP_003553636.1|  ffsvsgsdfvemfvgvgaarvrdlfeqarkyqpciifidemdavgrhrgaglggghdereqtln
gi|294102313|ref|YP_003554171.1|  aqlrnhhigfifqtynlfpvynvyeniefpllllkipqkerkekifdalewlgltdkidsrpsq
gi|294102640|ref|YP_003554498.1|  eatggevlfkgqdalkfnnaqkrefhkqaqivfqdpfsslnprmsvsqliaepllinkacgsrk
gi|294101376|ref|YP_003553234.1|  geseerlrnvfdeaqahapaiifideidaiapkreemggekqverrvvaqllalmdglesrgqv
gi|294102641|ref|YP_003554499.1|  lqliqsppgeitngeiffdgqdvmkmteaekrdirgskiamifqdpmtslnpimtveeqimemi
gi|294101359|ref|YP_003553217.1|  aildslpncqrvwlfsatmpaeiknlakrylktpvfislteegeahedithevylvptrhkeeg
gi|294102459|ref|YP_003554317.1|  nhpdiilmvlliderpeevtdmarsvdgeiiastfdrpaeehlrvanlalekakrlvetgkdvv
gi|294101785|ref|YP_003553643.1|  tppghiesgtilyknkdilgmtsseirkvrgeqvsmifqdpmtslnpimivgdqiaeaikthmh
gi|294101376|ref|YP_003553234.1|  gpalmskyvgeserairevfkkakqaspsilyfdeieslvpirgrdsgagasftervisqflae
gi|294102074|ref|YP_003553932.1|  kkflewavvhehlygtlksdvekvleagvdvvleidvqgalqvknafddsvlifimppskeele
gi|294102442|ref|YP_003554300.1|  vgdqnlrklrasqlpyyrrylgvvfqdfkllphltawenvafvlesmgmprrmvqkrtnevvdq
gi|294101577|ref|YP_003553435.1|  pdsgrvmidskditpfpmfrrarigvgylpqeasifrnltvkenieivlqelgkpqkeietmvs
gi|294101171|ref|YP_003553029.1|  dggrilfdgeditplktyevirkgiartfqnlrlfprssvlenvmtaaqqheaysfveavthfg
gi|294102413|ref|YP_003554271.1|  gniffnednitgfppnkvcesgiartfqnirlfsnetvlqnvmigchvrqkskwwmapfpvpsm
gi|294102187|ref|YP_003554045.1|  pnrerivtiedaaelsmqqdhvvrmesrpvniegtgaitirmlvrnslrmrpdriivgecrgee
gi|294102332|ref|YP_003554190.1|  ieptagqmmlgddviyhdgwkvkdlralrrdhigfvfqapylipfldvtdnvallpmlagkpna
gi|294102831|ref|YP_003554689.1|  ltmydsrtrlandvveevrrqfgeivfstivprnvklseapshampiayyeptctgakaymnfs
gi|294101321|ref|YP_003553179.1|  acdsyipapqretdkpflmpiedvftitgrgt................................
gi|294101626|ref|YP_003553484.1|  acdsyipapqretdkpflmpiedvftitgrgt................................
gi|294101069|ref|YP_003552927.1|  dknmrrmsgreiarrigyvpqssekvrltafdaillgrrpyvgwrlaesdikkvdaiihtlgld
gi|294102759|ref|YP_003554617.1|  sntevsgavifdnlnlislrpemlnairwkdialipqgamnsftpvltigkhieevlaihlgls
gi|294101055|ref|YP_003552913.1|  edergvtlsgqirldgedtftlspeevrrrigmvfqsptpfpfsiydnmayplryygygskkks
gi|294101254|ref|YP_003553112.1|  ekt.............................................................
gi|294102760|ref|YP_003554618.1|  tegnvelfgenidkcshsqlielrrrcgyvpqdpygslpptltvldavaepwiivngrksrlea
gi|294101659|ref|YP_003553517.1|  llpsqgacfvygmdtreeknlwairshvamvfqnpdnqivgtvveddtafgpeniglspleirq
gi|294101172|ref|YP_003553030.1|  ekglinfsgaplaqrsydvvkqgislvpegrrvfapltvyenlmmgafprkepekvkqdlqwvf
gi|294102017|ref|YP_003553875.1|  maallvimaqmgafipaaeasmglmdrvftrigardelsrgnstfmvemietanilhnvtdrsi
gi|294101748|ref|YP_003553606.1|  hpmdrllvgdvgfgkteiamraafkaseagkqvvvlvpttilaqqhyhtfrsrmagfpirvevl
gi|294102409|ref|YP_003554267.1|  aqagrfgavtvatnmagrgtdivlggnpdflaketlrkegnvedldpskyqqlleeyrqicake
gi|294102070|ref|YP_003553928.1|  tqtsiepptfvffvndpeivsqsfnkhienkiremdtfdgtplrlywr................
gi|294102390|ref|YP_003554248.1|  lallqaveggyqgafmapteilaqqhyyrlhsfleplgvsvvlligslknrareltlqkistge
gi|294101403|ref|YP_003553261.1|  giaeaqkaggiaafidaehaldprlaaslgvdvqslyvaqpdsgeqalyvldtlvrsgavdlvv
gi|294101730|ref|YP_003553588.1|  lainggesldvieidgasnnsvdevrelkahvslsafsslykvyiidevhmlslsafnallktl
gi|294102602|ref|YP_003554460.1|  iaeyvpapkvnlhap.................................................
gi|294102663|ref|YP_003554521.1|  pnvkvegdiylegkniysgatdvialrrqvgmvfqkpnpfpmaiydnvaygprlqgiksrekld
gi|294101436|ref|YP_003553294.1|  dnpevphpednidpardwnivemeliyrdlgvidnrlsrlaakkrllpeeeeekkllercqafl
gi|294102150|ref|YP_003554008.1|  gdteaplqalifdsvynnyrg...........................................
gi|294101607|ref|YP_003553465.1|  ieggfknaaagatealvvttpeipsvrdadriigllesmekkpirlvinrvkpsmvkegemldv
gi|294102035|ref|YP_003553893.1|  eldqvidilkkrppfvevvltgrnppvalleyadlitemkeirhpfqkgitgrrgiey......
gi|294102412|ref|YP_003554270.1|  eenilgktpefivkkgiamspegrrilphltveenlllgayirddkegiekdmdhvyslfprlr
gi|294101660|ref|YP_003553518.1|  ivpekgevivegfvsrpksqdlrkirrlvglvfqypeqqlfaetvfdevafaprnwgvseedle
gi|294102549|ref|YP_003554407.1|  gkfkidnkiltiktprdamkygigmvhqhfmlvpslpvyknvvlgdepttrglifnhhgaieav
gi|294102841|ref|YP_003554699.1|  tpdravtsvgyvpqegvrdkifpvsvfdvvlmgrlgigrrkifteedkkiamdvlehmglagrr
gi|294101272|ref|YP_003553130.1|  reygtmewigeavphlgqiaaymqqkdlllpwlslmqnamlpqvfskekhlrknkkakglferf
gi|294101433|ref|YP_003553291.1|  msyvtcpdcgkaievfgpshvkeieekfslpvlgkfpldlelshlgdqgr..............
gi|294101963|ref|YP_003553821.1|  emeelradp.......................................................
gi|294101356|ref|YP_003553214.1|  ygynvkmgffsqesaqnlnynrtiweeisntgylgtdtekrgllgaflfsgddiyklisvlsgg
gi|294102542|ref|YP_003554400.1|  egtvyfkkervetvsvnyrrsvtlllqntyllkravwenvafglkvrgvrgkelmksmeealyf
gi|294101861|ref|YP_003553719.1|  lrvttgpalekagdiaailsnlepfdvlfideihrlpanveeilypsmedfslhiivgkgplan
gi|294102400|ref|YP_003554258.1|  eqrnekmpqlsdlrdsgaieqdadlvmllyrpgyydtaaspeeednratiriakhrngptgdvn
gi|294102043|ref|YP_003553901.1|  flfvidrcehvsqvispalscgqivlcerytdstrayqiwgrglpeekvedlfawcsfpepdlt
gi|294101077|ref|YP_003552935.1|  gdiivkgkviknqkdlrylrqtigflfqdpddqlfcptllddvlfgplngginkeeayeqainv
gi|294102348|ref|YP_003554206.1|  kgsisflgeditswsitdrakagltlawqmparyegisirdylrigpqnssernleeamdfvqm
gi|294102040|ref|YP_003553898.1|  gfaqaesfhkalslngvilskydntakggvilaiahrlalpiryiglgesvddlrlfepqefvr
gi|294101613|ref|YP_003553471.1|  lgegspnclritrqsdllfqgsislptatetevslciredpkictikrefspetgtslfvdgmr
gi|294101367|ref|YP_003553225.1|  tggyegkffingqeaqfkspfdaldagigmvhqefslipgftaaenivlnrestqynflvesfg
gi|294101893|ref|YP_003553751.1|  slggvrdeaeirghrrtyvgaqpgriiqkmrqagtknpimlmdeidkigqdfrgdpasallevl
gi|294101841|ref|YP_003553699.1|  phsei...........................................................
gi|294102070|ref|YP_003553928.1|  ee..............................................................
gi|294102221|ref|YP_003554079.1|  tlrlitlpeilgiwiehliekranamelmkvaakydkdlqekikedpiidtlqarrdkfalark
gi|294101356|ref|YP_003553214.1|  regnvyfpkgirigylsqdlveiedtvllhylkkqagialvekelrateediaraakneeeyhs
gi|294101345|ref|YP_003553203.1|  geirvlesslaelshkkraqllsfvisgrpaiqgfsvfelvalgrhpytnwkgeledrdikave
gi|294102145|ref|YP_003554003.1|  qprtrrgpffmpidrafpisgfgt........................................
gi|294101756|ref|YP_003553614.1|  h...............................................................
gi|294102549|ref|YP_003554407.1|  krdithlpplkrrklglayipedriktglaplaslkdnallgyqykppflkrnffqnfrsiref
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  vdilliddiqflgnkgssqeeffhtfnqlhvskkqivicsdrppkeiqniedrlvsrfewglvt
gi|294101780|ref|YP_003553638.1|  tlyaegqrryveslsayarqflgiqkkpdvddisglspaisieqkgtshnprstvgtvteiydy
gi|294101686|ref|YP_003553544.1|  ervlyisgeesasqvalrarrllalhnnldlfcdtdldgalshveghgfvvldsvqamrssled
gi|294102507|ref|YP_003554365.1|  lsheelleslqihssarpdykpsleppfhivhptastvaicgggaslrpgeislahrgilflde
gi|294101471|ref|YP_003553329.1|  drgkvlwkgqdirtlsktkkknlrpyfqkihqdpgssfpqnrlirtifedffrwgyhpalssek
gi|294101845|ref|YP_003553703.1|  sgkraqselirageeeaevialffcprtlqlpeeisseegnlflkrvftrngrgktfiqgklfp
gi|294101553|ref|YP_003553411.1|  gegidaielfdakrmaqriigmgdvmglaekvqqvtsqedvakitkslkkdkltmedlllqfeq
gi|294101853|ref|YP_003553711.1|  hlphmlakpvtspkkaiqalawavremeqrydifakarvrnlagynekaipkdrlphiviivde
gi|294101780|ref|YP_003553638.1|  ykgmkrildkdfreragkhlsidgaeqfrnvvlvdqspigrtprsnpatytglftlirelfael
gi|294102079|ref|YP_003553937.1|  llgldyldtgaiyralafylnamgfepvespylteilskikvslsdgcvyingadvtehirspr
gi|294101472|ref|YP_003553330.1|  krlsvcgkvflkkqnllsvkekelkklwgrylflmpqepstalnpllsvfrqvrevfqhlrgmd
gi|294102235|ref|YP_003554093.1|  l...............................................................
gi|294102390|ref|YP_003554248.1|  gqlpsseketimrsfarghldlivsttvievgvdvpqatvmviedadrfglsqlhqlrgrvgrg
gi|294101443|ref|YP_003553301.1|  saaiafvdeiyhfnksqqnallpsvekgdiilvgtttenpwfeinktllsrlvvfqlkplaeed
gi|294101748|ref|YP_003553606.1|  imfpearismahgqmaekdlertmldfyngnldilvcttivesgldiprantlivddaqelgla
gi|294101649|ref|YP_003553507.1|  aaeiktkykvahistgdilrqnvkektklgcqaqefmnggklvpdeiivgmmgerlkekdcekg
gi|294101715|ref|YP_003553573.1|  trsslvlldelgagtdpqegaalgialidtlrekksitlatthhnpiksyalttphvetasmef
gi|294101925|ref|YP_003553783.1|  lrailndydgsrvilidphgeyasafpsakvfrinapsnplyipfwlmnfdelafflvgakptd
gi|294101367|ref|YP_003553225.1|  leikctgdyqrvqelsggnqqkvclakafalhpkllfvseptrgidvgakrvvldtlreynqkr
gi|294101751|ref|YP_003553609.1|  rplydafydlfsperflryidknvieiaplaymrgrtlndsfiildeaqnttpeqmkmfltrlg
gi|294101046|ref|YP_003552904.1|  etitersftvyesqervtdlvyvpkkpaqlfsvhdalvfvfsqrgtmdlaytiartrrrlpreq
gi|294101779|ref|YP_003553637.1|  kdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavgekwdrrgfme
gi|294101226|ref|YP_003553084.1|  ghippl..........................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ipviaidpkgditnlllsfpeqrsedflpwinienataegfppseyaareaekwkkglagwgid
gi|294102188|ref|YP_003554046.1|  eygvkgllpfdeklekgwlkgeplilsqprspyskvireiaselvgke................
gi|294102320|ref|YP_003554178.1|  klidegkaeryssedfkdelrtdlehdrailmeikrlweqidrdpkllkfkkelstnatlqknh
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  lvkkysvstpsietpvknlsggnlqklmlgrelcdapkaliavhptwgldvaatqfvreqllle
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  vhrrl...........................................................
gi|294101748|ref|YP_003553606.1|  rremgeergrllrwlevagyervdlvwtpgqyvvrgfivdiydpayalpirieffdeivesirs
gi|294101141|ref|YP_003552999.1|  pdlkekasamryrvkqckkeealeealkaykngekvlwvvntvkrcqeiamelqesfaenllcy
gi|294101018|ref|YP_003552876.1|  sgwgpfrssrksflvnwdteekqaylrgyfsgetnldivatvgekniiqcdgkrithgnvrsli
gi|294101692|ref|YP_003553550.1|  rcgllvsshietalkmlrsieelcnekpydvddgplalalawieevrlfshslqwclavghfpe
gi|294101032|ref|YP_003552890.1|  ilarlpfskevarayakgiapilidkqwqeaasdilnhvkevl.....................
gi|294101031|ref|YP_003552889.1|  ipfrpnvveaiskkeiplea............................................
gi|294101431|ref|YP_003553289.1|  lqvcglnptvisldnyfvdrektpldeqgnydfevleaidldllesqlakllkgeevrvpefdf
gi|294102167|ref|YP_003554025.1|  wkslgatiidadalaheawkdttvlrraserwgtqvllgnghinpsvvasivfsdmteyewvcd
gi|294101458|ref|YP_003553316.1|  rtsggiifttiqkfapftnetngevidfnrwgrvaensspytantmltdrrnvvviadeahrsq
gi|294102320|ref|YP_003554178.1|  pnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylmvrrtraeie......
gi|294101940|ref|YP_003553798.1|  khvalripslvvidyltllkrpgqsdleaveevmprlktltqrlkirtlilsqlgraskldqrk
gi|294102120|ref|YP_003553978.1|  ltakgksavfvpvveildeiragfdegtaykiqqavkdadcvaiddlgaqrkdkswvderlfsl
gi|294101791|ref|YP_003553649.1|  lgargvrspsftlineyegrlplahvdlyrlergdeyelglceyaddgfvlviewpdrlaeqpt
gi|294102136|ref|YP_003553994.1|  lftveyydhpslefrkhnskannryaikpyygknrgdtlpfcpviylglgrlfpfgefqndeai
gi|294101830|ref|YP_003553688.1|  hraavqeglaavvdvrggrllndlfsvvdslkgtiplvqvlfldssdeslvrrfettrrrhplg
gi|294102042|ref|YP_003553900.1|  adtlllpaansmlkiveeppehgvilfllendkflptlksrcwnlal.................
gi|294102015|ref|YP_003553873.1|  iaetlkaevisvdsrqvyrymnvgtdkvtfqtrqhilhhmldvvdpdevfsaadfvdksmaaie
gi|294102787|ref|YP_003554645.1|  lfgcpdgrssrnlyapphggkqkgsliieslkgerfslvmngrnstfsgarngtsledllgyvd
gi|294102032|ref|YP_003553890.1|  yesrqgylytdfhkivsgafqkanggylvldaekvllnfmswealkralrtgeatienlgeqyg
gi|294102010|ref|YP_003553868.1|  lnmalalleagekvtiadidiinpyfcirqvsdvlekkglsvitmpeqakwldmslvtpkvdwa
gi|294101586|ref|YP_003553444.1|  lkylkeagihvgyikhshekvlspmdtdtgkvlsqgipalywgvdgcryekpgeisiydiqnri
gi|294101458|ref|YP_003553316.1|  eneggkgmivamsrriaidlykeivalrpdwhsddlmsgkikvvitgsssdpsdwqafigskad
gi|294102625|ref|YP_003554483.1|  fdesirrlqaalretehkveslgelqdrigpagqvrfsgseavsflhhwtsmatiwlppaikga
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  qyvatdnnvdyiiddglviargrimtgksakseknlvrairralfefpehreevvsflekqapc
gi|294102071|ref|YP_003553929.1|  ehkiiiggpgaifaplpdpqlilvdeesspayrmqaapllhi......................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  aligrpegfeltvrevrlsagagfiiaitgsimtmpglpkvpaamkidvdndgnitg.......
gi|294102529|ref|YP_003554387.1|  npaligrpegfeltvrevrlsagagfivpitgsimtmpglpkvpaamkidvdddgnitg.....
gi|294102437|ref|YP_003554295.1|  ieketgvpvqligvgpgrsqtilr........................................
gi|294102168|ref|YP_003554026.1|  gekiyvllapneyqeadfilsemhrlhnfcgyrygdmavlyrinamsriyeqkciekgvpyrvv
gi|294101779|ref|YP_003553637.1|  tkalverrdvivvasvsciyglgkkemyeevifpfavgekwdrrgfmerlidnyyarndmllea
gi|294102457|ref|YP_003554315.1|  lvpyleaarelktkptqhsvqelrrigilpdiiicrshypicdemkekialfcnvpkeavieal
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  egaidagnmlkpmlargelhcigattideyrkriekdaalarrfqpvlveqpdvedtisilrgl
gi|294102626|ref|YP_003554484.1|  lslfgsyikkakyghgdyilldtsfrskeilvhevndlfssvwkdglgqelplpfeslevphyl
gi|294101765|ref|YP_003553623.1|  avvsqrlirllcplckkpdsnspvgcsycggrgfhgrvgvfeylpitervqelllhkapvqkir
gi|294102479|ref|YP_003554337.1|  gihtfitslpegydtevgergvtlsggqrqrvaiaraiirnprilildeatssldvavesqiqe
gi|294101904|ref|YP_003553762.1|  igvderfphqlsggeqqrvalarvlvidprvllmdeplsnldaklriymraeirkiqkklgitc
gi|294102557|ref|YP_003554415.1|  lsggqqqrvalaraiimepalllfdeplsnldaklreqmrieirhlqkrlgitsvyvthdqaea
gi|294101807|ref|YP_003553665.1|  myeragrlkgkkgsitqipiltmpeddkthpipdltgyitegqiilsrglhrkgiyppvdvmps
gi|294101806|ref|YP_003553664.1|  ealremsgrleempgeegypaylgtrlasfyeragraiclgsdgregsvtaigavsppggdlse
gi|294102649|ref|YP_003554507.1|  kaqsypsqlsggqkqrvgiaralannpslllcdeatsaldpkttqsilalldeinrklgitivl
gi|294101185|ref|YP_003553043.1|  lqilddgrvtdsqghvvdfkntviimtsnigaplllegitgdgqikedareavmkelrqafrpe
gi|294102868|ref|YP_003554726.1|  akvglpdsasksidqlsggeqqrvalarslvtepkvllldeplsnldaklrirmrreirqlqkg
gi|294102500|ref|YP_003554358.1|  fsgkeaeetppqeedtirestrnkvyallkagklderevelevaesasmgipilggagmdsmgm
gi|294102409|ref|YP_003554267.1|  arqlkegrdfekdekernvaftedgiarcenllkmpglfsdaansdlahrivqavkahvlfqkd
gi|294102354|ref|YP_003554212.1|  gdeisheeivkvarkairerqifpvlpasgtanigvhqvldflgdmfps...............
gi|294101565|ref|YP_003553423.1|  illqiledgrltdgqghtvdfrnaviimtsnigakdwvkgtslgfsisgeadgyfdwdktksdi
gi|294101424|ref|YP_003553282.1|  llervglgdkvyakpsqlsggqqqrvaiaralamqpkimlfdeptsaldpelvgevleviaqla
gi|294101976|ref|YP_003553834.1|  sgyitegqivldrgihdrgayppinvlpslsrlmnk............................
gi|294101061|ref|YP_003552919.1|  elervgmaafadhyptqlsggqaqrvsiaralamdpdvmlfdeptsaldpeligevlevmrnla
gi|294101048|ref|YP_003552906.1|  ersnvalervglkgwenyypsslsggmrqrvgiaralvmdtpillmdepfsgldplirremqde
gi|294101977|ref|YP_003553835.1|  lgtrlaqyyeragrakllglperegsvtvinavspaggdfsepvtqaslrlsgafwaldkrlaq
gi|294101084|ref|YP_003552942.1|  ahkypatlsggqtqrgaiaralamnpkvmlydeptsaldpelvgevlqvmkdldnegmtqiivt
gi|294101565|ref|YP_003553423.1|  egavdaanilkpslsrgefqvigattldeyrkyiekdaalerrfqpvmveepsvddtisilegl
gi|294101786|ref|YP_003553644.1|  iqkkvdqtmdlvglakrfansypheldggrrqrigiaraltlnpkfivcdepvsaldvsiqaqi
gi|294101493|ref|YP_003553351.1|  lhalqivdledranhqpqqlsggqqqrvaiaralandapliladeptgnldsktgidvmklfvr
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  legtlsnvppkggrkhpyqdfiqmdtsnilficggafagieevigrrvnkkmigfggdilsvke
gi|294101778|ref|YP_003553636.1|  qllveldgfdestgiiliaatnrpdildpallrpgrfdrhivvdrpdvkgreeilavhvrnkki
gi|294102313|ref|YP_003554171.1|  lsggecqrvavaravvkrpeliladeptanldsensynilemmvrlnkelettfifathdekvm
gi|294102640|ref|YP_003554498.1|  evdnkvkelmdtvglaerlttsfpheldggrrqrigvaralaldpefivldepvsaldvciqaq
gi|294101376|ref|YP_003553234.1|  ivigatnipntldpalrrpgrfdreisipipdrngrfeilqihtrgmplaedvdlmrlsdithg
gi|294102641|ref|YP_003554499.1|  slhsdfkgeavrkrahemlalvgirpergkeyphqfsggmrqrvgiaialaceptlliadeptt
gi|294101359|ref|YP_003553217.1|  linvllwekpsraivfchtraetveltrrlhdenfqamclhgemsqrernmalsqfrsgrtpll
gi|294102459|ref|YP_003554317.1|  llldsitrlarasnlvvppsgrtlsggmdpaalyfpkrffgaarnieeggsltvigtalvdtgs
gi|294101785|ref|YP_003553643.1|  vssakatkkasemmelvgidpvrmsdyphqfsggmkqrvviamalacnpkvliadepttaldvt
gi|294101376|ref|YP_003553234.1|  msgieelkgvtvlattnridlidpallssgrfdvvlelpmpdakarleifqihlqkkplaedvh
gi|294102074|ref|YP_003553932.1|  rrlrnrgteeedtvqlrlsnalkemekmhmydyvvvndsvlraaleikriiasynl........
gi|294102442|ref|YP_003554300.1|  vglwrrrflyppqlsggeqqrvaiaramanspaifiadeptgnldihtaedvmrllvalnaaga
gi|294101577|ref|YP_003553435.1|  hileelgltslasipgyalsggerrrveiarclsimpdfllldepfsgidpiavydiqqiilsl
gi|294101171|ref|YP_003553029.1|  kwrmketsirdrsmellnrvgladralqpagtlpygyqrrleiaralaldprlllldepaagmn
gi|294102413|ref|YP_003554271.1|  iqeekeireksmkllqsvslaqdanvlssslpygaqrrleiaralatdpsfllldepaagmnpl
gi|294102187|ref|YP_003554045.1|  afdmlqamntghdgslttlhansprdvlsrlesmvlmagmelpvraireqissgidlivhqerl
gi|294102332|ref|YP_003554190.1|  earqqaiellkaldvehrakampsqlsggeqqrvaiarglvnrppviladeptapldseralav
gi|294102831|ref|YP_003554689.1|  mevaerwl........................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  elalryldemsggelqkvtiaralvqeprillldepissldvknqieimetmkhiikghglsav
gi|294102759|ref|YP_003554617.1|  gearrhrcrslleeadlewslanryphelsggqkqraaiatalacdpdflladepttaldvitq
gi|294101055|ref|YP_003552913.1|  knldviirnkledvglfeevkdslsmnatllsggqqqrlciaralavepeillldepcssldvk
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  yskarrllktlgieeerillsrvrsglsggqrqrvsiarslilepalllcdeptsmqdastrse
gi|294101659|ref|YP_003553517.1|  rvdwalsvtglshkmqnptyslsggekqrlavagalaldppclvldeptamldpqgrrdlldvl
gi|294101172|ref|YP_003553030.1|  slfprleerrdqyagtlsggeqqmlaigralmsrprlllldepslglapiiirdifkelrrins
gi|294102017|ref|YP_003553875.1|  vvldeigrgtstydgmsiawavleyldhgcgskpkvlfathyhelvaledhlnglknlsmavhe
gi|294101748|ref|YP_003553606.1|  srfvstsrqkriledtkkglvdiligtqrllqkdiefkdlglliideehrfgvmhkeklkdtre
gi|294102409|ref|YP_003554267.1|  rdevldkgglkiigterhesrridnqlrgrsgrqgdpgssrfylsleddllrlfgseriqgime
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ahvvvgthalfsdpvtfsnlgfavideqhrfgvlqknalrakganegqaphilvmtatpiprtl
gi|294101403|ref|YP_003553261.1|  vdsvaaltpqaeidgkigdsqlglqarlmsyalrrltsaisrsncvvvfinqlrakistgyssg
gi|294101730|ref|YP_003553588.1|  eeppshvvfilattephkvpvtirsrcqhipfrkidvqnivkslsmvahnenrnaeeealweia
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  eivkrsligaalwsevkdnlkssglglsggqqqrlciaraiatepevllmdeptsaldpmatar
gi|294101436|ref|YP_003553294.1|  meekplrelglsedeqrklsgfafltlkpemivlnldetqteghvpgldaimsiakerglglvq
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  qdvldvlaieligivpdddsvvksanrgepltsgdtslasmafsniadrllgkev.........
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  erawqkggtlsggeqqmlavgralmsrpdlvmmdepslglapmlvkevfdiireinaqgktvll
gi|294101660|ref|YP_003553518.1|  kvvnetllevgipldfldrnpfqlsggekrrialasvlaaepaylvldeptagldatgrkdlik
gi|294102549|ref|YP_003554407.1|  rhlsaqyglnidplapvhslpvgiqqrveilkllyrkaeilifdeptavlspreieglfsiire
gi|294102841|ref|YP_003554699.1|  ndpmgdlsqgqrqrvliaralasrprillmdeplasidpeargvlyedlasfagnvtiilvshd
gi|294101272|ref|YP_003553130.1|  glngfedylpgavsggmkqrcalirtlmfereivlldeplsaldaitrrslqslllslqkdfkk
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  eksrvallkllleetnllildeptnhldmrtrdifqqalteyhgtiiivshdryfldklvsrvi
gi|294102542|ref|YP_003554400.1|  vglapsqfarrkwyelsggeaqrvalasrlaikpevllldeptasvdrvsaelikqgvrmcrek
gi|294101861|ref|YP_003553719.1|  nicltlppftlvgattrlglltsplrarfgiveqlalynvdetseivqrgakvlgieieeeaay
gi|294102400|ref|YP_003554258.1|  lvfl............................................................
gi|294102043|ref|YP_003553901.1|  lwidtplpvainrikttrghfdriesetdgflnrvcegykelskrfphrivridgsqpteevsa
gi|294101077|ref|YP_003552935.1|  lktlnidnlahtppyalsggqkrlgalaavlamkpdlllldepssglderawqnlvdvlnqldm
gi|294102348|ref|YP_003554206.1|  splfldraidkslsggerkrielasiylmkprlaildepdsgvdllalrevlgllrlladqgsg
gi|294102040|ref|YP_003553898.1|  alle............................................................
gi|294101613|ref|YP_003553471.1|  irlqdlddvkrqwhmegeqfafigqgevaeaihhrpqqrrsilealfgidqyrkkredanqklk
gi|294101367|ref|YP_003553225.1|  drlrtlnteemrqrgenaieklnvvispdtlvsempvghkqfteiareidkkktqllvldepta
gi|294101893|ref|YP_003553751.1|  dpaqnsnftdhyiesafdlsnvifittanvthtipaplldrmevirlpgyvaeekihiakkhll
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  iltdkkntafyfvlnaeklpiietkraieilqkhdigiggvivnkvipeeagpffekrrvdqeq
gi|294101356|ref|YP_003553214.1|  llkrhdhlshryeqlggyefaamaqkvmkglgfsdgdgqrytstfsggwkmrislaamllsspd
gi|294101345|ref|YP_003553203.1|  kalvevnawhlsgrdfaklsdgesqrvliaralaqdtpillldeptafldlprkvellsllrqy
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  alhlmerynimaaseniqagtlsggnmqrlvmareleqqpdfllvsqptrgvdiggisfihdrl
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  diqmpdletriailqkkaqirnyevpedvisflaqnvpsnirelegalnri.............
gi|294101780|ref|YP_003553638.1|  lrllygrlgvpycpscgkavirysldeivdvifrnypdqrleilspqvrgkkgefknlfaqnre
gi|294101686|ref|YP_003553544.1|  gwpgtpsqvravaqqcidsakktgipfvvvghitkegriagpmllehmvdavllfsgedtsayr
gi|294102507|ref|YP_003554365.1|  ftefrrdllealrqpledgsivvsraagrvefpcrvlllaacnpcpcgwagdpvescscsayek
gi|294101471|ref|YP_003553329.1|  ewwnalgegmekaslserllhrypcqlsggelqrfallrallfsplflvadeptsrldpsvqak
gi|294101845|ref|YP_003553703.1|  lslfnevaapllriqsqfaqlelldsdrqrdildsyggeeiiclknelrsvfsnallkekelrs
gi|294101553|ref|YP_003553411.1|  ieklgpldkvidml..................................................
gi|294101853|ref|YP_003553711.1|  ladlmftaqkdvedyicrlaqmaratgihlllatqrpsvnvvtglikaniparvaftlpsqads
gi|294101780|ref|YP_003553638.1|  peskirgyapgrfsfnvrggrceacsgagsvkvsmlflpdvyvdcevcggtrynretlevrykg
gi|294102079|ref|YP_003553937.1|  vdsivssyaalptvrrcllsiqreqaeegglvadgrdmgtvvfpdatikiyltasdsvrakrrh
gi|294101472|ref|YP_003553330.1|  rhtartatqnlfsalgitqeasrerpgklsggmaqrallamalaspaefilldeptkgldssrk
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  gnqsycvllsnpttregverlkvmcattdgfkiaeadlrlrgpgevcgvrqhgitdfrvadllk
gi|294101443|ref|YP_003553301.1|  lvqilykalkdeekglgalklavsedvitvlakmaggdarqaltrlellassvaasgaaeltma
gi|294101748|ref|YP_003553606.1|  qmyqlrgrvgrreegayayflypetmplqketmerfeaisafsdigsgyslalqdlqirgsgdi
gi|294101649|ref|YP_003553507.1|  flldgfprtvpqaealdqllatmnlsldavilldvddevvvkrlcgrrmcrqcgeiyhvtfkps
gi|294101715|ref|YP_003553573.1|  nvetlaptyhllmgipgrsnaiyiaerygmpsevlqkaratlkeq...................
gi|294101925|ref|YP_003553783.1|  dqrveyrllrelittfkkencklksgdvtqefitadspipfsarklwyemnwwlnasfestkkd
gi|294101367|ref|YP_003553225.1|  gttivmisseleelrsicdriaivnegkiagt................................
gi|294101751|ref|YP_003553609.1|  fgskavvtgditqidlpsgkksgliqvreilegikg............................
gi|294101046|ref|YP_003552904.1|  rsrlyelatildvpkvqmpllcgigiyhgsmlpkekllvesafrerildvvvgtnalalgvnlp
gi|294101779|ref|YP_003553637.1|  rlidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidpvsghtlkqlp
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  gdrikkmresvsfsiytpgsnsgikvnvlgsfrcpsekiindhdlflekvqnttstllsllnie
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  liiftesketanylfeeinkeypkkvllftgdskeavrdkvianfdararskkgdyrilistev
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  rdrgaavflvsedleellslsdrlavifkgeimgildhpe........................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  fhpqsqmsaatldeieihsitaarekkleemipdschtvlfepsqienkaesy...........
gi|294101141|ref|YP_003552999.1|  hsrfrlkdrqkwhkkliekfrdpepmiaittqvcemsldlsasllisefapvtsliqrmgrcnr
gi|294101018|ref|YP_003552876.1|  palaflpgdlaivdgapsvrrqfldrlcallfplyvrkmsdcrralrhrvillrerkdpsltsk
gi|294101692|ref|YP_003553550.1|  waywregdalvseptlcsdkvsegilsqkaekiiaisatmtvegsfdfwkretgiiptdtyvle
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ikgkkfpgatlrlnkhdvliiegihglnekvtavvpeemkfgifvspltginldehnrtsttdn
gi|294102167|ref|YP_003554025.1|  mihpfvriemerkvaslqgwviaeipllfenripwwvdlsvyvtapldlrlarnevrgwnkeei
gi|294101458|ref|YP_003553316.1|  ygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltdkntrvvfgdyidiydmtra
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  gatgghakgggiveelvhseieiqkdgldkngqprliatitkarhgtkgsfeleyig.......
gi|294102120|ref|YP_003553978.1|  idaryrsgkqtiittnacsmsqlkemlgehgtrivsrltema......................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  rgvkgelpstyqdeiktfyedftgisiessspqqmgdfktradfisdvegidsntisagednlf
gi|294101830|ref|YP_003553688.1|  dhipvlegiqkerallapvreyadvvldtsglsirglkdrliae....................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  rimnrgkiplfvggtpfyyhalfegvltkdlprdrkltdelekfaskhgnqalhdqlsaidpkr
gi|294102787|ref|YP_003554645.1|  remyerifsvgledmqkirplndrgiqsrffsagaglgtaslptflaslsnqekalyriqggar
gi|294102032|ref|YP_003553890.1|  aipisslrpqpipinvkvvmvgtpylyallqyydpeflkmfkikaefdrdmprtfeseqqmaqf
gi|294102010|ref|YP_003553868.1|  lhdestrllmdiggdaegalalkqfepiikkvgyrlilvvnafrpqtasvtriqkmmkkmesic
gi|294101586|ref|YP_003553444.1|  gsnfdillleggksfpchkiw...........................................
gi|294101458|ref|YP_003553316.1|  retlakrmkdrndelklvivrdmwltgfdvpsmhsmyvdkpmsghnlmqaiarvnrvfkekqgg
gi|294102625|ref|YP_003554483.1|  lslfigtppvleknslwimpnitasiwpgkmsessllpdrhklalhdltgterghlpllkekrd
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  tvmiiatstamalkivrilnlpqperfi....................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  rgtafydrkeikdvlsfmrlavnpldgaslgrianvptrgigkksqeklmeglgaipemeaeql
gi|294101779|ref|YP_003553637.1|  gkfrargdvleiypsysetalrvaffddeierideidpvsghtlkqlpkasifpaqhyvtsrda
gi|294102457|ref|YP_003554315.1|  deptiyqvplslqaqefdrlvmrllsf.....................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  kerlevhhgvrirdnalvgaavlsnryitdrflpdkaidlvdeacamirteidslpaeldaasr
gi|294102626|ref|YP_003554484.1|  sthelrqqctvdpfltyleggkegekirearlrqirrlallfsqyyeekrtvwdkqkeclrpvq
gi|294101765|ref|YP_003553623.1|  tqarkegmrtlvengmlkverglttyeeil..................................
gi|294102479|ref|YP_003554337.1|  amekamegrtsfviahrlstvrsadrilvlskghivesgthdellekggiyrhlyelqf.....
gi|294101904|ref|YP_003553762.1|  ihvthdqkealtiadrivvlnkgkieqvaapfelyanpatlfvadfigqanifkg.........
gi|294102557|ref|YP_003554415.1|  msisdrvvvmnkgrieqvgtpielyarpsnsfvaafigkvnfmpak..................
gi|294101807|ref|YP_003553665.1|  lsrlkdk.........................................................
gi|294101806|ref|YP_003553664.1|  pvsqntlrvtkvfwgldaslayqrhfpainwllsyslytdt.......................
gi|294102649|ref|YP_003554507.1|  vthemgvirqichrvavlehgqvvelgavkdvfmkpqsktaref....................
gi|294101185|ref|YP_003553043.1|  flnrvddvvlfkplqrheirqivkllaqelqkrlkdhridlelseeavdyiadagydpvfgarp
gi|294102868|ref|YP_003554726.1|  igitaiyvthdqeealalsdrivvmekgeiiqidtprniyfhaqnsfvadfigrsniit.....
gi|294102500|ref|YP_003554358.1|  ninemlsgllpkktkkrrmkvsdgkkllqaeeaeklidmesvarealdkaqeegiifideidkv
gi|294102409|ref|YP_003554267.1|  vhyvvkdgeiiivdeftgrlmfgrrysdglhqaieakekvrvgresqtlatitlqnyfrmyrkl
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ldavqktfrpefinrvdemvvfrplskkemlvivdimlsdvrerlryqdidikvseeakafile
gi|294101424|ref|YP_003553282.1|  etgmtmviithemlfakdvsdriifmadgniveqgspqdimvkpahprtqaf............
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  kggmtmlvvthemgfacsvaneimfmeegrilesgspdkllntpqyertrqf............
gi|294101048|ref|YP_003552906.1|  lirlqkelkktiffvthdldeamrmgdrmavmkngtivqmgapaqilanpadeyvarfvqdk..
gi|294101977|ref|YP_003553835.1|  qrhfpainwqqsytlyegs.............................................
gi|294101084|ref|YP_003552942.1|  hqmrfarnasdyivfmdggeivemadgdvlfetpqnkrtkaf......................
gi|294101565|ref|YP_003553423.1|  rdryeshhrvkisddalvaaarlssryiterflpdkaidlideaaararlktmeipanlkdieh
gi|294101786|ref|YP_003553644.1|  lnliqdlqvqfgltylfithdlsvvkhlstnimvmylgqvveladskklfknpvhpytktl...
gi|294101493|ref|YP_003553351.1|  lnvesgktiiqvtherdmalfgsriitvkdgtivhderv.........................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  hrnyelmrqvqpedlmafgfipeligrlpvvvpleeldddalarilvepknalirqyqktfeie
gi|294101778|ref|YP_003553636.1|  addvdlgvvarrtpgfvgadlanlvneaallaaragkslitmaefeegidr.............
gi|294102313|ref|YP_003554171.1|  kylrrkihlfdgrvaqde..............................................
gi|294102640|ref|YP_003554498.1|  ilnllgdlkkergytylfishnlsvvryvsdevavmylgqvvekagntilfkdplhpytqal..
gi|294101376|ref|YP_003553234.1|  fvgadlealakeaamsslrellpcidyeqavipyekllsmnvtmenfldalkevepsa......
gi|294102641|ref|YP_003554499.1|  aldvtiqaqvldliknlqkivntslllithdlgivaeicdevaimyagrlveysdirqlyskpm
gi|294101359|ref|YP_003553217.1|  vatnvaargldvegvshviqmglpdnretfvhrsgrtgraghegrnllvlspkea.........
gi|294102459|ref|YP_003554317.1|  rmddviyeefkgtgnmelhlsrklaeqrifpavditksgtrreell..................
gi|294101785|ref|YP_003553643.1|  iqaqvlemmnelkkkfnmatilithdlgivaqtcekaaviyageiveygtvheifknmrhpyti
gi|294101376|ref|YP_003553234.1|  leelvrsteghsggdihficrkasalairdflkigekgapciekhhfeials............
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  tvimathdqylvdayrqrvvelqegrivrdeekg..............................
gi|294101577|ref|YP_003553435.1|  rakgygilltdhnvrdtlaitdrtylihqgeiviegspdevaqsevarkfy.............
gi|294101171|ref|YP_003553029.1|  peevmalneliksihmefqlailviehhmdlvmeicpriicmnfgakiaegspeeiqansevlk
gi|294102413|ref|YP_003554271.1|  etvdlmsfirrirdefnltilliehdmkvvmgiceyiwvldygkliaegnpdeiqsnprvieay
gi|294102187|ref|YP_003554045.1|  kdgtrr..........................................................
gi|294102332|ref|YP_003554190.1|  irilndmaqrfetavivvthdekiiptfkriyhirdgvtyeeegq...................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  mslhdltmalrygdrfvfmkkgeiryilardeis..............................
gi|294102759|ref|YP_003554617.1|  keiiltlerlargrnmglllvthdlplavqicdaiavmhegeiveegapadivtkprhrhttq.
gi|294101055|ref|YP_003552913.1|  ntqniemmlralcqqysiiivthnlfqarrishrtffildgeiieagptkdlfenp........
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  iihvlnervkegmamvfvthdlylargaakrgivllegecceensteallsapkhaytralv..
gi|294101659|ref|YP_003553517.1|  ktlhaqgrtiiyithrleetvhcdralvlksgkvqwdgtiselfrhte................
gi|294101172|ref|YP_003553030.1|  egvtillveqnarqalllshrgyvlqtgsiimagtsedllnsadirnaylg.............
gi|294102017|ref|YP_003553875.1|  gergisflykvvdgpadrsygievarlagippavlkrafhlletfe..................
gi|294101748|ref|YP_003553606.1|  gldvltlsatpiprtlslslrglrsfsiistpp...............................
gi|294102409|ref|YP_003554267.1|  klgmeegeai......................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  tlsvygdlsvsvidempp..............................................
gi|294101403|ref|YP_003553261.1|  pqetttggralkfyssvrvevkrgksinkgedaighelwmkvvknkqappfrtahasliygkgv
gi|294101730|ref|YP_003553588.1|  rqadgamrdalslleqvma.............................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ieelvrtlkerytviivthnmqqaarisdytafflmgelieygktpklftspg...........
gi|294101436|ref|YP_003553294.1|  vfgrmememadlsedeqrefmadlgikeagrerliqeaysllglisffttgkdevkawtlkkda
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  veqnafaalkvahhayilevgsivlsgpgedllknprvkeayl.....................
gi|294101660|ref|YP_003553518.1|  llskqkkkgrgiifvthdletalmssdsilvleggrevvqgapgkiieels.............
gi|294102549|ref|YP_003554407.1|  frkagktiifiahnlnevlavsdvitvmrkgkhiatlprseat.....................
gi|294102841|ref|YP_003554699.1|  lsviangatavacv..................................................
gi|294101272|ref|YP_003553130.1|  tvlmithdidealyladtvlvltqapmkirdritlpsekprnldsseyiaik............
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  eiregkileypgnysyfiq.............................................
gi|294102542|ref|YP_003554400.1|  wgttlvlvshdvlwvkslsdrhliltegelstss..............................
gi|294101861|ref|YP_003553719.1|  eiarrsrgtprvairllkrvrdvaevrqspsintavasvalnm.....................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  qiwkvvevhls.....................................................
gi|294101077|ref|YP_003552935.1|  aliiashdipflehvtrrgyelssg.......................................
gi|294102348|ref|YP_003554206.1|  vmvithredvaagcdrsylmcdgriilegsaaavkry...........................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  faseelarletlvseltsrrdeiaamvtiaekarrlldeldekrrgyyfsrraflerelysfqs
gi|294101367|ref|YP_003553225.1|  vlteseaeillasmrklaalgiaivfishrlhevidvcdkivvlrdgqvvhettpak.......
gi|294101893|ref|YP_003553751.1|  pklfkehgltdkmisitsktvektirdytreagvrnlqrslatlcrkv................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ylkqidemfggfgvariplldsdikgieql..................................
gi|294101356|ref|YP_003553214.1|  illldeptnhldtesmewledwllnfngtliaishdrhfldkictstaelsqgaislykg....
gi|294101345|ref|YP_003553203.1|  awkmnkgvlmsvhdidlalrfadriwvmspshsftvgipedl......................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  lslrragkailmisadldeilslsdriavmnrgeivavlprkeasr..................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  kgfmrvrvdgtiywleeeialdknkrhtievvidrlkvlddrkgriseaveaalslsggyvllv
gi|294101686|ref|YP_003553544.1|  mirgtknrygntdelgifemtekgl.......................................
gi|294102507|ref|YP_003554365.1|  eryskrlsgpildridlhvsvprllpkelisfedqsgedsetvrqrvcearekqrlrwrkygfh
gi|294101471|ref|YP_003553329.1|  vahmlveeahvksiavlfishdevllnalcsriirl............................
gi|294101845|ref|YP_003553703.1|  vekkqkevidryenansilqsfksispesnseaiwegrlerisksidehtkleqilarltggkt
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  rtiidvsgaekllgkgdmlfvsprfpkpvrlqspyiedgksle.....................
gi|294101780|ref|YP_003553638.1|  rniadvlnmtvddafeffkeipriasklaliqeaglgyirlgqsaltlsggeaqrvklakelsk
gi|294102079|ref|YP_003553937.1|  lqllergekvsfdevlrqiqnrdqfdsnreiaplcqasdaifvdtssmtedevvdylvrlvke.
gi|294101472|ref|YP_003553330.1|  edatalvkgiinagktllcithdfslpkqiggqtgvlfsgllvesgdsqivlqhpshpytqgl.
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  d...............................................................
gi|294101443|ref|YP_003553301.1|  h...............................................................
gi|294101748|ref|YP_003553606.1|  igvsqhgqdervgyrfyykmleeeiar.....................................
gi|294101649|ref|YP_003553507.1|  sqgmrcekcggelfqrdddketvirsrlkvyhdqtaplisyydekgllrkvnagtssssvmaei
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  eqkretkyeinkgdyenligaeftshlttannqpphvsqhkdfysyekkllarlkdsrfnfmfh
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  aesvifaqlvqfhdnapiskneflqmagragrkglfdtgyvtwl....................
gi|294101779|ref|YP_003553637.1|  kasifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtrydmemlaevgyc
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  sdplsgrehlliskifeqswrngkdvdlpmiingiqtppfaqigvmptdtfyppserfklalal
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  lsegvnlhrsnvvvnydipwnptrmmqrvgrinrvdtpfdvihtfnffpttqsndqiklkeaae
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  yleiceggrilly...................................................
gi|294101018|ref|YP_003552876.1|  vlaplvswiwstraaavdllkigiqefrillpsdivltferggaldlqdpmqdywesvrkwrek
gi|294101692|ref|YP_003553550.1|  spfdlekqmkilvvdlglkviekgydervcrvverlcndnggsslvllssmrlvkkvgnwlkgs
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  rllrrmirdyrtrghsaertldlwpsvikgareyifpyqssavamfnsslpyelavlrgyaqpl
gi|294102167|ref|YP_003554025.1|  errerflrnaeekraeadlvirndssidtleqslsr............................
gi|294101458|ref|YP_003553316.1|  vedgttvkifyesriakldlpeemkp......................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  illtaiislkyyyeatalshevtsillvdeidatlhpsilykllklfedysnrykiqiictshs
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  asqlhvndvr......................................................
gi|294102787|ref|YP_003554645.1|  ssaeinvflkkiqetkeqikllqqqkdeylqkkeelektghqiesarknleairydlslmewve
gi|294102032|ref|YP_003553890.1|  icgfvrnegkipftvkavaeviewagrlaehqnrvttefnkiieviveatawalsenatlvedr
gi|294102010|ref|YP_003553868.1|  glevgalisnshlmh.................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  lvvdyi..........................................................
gi|294102625|ref|YP_003554483.1|  qrealfrrlvacgedllilsspstdalgkplppspflg..........................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  wravadgkdlgltgkakigamelgrhmfniikrsgsfhdvllyildsieyedqlkkddpegwee
gi|294101779|ref|YP_003553637.1|  idkamgqiqqeldeqlhllkkqgklleaqrlemrtrydmemlaevgycsgienysryldgrnpg
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  kvmqleieeaalkkekdaaslerlsvlqkelqeareeadalraqyesekeviskvrkmreeida
gi|294102626|ref|YP_003554484.1|  wkdmailvpsrtswfpllekiffeefqlpiyfegstsyfsrseiqdliallnflddpgkelylm
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  lkrfivkqletrmarslvagevregskvyvtvkdkalaf.........................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  vargtssgpdvsregvqrdllpivegstvqtkygtvktdhilfiaagafssvkpsdlvpelqgr
gi|294102409|ref|YP_003554267.1|  agmtgtavteseefkeiygldvivvptn....................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  kgynprygarplrrkiqqliedrmadmllegkikkgslvsidedk...................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  dleevrkekeaavtsqefekaarlrdterkiseeleekkkdwqsrryqekplvsfddiativse
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  gvklffeqdaikaiakearkkntgarglrsimeylmldlmyeipsrsnevekiiitkevvek..
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  hpytqg..........................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  aylge...........................................................
gi|294102413|ref|YP_003554271.1|  lge.............................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ta..............................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  rihalerrknraaewetiwkeglsfyqslfnsyeqqkkvheerteslgfqretlrrqcfatalt
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  teggkeqlltenyacpdcgislpeieprlfsfnnpygacpdcsglgshehfseehaidpvrsve
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  cnaelperiikrelnlgtdvrpflirmadnlrlsgrgisrvlkvartiadldnssrvrvphise
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  gegiadsienlcleltqiispdtekgskyqelgnnalvflqklsqsltvllseqslsdlyaeqe
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  rftgptlylldepttglfytdvkkllhilhrivdqgntvvtiehnldvllssdyiidlgpeggm
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ealv............................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  pgdykdassskdlhnllnewigsenklaildlsgvpfevldiaiglitrfvydsmywgkyesyt
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  sgienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdrarkttlvengfr
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  nqilaspafnqwmtgvpleigsflhspegkprasiftvshlsdnermffismvlneivgwmrtq
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  gkinafltllggdaellt..............................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ehitgvpqvgpqrddmiittkgqsvsivmsrgqrrrtavalmlaagwaverklrrkpllildei
gi|294101692|ref|YP_003553550.1|  qhpytvyvqnelprtellerfrsdlssvligsvsfregvdvpgegltqviidripfphpkdpvv
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  lqtvpesssmhgearrllsmlkfvpplpsenvpsnsilrefigggc..................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  lsliefalarkynviylldn............................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  karspwvemteaqrkleeigevlffpdegllrfkkiheeegarereleelvfqcrnldkqlqaf
gi|294102032|ref|YP_003553890.1|  hvykaieekrfrsnliqeriqraye.......................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  rvenirelgslvtsggdlaevlaevalftdlettdmddleavnfltlhaakglefpvvflvgle
gi|294101779|ref|YP_003553637.1|  eppgtlldffpddfimvideshitlpqvrgmyngdrarkttlvengfrlpscldnrplnwrefk
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  vkreiekaereydlnkaaelkhgrlpelqqqlkkeegahaagqegdqllreevtedeiaeivsr
gi|294102626|ref|YP_003554484.1|  sflssplsslsleevrdlaldapkgyrlqafqekwphlarqiddwrlmahflgpsavlasflek
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  fpirvelqplgreelarilvepenslikqyqallsterievrfsedaieeiaamaekmnaemen
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  wtnipvtqlteeetqrllrm............................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  vksarerliaqkeekrhveevlskvdeeatlargtsysltqnlhkkkeevsalwqklsnlrssl
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  egallpwkkkhymlrklytfsqskewdltqpygtlpknvqnfilygsderlpmffsdrgerhqy
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  alay............................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  eienklgtlrklkrlagvrtleeltnyckeaemnltwlnesyrrseqsgaeakklrreasrlal
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  eggs............................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  gknrplllayeeahtylnkndnnsysknaverifkegrkfgvgalvisqrpseisetilaqvgt
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  lpscldnrplnwrefkkylrqvifisatpgdwerevstcvaeqiirptgvvdpevvvspatgqv
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  tgtpslrailyidevfgymppvkeppskkplitllkqarafgigvvlatqnpvdldykglsnig
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  aaelddrgrnilidalvesswqvfaata....................................
gi|294101692|ref|YP_003553550.1|  qsrnelegrkafvtvilpqakmflrqalgrlirsksdqgrvvil....................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  hipsiqkvleqkgairalaqnrnriekeeeiiqnlsldilsmkqrldrevreihqswtiddles
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  eaifphfkclevqesleeerrlcyvgmtraeeklymsgarsrrlfgtvfrnglsrflweipd..
gi|294101779|ref|YP_003553637.1|  kylrqvifisatpgdwerevstcvaeqiirp.................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  wtg.............................................................
gi|294102626|ref|YP_003554484.1|  sdsflrafpawkrrgvaanmrkaidmarefeeaigtslpgcasylreamerqekfaepdvsnek
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  igarrlhtmveqlleeisftaperqgevvdinaqfvkerlsplmedt.................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  raerqrrqeygneyarvegecvkilsrlqarsealdknekeleeaknkvfvaeketetykkefe
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  mgryegllpwlegrwnetesenvleelagyrvedicqtchgyrlrpealmvqlnhhtidelvem
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  elrkkrertarsleeavnhslrdmameditfsitlsdlgkikstgadeisflmasgmmppgpvm
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  lialrltnsgdqsivkssspdnlnslidllpslrigeavivgesikipsrirvklnnprp....
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ddlvdrlrgitargeralvttltkkssedlaeyladlqfkvkyihselnaferaelirdlrsge
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  twfigrlqtqrdkdrvleglerlenasgydrqfldkaitglkkrefllnnvhenspsif.....
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ldlsfgvsqkagdlekqkedfrnqhvirnetceqarkardearsllktrkehvekmernvspls
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  envirvmtvhgskglefpvlavlglertssagekgslmpspkmgvalsripgernsgqaplaws
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ythlsykkiierhgeiyvqcqrlatslsqlkknvdvlenqletvlenteqrlypepvrvilaaq
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  pvdrllpvlkemefteneqkimgqvmielekrlsflvdvgvgylslmrradtlsggesqrirla
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  kiasggelsrlllalqlalpdsqlpgtlvfdeveaglggkaavlagyklkqlaekcrvilithe
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  vsilvginllregmdlpevslvaildadregflrshrsliqimgraarntrgqvvlyadvetes
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  vqtlrekcgslrqfftrwhqiqnqikenemnldlfrqkkelqwggaaagtlglaflgagyrtgd
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  lsrlfeeqeeyeewqrlfyvactrardslilcghlpwrrdg.......................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  klgklpiqiklaaeafkceeklaapleaylggrqfwlfvksleeaqlgielvkqkragritflp
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  tqigsklsgvlyvldeptiglhsrdtdrllrtlrsirdlgntvvvvehdretmlaadaivemgp
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  atiaalaeqhfvvarqenksfikeiek.....................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  irtsvqetrrrreiqmlfnekhgiipqtis..................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ifflktgitaiaaslgfiivdffqkrkffnekeellcrlrknlveteeelshtveglaiecpkd
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  leqchprnpdygfplpcqgtvgwatdliaseqlwspavnhllgdlliveeydvgmnlaragasf
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  gageqgg.........................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ylelekaemyiddcidgireydqalqsqrdaeeelgrrqrkledcesslnsikklldqtdaewk
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  pivtlqgdvftvggsvsggkfrktggaierrlqiedleknlkdkrgslervvsllqeaeelecv
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  sfveekgfsaslkvehwtefeslvkqlrgrlaqirdmekqlsssqeyisakeeeihslfrslsl
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  iakerafwkekeqeaekkllshsirferqreeivrlekersfflndvedsgkllkrtqhslkel
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  gpwsklslvspidiltsrleeaeeqwnqitmiqrekkrneeiyerahkawnesrtlkkelfeqa
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  eeaiasfgdfpdetelerelasakgeeavlcekvksgevlinrieseaaqlterlrslsgelen
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  kvhdepsflelgerwqrcndlkkiienhrlsllaiaggnenltkvleelpkrtpaesqiliges
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  telsldegldrlrelgvqsyelwenikeidserarlsaeteslvertsllrercaeahervqie
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  keqeqllsqqleelneerghlktridelekdkelsalflerekleeelrlalkewlavvacrcv
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2akab1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  eekvkdsqrqvdsarlelnqiislwedayhypgtenisleeyeeeslahvrrlekkvrelgdyd
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................