SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

P-loop containing nucleoside triphosphate hydrolases alignments in Aminobacterium colombiense DSM 12261

These alignments are sequences aligned to the 0052549 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  dieiarsakmkpivevaaqlgideeelelygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102529|ref|YP_003554387.1|  dieiaqnaelkpivevaaqlginedeleyygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102437|ref|YP_003554295.1|  veiiigaqwgdegkgrvvdalgnrvevfaryqgganaghtvivedekyvfhllpsgmlypcklc
gi|294102168|ref|YP_003554026.1|  dsildklnprqqeavrycdgpllvlagagsgktrvlahkiayliekgyaspkgilavtftnkaa
gi|294101779|ref|YP_003553637.1|  adwgpsgdqpeaieklveslkngtrfqt....................................
gi|294102457|ref|YP_003554315.1|  tkfifvtggvvsslgkgitaaslgvllkkrgfrvsiikldpylnvdagtmnpfqhgevfvtddg
gi|294101625|ref|YP_003553483.1|  emkkirnigiaahidagktttterilfytgrnykmgethegsatmdwmeqerergitissaatt
gi|294101185|ref|YP_003553043.1|  tyealdkygrdlvkmarlgkldpvigrdeevrrvirilsrktknnpvligdpgvgktaivegla
gi|294102626|ref|YP_003554484.1|  tqpgqfkaitadaplvavsagagtgktwtlawrfiwilvtgradtneiltltftekaalemaer
gi|294101765|ref|YP_003553623.1|  ydaafpakdivdfvdriineaakngasdihieglsawsrvrfridgycravysfsldfhpaiis
gi|294102479|ref|YP_003554337.1|  hpvplgviqgaikmedvwfaykdeqwvlkgvalevcpgervavvgetgggkstlmdliprfydp
gi|294101904|ref|YP_003553762.1|  islthltkiftkgkesfkavddvhldidagelitflgpsgcgkttilrmiagfekptegqvlig
gi|294102557|ref|YP_003554415.1|  yikkivkdfgsyddpsnrvravdrvdlhvkegelitllgpsgcgkttllrmiagfedptegdvf
gi|294101807|ref|YP_003553665.1|  tlpvsrdmlgrifngrgepidggapilpdakldingmpmnpfsrdypsefiqtgistidgmnpm
gi|294101806|ref|YP_003553664.1|  vietiaviknesgeeknvvmlqrwpvrkprpvarrlppiiplttgqrvvdaffpiakggtacvp
gi|294102649|ref|YP_003554507.1|  misiqnlyktypceggdfealrnvsiniqsgeifgiiglsgagkstllrtlnrleepssgsici
gi|294101185|ref|YP_003553043.1|  ipvtrlmegerekllkldeilhqrvigqdeavelvadavirarsgikdprrpvgsfiflgptgv
gi|294102868|ref|YP_003554726.1|  lqlkqlnkkfghsyavrdfsfdinegelvsllgpsgcgktttlrmiggflqpdegsiilegedi
gi|294102500|ref|YP_003554358.1|  ltprmivecldryivgqekakravaialrnrmrrrnlprdlanevapknilmvgptgvgkteia
gi|294102409|ref|YP_003554267.1|  pneralkryrqiaddinglepeysaksdedlrslvadfkrranegesldnllvevfalvrevsr
gi|294102354|ref|YP_003554212.1|  kpedirsvaiaahggagktslveailfsngdinrmgnvvdgntvadfgaeeqkrqisintalvt
gi|294101565|ref|YP_003553423.1|  ipvtqlteeetqrllrmeeeihcrligqeeavsavarairrarsgmkdprrpvgsflflgptgv
gi|294101424|ref|YP_003553282.1|  ievknlhksfgnlhvlqgvsmtvgegevvsvigpsgsgkstlarcicrledindgeiylygqrv
gi|294101976|ref|YP_003553834.1|  kmpvglslvgqvlngrgrsidgtplsfidkdlpitgmpinpvrrtspnayvetgissidmmntl
gi|294101061|ref|YP_003552919.1|  ilrvedihksyggvevlrgisftvrkgetkvfigpsgtgkstllrcinqltipdsgqiwlhgee
gi|294101048|ref|YP_003552906.1|  dksedavvavrgvslaarqgevfvimglsgsgkstlircvirlieptsgeiwvngqevsslpkk
gi|294101977|ref|YP_003553835.1|  engveltmkqrwevrrprpvlsrlsfdaplltgqrildtlfpiaiggaavlpggfgtgktvtqq
gi|294101084|ref|YP_003552942.1|  lihvenlyksfedgevlngisidihegdlvsiigpsgcgkstflrclncleyidsgtitiagvt
gi|294101565|ref|YP_003553423.1|  ptldqlgidlseksrkdeldpvigrdkeiqrviqilarrtknnpvllgdpgvgktaiveglaqk
gi|294101786|ref|YP_003553644.1|  llkvdhlkkhfytpygtlfavddvsfsikegetlgvvgesgcgkstlgravlrlceptsgtvff
gi|294101493|ref|YP_003553351.1|  lvrvdniyktysmgevdvtalqgvsfsvkkgeflsimgasgsgkstlmniigcldtpteghyyl
gi|294101884|ref|YP_003553742.1|  aekalhgdiralariislveneapeseeimkylyphtgkalvigitgspgagkstlvdklilef
gi|294101894|ref|YP_003553752.1|  dtpkpaevkkfldqyvigqedakkilsvavynhfkristmseenddielqksnvlligptgsgk
gi|294101778|ref|YP_003553636.1|  dnrpkvtfddvagcdeskeelseviqflrdpgkfralgakvpkgvlllgppgtgktllaraaag
gi|294102313|ref|YP_003554171.1|  ivnikeltkrypmgdhtftalssvdlefkkgefcgligpsgsgkttllniigaldapsegsvvv
gi|294102640|ref|YP_003554498.1|  lldirnlkkyfnvskgllhavdditltitkgqtlglvgesgcgkstlgrvviglieatggevlf
gi|294101376|ref|YP_003553234.1|  isyedigglgpqiqrvremielplrfpqvfdrlgvqppkgvllygppgtgktviaravanetdv
gi|294102641|ref|YP_003554499.1|  lldirnlsvrfntdsgivhavnnlnlslrrgkalgfvgetgagktttalavlqliqsppgeitn
gi|294101359|ref|YP_003553217.1|  skvlilsptrelsqqiwkeakwfgnyinvsaaslvggmdmsqqirslrdgsavvtgtpgrvldh
gi|294102459|ref|YP_003554317.1|  lrngdviwgmvrppkdqehyeallrvemvnfadpeaarkrphfgtltpifpdsrltletdpdei
gi|294101785|ref|YP_003553643.1|  ileirnlrvsyetedgtvealngidldldegvtlgivgetgagkttlaksimriiptppghies
gi|294101376|ref|YP_003553234.1|  pdvtwsdiggleaikeelieavqwplkynsvyekfnitppqgillhgpsgtgktllvralahes
gi|294102074|ref|YP_003553932.1|  mfvisgpsgagkgtvrkalfeqmpdlvysiscttrqprdger......................
gi|294102442|ref|YP_003554300.1|  irlagvtkifqpdivaledvylsimqgefvylvgttgsgkttlmrlitreliqtrgqvtvgdqn
gi|294101577|ref|YP_003553435.1|  lkarkvckafkgrtvvssvdldvhmgeivgllgpngagktttfymivglikpdsgrvmidskdi
gi|294101171|ref|YP_003553029.1|  llelngvdkffggvhavqsmsfalnekeivgligpngagkttifnvvtgvydpdggrilfdged
gi|294102413|ref|YP_003554271.1|  vletkgltmcfggltavnsfnmavpkgsivgligpngagkttvfnmitgfykptegniffnedn
gi|294102187|ref|YP_003554045.1|  einrlhddllnevfgygpiqplldddtvteimvngceqvfverwgkieptdvffnndnhirrii
gi|294102332|ref|YP_003554190.1|  irisglrkrygsgdtavdalkmvnmhvapgevvgligpsgsgkstllkclgavieptagqmmlg
gi|294102831|ref|YP_003554689.1|  mlsiavtnqkggvgktttcvnlsaelgrlgysvlavdmdpqgnctsglgiearaievslydvll
gi|294101321|ref|YP_003553179.1|  akphlnvgtighidhgkttltaaitkclstkgwsnfeaydmidkapeerergitinishveyqt
gi|294101626|ref|YP_003553484.1|  akphlnvgtighidhgkttltaaitkclstkgwsnfeaydmidkapeerergitinishveyqt
gi|294101069|ref|YP_003552927.1|  ilsvddlhfsygetpilknislsvknqemvmilgpngsgkttllrclnginrpqkgtitledkn
gi|294102759|ref|YP_003554617.1|  mieivdlsitykteshdvsavknaflsiprgritglvgesgsgkssllmaipgllpsntevsga
gi|294101055|ref|YP_003552913.1|  ileihqlavafnnkkilkninaniyphqitaiigpsgcgkstflkslnrlvedergvtlsgqir
gi|294101254|ref|YP_003553112.1|  plvqmqeitkefagivanhnidfdvnrgevhallgengagkstlmnilyglynpdrghilidgk
gi|294102760|ref|YP_003554618.1|  tdkvsvfypsrdgknsgqwalrnislslqqgeslaligesgsgktsllrvllglisptegnvel
gi|294101659|ref|YP_003553517.1|  tlqgvgfsypeadssaldqvsfqvregewlallgsngsgkstlakhlnalllpsqgacfvygmd
gi|294101172|ref|YP_003553030.1|  nilldvqnlqvsygairalrgislqvkegeivcvigangagkstlmnalmsevrrekglinfsg
gi|294102017|ref|YP_003553875.1|  yirpqinnglnlkieggrhpvieatfldlpfvpndivldgdeerialitgpnmagkstylrmaa
gi|294101748|ref|YP_003553606.1|  vldslrgtrwkkavektrervreevknlvrlyarrellkgyafpvaseiyrhfveafpyvetpd
gi|294102409|ref|YP_003554267.1|  pmvrsdf.........................................................
gi|294102070|ref|YP_003553928.1|  fehvvgisalhkryiddlmdmavsllpsdeeeerdpeeirvsivgrpnvgksslvnalagsdrv
gi|294102390|ref|YP_003554248.1|  dplpdflrlkhafpplydsilemhypqgreswkkardrlayqelfvlqtgmalrrgersrlaek
gi|294101403|ref|YP_003553261.1|  redilelaiddirskfgegsimrlgdpfkvqvevistgilpldvalgigglpkgriveifgpeg
gi|294101730|ref|YP_003553588.1|  ekrvshaylfsgprgcgkttlarllakslnctgqkqsvepcndcpnclainggesldvieidga
gi|294102602|ref|YP_003554460.1|  vqaekirnlaiiahidhgkttlidsifkaaqifrkgahieervmdsnelerergitirakhctv
gi|294102663|ref|YP_003554521.1|  ivsnlnlfygknqvlhninmdifgktvtaligpsgcgkssfirclnrmndfipnvkvegdiyle
gi|294101436|ref|YP_003553294.1|  lkcgivglplcgkstvfnvitragaevkpyasgktdpnramvsvpdprfehlvtifepkkqtpa
gi|294102150|ref|YP_003554008.1|  slsrirnfciiahidhgkstladrlieytgtveirkmkaqlldsldlerergitiklvpvrmsy
gi|294101607|ref|YP_003553465.1|  prvivvtsgkggvgkttttanvsfalakagykvvaidadiglrnldvvmglenrvvynfidvie
gi|294102035|ref|YP_003553893.1|  rrfvqvymgdgkgkttaalglairaagwnmkvgiiqfmkgwpqygelaslarfpeiqlvqtgrp
gi|294102412|ref|YP_003554270.1|  lkieelhvyyggihavkgislhipkgkivtligangagksstirsiaglvrsakgkilytsneg
gi|294101660|ref|YP_003553518.1|  msiiiknlthtyhpstpletvaleginlttekgqwlsivghtgsgkstlaqhlnalivpekgev
gi|294102549|ref|YP_003554407.1|  lwisrltktfgtlravddfsleiasgtvhslvgengagkstvvkcvyglysptagkfkidnkil
gi|294102841|ref|YP_003554699.1|  pavvfedvsfgyengtmvldqasfqvpqgeflviigpngggkttllrlilglekpargkievlg
gi|294101272|ref|YP_003553130.1|  mlrlshlgkkynglpvidqfdldiekgsfsvligpsgcgkstlfdlltgtiereygtmewigea
gi|294101433|ref|YP_003553291.1|  kkdvgkviavgsgkggvgkssiscllavalakkgfsvgildadit...................
gi|294101963|ref|YP_003553821.1|  khmeprppivtvmghvdhgkttlldyirqtnitareaggitqhigastvtyegknivfldtpgh
gi|294101356|ref|YP_003553214.1|  dssekavaihfpqcprsgqevisvkdvkktygdnlifkdisfsvhrgekialvgvngagkstls
gi|294102542|ref|YP_003554400.1|  rlknikhfysqrcvlqipsleigqgeilgllgangsgkstllrilafletptegtvyfkkerve
gi|294101861|ref|YP_003553719.1|  lrpsslqdfvgqqklkdklsiyvqaarqrkealdhilfygppglgkttlagiiahemggqlrvt
gi|294102400|ref|YP_003554258.1|  vtgfstgfyqfdrmtgglqpgslniiaarpsmgktalalniaqyggverkepilifslemsaeq
gi|294102043|ref|YP_003553901.1|  mfitlegidgcgkstqaaflkeqlqqkkkepvlwtrepggwvhgdfvrtlllekdlrhelself
gi|294101077|ref|YP_003552935.1|  mpllrlksiafayprssplfthlsfeifekekiyirgengagkttlfslimgllrpqkgdiivk
gi|294102348|ref|YP_003554206.1|  llkvdsitvrrdnatilkdislrvesgevtgvlgrngagksslayalmglpdyipvkgsisflg
gi|294102040|ref|YP_003553898.1|  kspkvivlvgvn....................................................
gi|294101613|ref|YP_003553471.1|  mfierlrlkgfksfggsheltfspgftaivgpngsgksnildglrwvlgegspnclritrqsdl
gi|294101367|ref|YP_003553225.1|  epllkmenigkayfgnrvlkdvsftlekgqilglvgengagkstlmnilfgmpviqetggyegk
gi|294101893|ref|YP_003553751.1|  pwntyteenlditkaqrildedhyglvkvkerileflavrqlagkeakgqvlcfvgppgvgkts
gi|294101841|ref|YP_003553699.1|  dvglvglpnagkssllaaisnarpkiagypfttlspnlgilavdddrivvadvpgliegahenk
gi|294102070|ref|YP_003553928.1|  iaivgrpnvgksslfnrilgrreaivddmpgvtrdriygetewkgrqfyivdtggllvrdehpl
gi|294102221|ref|YP_003554079.1|  mvhhvkrqfvffggkggtgkttcaaayayalsrlgiktlvvstdpahsladafnrpigldvipv
gi|294101356|ref|YP_003553214.1|  iqlvnithfygeqglynslnwsithgsktgligsngtgkttlfkiimglvepregnvyfpkgir
gi|294101345|ref|YP_003553203.1|  pllatqdlsigygpkkgttlvagpiatslyegelvcligpngvgkttllktlagtqnplggeir
gi|294102145|ref|YP_003554003.1|  eislvlgtaghidhgkttlvkaltgvscdrlneekkrgitielgfaplklhdgrvvsivdvpgh
gi|294101756|ref|YP_003553614.1|  pivgrpnvgkssllnnilaykvsivsekpqttrnaihgiynepemqivftdtpgihrprhklge
gi|294102549|ref|YP_003554407.1|  pflemtrltvsgdrgkdvvknltltvhrgeivgiagitgngqseleeaisglrfvkegqllmgk
gi|294101372|ref|YP_003553230.1|  ytgeemveisthggtlvaqkclesligkgarlaepgeftrraflngkidlsqaeavlgiirsks
gi|294101016|ref|YP_003552874.1|  lnpnyifnsfvvgksnrlahaaslavaetpgeaynplfiwggvglgkthlmhaighyvlnknns
gi|294101780|ref|YP_003553638.1|  vitgpsgsgksslafdtlyaegqrryveslsayarqflgiqkkpdvddisglspaisieqkgts
gi|294101686|ref|YP_003553544.1|  idesgcekprssdlmavniidvrppqrftsgipeldrvlgggwvsggvvllggqpgigkstlll
gi|294102507|ref|YP_003554365.1|  pnpdladikgqagakraleiaaaghhnllfigspgsgktmlarairgivpplsheelleslqih
gi|294101471|ref|YP_003553329.1|  flrkggsqivlfshlsvsfkkgevvglvgpsgkgkttlgdillglivpdrgkvlwkgqdirtls
gi|294101845|ref|YP_003553703.1|  mleelslrniggldsahlhfkgrfiaitgesgagkssivralefasgkraqselirageeeaev
gi|294101553|ref|YP_003553411.1|  dvdykvvkslvdsirgrcigqevldsitpgqqvvaivyeelvslmgedvvpfiisskpptlcmm
gi|294101853|ref|YP_003553711.1|  lrveapipgkpyvgieipnpkrrgvllrrilesqafeqadynlplpmgvrvdsrpliigledlp
gi|294101780|ref|YP_003553638.1|  ahhnlkeidvaipsrvfscisgvsgsgkssllydvlykgmkrildkdfreragkhlsidgaeqf
gi|294102079|ref|YP_003553937.1|  mknlvvaidgpagagkssvakkvaellgldyldtgaiyralafylnamgfepvespylteilsk
gi|294101472|ref|YP_003553330.1|  flsvenlsildeenkplvrnvsfsipsesvfflvgetgsgktpiaqaiagtlakrlsvcgkvfl
gi|294102235|ref|YP_003554093.1|  itlalagnpntgktslfnlltgsrqhvgnwpgvtverkeghfsyegmnftlvdlpgiyslgaas
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  qwerpladrmrpsslddfvgqnhllapgtplrqilqsgkvpscvlygppgvgkttlvrlmamvt
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  mrvillgppgagkgtqaaeiktkykvahistgdilrqnvkektklgcqaqefmnggklvpdeii
gi|294101715|ref|YP_003553573.1|  wtlpelskkpffvfydllhpllgekgipltiecgrsfhvlvvtgpntggktvalktvgmgiila
gi|294101925|ref|YP_003553783.1|  sieigkhsssdnlsvyvdihklilrhcailgstgsgksnttvsilrailndydgsrvilidphg
gi|294101367|ref|YP_003553225.1|  lagnilkvehlwvdmpgetvrdvsftvkegeifgigglagqgklgiangimgmypsggtvtfde
gi|294101751|ref|YP_003553609.1|  pvrpktggqklyieamrahdivfaigpagtgktylavchgvamlkagaisrivlvrpaveages
gi|294101046|ref|YP_003552904.1|  navlsaptgagktlvaylwagllttegkaqmpegisriiftapikalsnerymdlrrmgfdvgi
gi|294101779|ref|YP_003553637.1|  tllgvtgsgktftvanvlaqfdrpvlvlahnktlaaqlytefktffphnavhyfvsyydyyqpe
gi|294101226|ref|YP_003553084.1|  llignpnvgksvifsrltgvraissnypgttvgflegwlrynsevyriidvpgaytldptneae
gi|294101892|ref|YP_003553750.1|  ppqtlpevafvgrsnvgksmllnalmerklahvgstpgktrsvnfykieaevdfflvdlpgygy
gi|294102315|ref|YP_003554173.1|  sdnlvlydskdltthgmiigmtgsgktglgialleealmdnipviaidpkgditnlllsfpeqr
gi|294102188|ref|YP_003554046.1|  eriavlscrggaggssfsislalqlasmgkrtalidgdlymgdvafllntpyelnwtswanecl
gi|294102320|ref|YP_003554178.1|  ekytniiideahrfrtettityeklaeicrgkrvilvtatpynnspkdilsllklfqkgqksti
gi|294102169|ref|YP_003554027.1|  svmaadeefarrmrdeshhrgilviniigspgagkttlleatkkaasfrfaviegdiatsrdae
gi|294101254|ref|YP_003553112.1|  kkitvlgdrgipvvkdlsidvrereilglagiagngqqelcealaglrplkegrimiddeelth
gi|294102077|ref|YP_003553935.1|  ryrrekagiptvaltgytnsgkstllqqlshgrnlyvadqlfstldtyvrkvelsdghdvlvsd
gi|294102510|ref|YP_003554368.1|  hmakgkrkleelvqkldlilevrdaraphltsspmsdqlsricpvyivlsradlaeegatkawl
gi|294101748|ref|YP_003553606.1|  qvhlpvdggarawilggasvpllvvfsdqrqaedfvsdfenlwegeivrllyelplsvegvrnk
gi|294101141|ref|YP_003552999.1|  drtcllapcgsgktlaawkwgsgvasrhpisrfiflyptratategfrdyvswapetdgtllhg
gi|294101018|ref|YP_003552876.1|  lewaaglnllvgnngsgktnaleaihilsgwgpfrssrksflvnwdteekqaylrgyfsgetnl
gi|294101692|ref|YP_003553550.1|  iwdsfmqqrntvfvaeaptgigktfallapalkwalpqekrilfltagitlqeqlirkdlprlk
gi|294101032|ref|YP_003552890.1|  mfrltvasgkggtgktciaaslalslskgtaidldvdepdlglvlqiknpkkenvykvvpqiea
gi|294101031|ref|YP_003552889.1|  pkeiviisgkggtgktcimaalcssfsgkavfcdvdvdapnlqlllnpqdeqafsftgrkipei
gi|294101431|ref|YP_003553289.1|  ektkviviagpsgsgktttakrlkiqlqvcglnptvisldnyfvdrektpldeqgnydfevlea
gi|294102167|ref|YP_003554025.1|  lvlgvtgdvgagkstvsqiwkslgatiidadalaheawkdttvlrraserwgtqvllgnghinp
gi|294101458|ref|YP_003553316.1|  aplcipqlevlikgmflkdrfldiirhfvlfqsdgkeikkilagyhqyhavnkalqstqratme
gi|294102320|ref|YP_003554178.1|  fkrleyqeqavlnakkivleyggvfisdvvglgktyisamlagqldgrtlviappvllektnpg
gi|294101940|ref|YP_003553798.1|  rlgirrldtafdgvypgemlnlaga.......................................
gi|294102120|ref|YP_003553978.1|  rtakglamacvedgsslilgggtgvg......................................
gi|294101791|ref|YP_003553649.1|  hvysgltillygdlgagktvlvkglgdglgargvrspsftline....................
gi|294102136|ref|YP_003553994.1|  mvkqidirkyrkmedlslvfsqginilsgtngtcktsllhivsnsfqevnkgcpwvtdasclta
gi|294101830|ref|YP_003553688.1|  rcliitgmsgagkstvlniledqglfavdnippallpqllellsqhraavqeglaavvdvrggr
gi|294102042|ref|YP_003553900.1|  iaidiarlllcekknacgqclsccswhekthpdlvlsgslekaptisecreiavelslypv...
gi|294102015|ref|YP_003553873.1|  ilaiigptavgktklsleiaetlkaevisvdsrqvyrymnvgtdkvtfqtrqhilhhmldvvdp
gi|294102787|ref|YP_003554645.1|  mrfiefkirsfgllenmeghfpaglslilgdnesgkttlmsflryslfgcpdgrssrnlyapph
gi|294102032|ref|YP_003553890.1|  lekfigqeravqaisfglsveskgynifvlgnpgsgrtsyslqrlhesakekpapddwiyaynf
gi|294102010|ref|YP_003553868.1|  tllaslirlyewpkavavtga...........................................
gi|294101586|ref|YP_003553444.1|  yifavsgmknsgktk.................................................
gi|294101458|ref|YP_003553316.1|  vviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltdkntrvvfg
gi|294102625|ref|YP_003554483.1|  ivagsprmemetlarelvlwknkkgylsgqeilpaetpwqnigmvfdapllplaeevlqryrip
gi|294102478|ref|YP_003554336.1|  ipvisvgnitlggtnktpfvemlsrhfynmgvrvgivsrgyggrtsepvvikgtssereivgde
gi|294101874|ref|YP_003553732.1|  hviafvgpagtgksqraqyvatdnnvdyiiddglviargrimtgksakseknlvrairralfef
gi|294102071|ref|YP_003553929.1|  lqe.............................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  gegkttttvglaqglaklgkkvsialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102529|ref|YP_003554387.1|  gegkttttvglgqglaklgkrvcialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102437|ref|YP_003554295.1|  vvgngvvvdpeqllkelhtlqeqgkdrarlmisgsahvvmpyhkildkadeqfrskdkkigttg
gi|294102168|ref|YP_003554026.1|  remgervqalvgakasamqvstfhsfglhflfrnsdqleflglrkgfaifdrndsrslvkkime
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  aetdldlghyerfideslsadnnvttgkiystviskerhgcylggtvqviphitneiqdrilka
gi|294101625|ref|YP_003553483.1|  ciwrdcfvniidtpghvdftveversmrvldgavavfcavggvepqsetvwrqadkyhvpriaf
gi|294101185|ref|YP_003553043.1|  qrivrgdvpeglkdrsifaldmgslvagakyrgefeerlkavlneiktsegriilfidelhtiv
gi|294102626|ref|YP_003554484.1|  iknlllqlamelpsqkvffqkaadridegyistihsfsmrvlkecglateldpesgtiappqes
gi|294101765|ref|YP_003553623.1|  rikimasmdisdkrrpqdgqfniktgsqdfldvrvsslptvdgekialrlldsskipdniyqlg
gi|294102479|ref|YP_003554337.1|  srgkvsvdgcdvrtldltelrkqigivpqdpvlmkgslafnisygfpqateedivkaaqiagih
gi|294101904|ref|YP_003553762.1|  grdithlavnkrdigfvfqnyalfphmsifdnvayglkvrglsrkeaelkvkevlnlvgligvd
gi|294102557|ref|YP_003554415.1|  fgdrrvndvapnhrnatmvfqsyaifphlnvyeniafglrlkkmeeskirekmegvidlvgltg
gi|294101807|ref|YP_003553665.1|  vrgqklpifsgsglphnrmaaqiarqatvisghedfavvfaamgitfeeasffmedfrrtgaiq
gi|294101806|ref|YP_003553664.1|  gpfgsgktviqhqlakwaesdivvyvgcgergnemtdvllefpeledprsgeplmkrtvliant
gi|294102649|ref|YP_003554507.1|  gdtditrlstpelrklrrrvgmifqhfnlltsrtvfqnvafpleiekwetdaiskrvtevldlv
gi|294101185|ref|YP_003553043.1|  gktelaktlaealfdsednmiridmseymekfsvsrligappgyvgyeeggqlteavrrrpysv
gi|294102868|ref|YP_003554726.1|  thlppekrptatvfqsyalfphmtvlqnviyglkfkkidrkkamqmgdemlakvglpdsasksi
gi|294102500|ref|YP_003554358.1|  rrladlvlapfvkveatkftevgyvgrdvdsmirdlvetavamvkrvkieevqgpaeeraewrl
gi|294102409|ref|YP_003554267.1|  rtlglrhfdvqlmggmalhegkitemk.....................................
gi|294102354|ref|YP_003554212.1|  lerngkrlylldtpgfadfigemrsamrvsdsalavvsglhgvevqtgkayeyaedfsipvafv
gi|294101565|ref|YP_003553423.1|  gktelarrladflfgsedamirldmsefmerhevgkligappgyvgydeggklteairrrpysv
gi|294101424|ref|YP_003553282.1|  dngkhsnkevatlvgmifqqfnlfphlsvldnitlcpiqakgmk....................
gi|294101976|ref|YP_003553834.1|  vrgqklpifsgsglpaneiaaqivqqaavpgretdflvifaamgitrrearyfidtfestgain
gi|294101061|ref|YP_003552919.1|  vthskksinvlrqkmgmvfqnfylfdhltalrnveiallkvkgmdkkharekamlelervgmaa
gi|294101048|ref|YP_003552906.1|  dltefrrkqiamvfqhygllphktiidnvefglklqgisekerrersnvalervglkgwenyyp
gi|294101977|ref|YP_003553835.1|  slakwcnaeiiiyigcgergnemtevleefpelsdpfhnaplmermvliantsnmpvaareasv
gi|294101084|ref|YP_003552942.1|  vsrtgkekeldksfleachhmrqevgmvfqsfnlfphrtvlenvmlapmvvkkaseeeaheial
gi|294101565|ref|YP_003553423.1|  iqdgniaeilrgkkivqlnignlvagtkyr..................................
gi|294101786|ref|YP_003553644.1|  dgedvlkfnkakmkkmrsqmqiifqdpyaslnprmtvsqsiaapliiqgvykssekdkiqkkvd
gi|294101493|ref|YP_003553351.1|  dgtdvstidenqladirkntigfvfqgfnllprmtalenvelpmlysgisarkrheral.....
gi|294101884|ref|YP_003553742.1|  rkkkktvgiiavdpsspfsggailadrirmqrhandpdvyirsmgtrgslggvsrstre.....
gi|294101894|ref|YP_003553752.1|  tllaqslakklnvpfamadattlteagyvgedvenilvrllqaadydiqaaergiiyideldki
gi|294101778|ref|YP_003553636.1|  eadvpffsvsgsdfvemfvgvgaarvrdlfeqarkyqpciifidemdavgr.............
gi|294102313|ref|YP_003554171.1|  idrnvenlshkesaqlrnhhigfifqtynlfpvynvyeniefpllllkipqkerkekifdal..
gi|294102640|ref|YP_003554498.1|  kgqdalkfnnaqkrefhkqaqivfqdpfsslnprmsvsqliaepllinkacgsrkevdnkvkel
gi|294101376|ref|YP_003553234.1|  yfthisgpeiigkfygeseerlrnvfdeaqahapaiifideidaiapkreemggekqverrvv.
gi|294102641|ref|YP_003554499.1|  geiffdgqdvmkmteaekrdirgskiamifqdpmtslnpimtveeqimemislhsdfkgeavrk
gi|294101359|ref|YP_003553217.1|  irrgtldtsgikivvldegdhmldlgfkeeleaildslpncqrvwlfsatmpaeiknlakrylk
gi|294102459|ref|YP_003554317.1|  strlidlfapigkgqrallvsppkagkttvlkkianavtvnhpdiilmvlliderpeevtdmar
gi|294101785|ref|YP_003553643.1|  gtilyknkdilgmtsseirkvrgeqvsmifqdpmtslnpimivgdqiaeaikthmhvssakatk
gi|294101376|ref|YP_003553234.1|  gvnfipvkgpalmskyvgeserairevfkkakqaspsilyfdeieslvpirgrdsgagasfter
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  lrklrasqlpyyrrylgvvfqdfkllphltawenvafvlesmgmprrmvqkrtnevvdqvglwr
gi|294101577|ref|YP_003553435.1|  tpfpmfrrarigvgylpqeasifrnltvkenieivlqelgkpqkeietmvshileelgltslas
gi|294101171|ref|YP_003553029.1|  itplktyevirkgiartfqnlrlfprssvlenvmtaaqqheaysfveavthfgkwrmketsird
gi|294102413|ref|YP_003554271.1|  itgfppnkvcesgiartfqnirlfsnetvlqnvmigchvrqkskwwmapfpvpsmiqeekeire
gi|294102187|ref|YP_003554045.1|  dkivaplgrrideaspmvdarlpdgsrvnavippvsidgptltvrkfrrepftaqdlialgtls
gi|294102332|ref|YP_003554190.1|  ddviyhdgwkvkdlralrrdhigfvfqapylipfldvtdnvallpmlagkpnaearqqaiellk
gi|294102831|ref|YP_003554689.1|  ggasaqdalmatswqgvsllpatidlagaevelasvisretclrrhmanlnqfdvaiidcppsl
gi|294101321|ref|YP_003553179.1|  enrhyahidcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehvllarqvnvpa......
gi|294101626|ref|YP_003553484.1|  enrhyahidcpghadyiknmitgaaqmdgailvvsaadgpmpqtrehvllarqvnvpa......
gi|294101069|ref|YP_003552927.1|  mrrmsgreiarrigyvpqssekvrltafdaillgrrpyvgwrlaesdikkvdaiihtlgldela
gi|294102759|ref|YP_003554617.1|  vifdnlnlislrpemlnairwkdialipqgamnsftpvltigkhieevlaihlglsgearrhrc
gi|294101055|ref|YP_003552913.1|  ldgedtftlspeevrrrigmvfqsptpfpfsiydnmayplryygygskkksknldviirnkled
gi|294101254|ref|YP_003553112.1|  kvsfsspkdaiaagigmvhqhfmlipsqtvwenmilgleglpqllpkkeihqqiidisrqygle
gi|294102760|ref|YP_003554618.1|  fgenidkcshsqlielrrrcgyvpqdpygslpptltvldavaepwiivngrksrleayskarrl
gi|294101659|ref|YP_003553517.1|  treeknlwairshvamvfqnpdnqivgtvveddtafgpeniglspleirqrvdwalsvtglshk
gi|294101172|ref|YP_003553030.1|  aplaqrsydvvkqgislvpegrrvfapltvyenlmmgafprkepekvkqdlqwvfslfprleer
gi|294102017|ref|YP_003553875.1|  llvimaqmgafipaaeasmglmdrvftrigardelsrgnstfmvemietanilhnvtdrsivvl
gi|294101748|ref|YP_003553606.1|  qlraeqeilqdmess.................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  lvsdipgttrdatdtviemkegkfrfidtaglrkksridsdieyysfvrtlqavdrsdvallvm
gi|294102390|ref|YP_003554248.1|  apilpesgrlkerflkeifpyplteaqkkvsleisqdmalni......................
gi|294101403|ref|YP_003553261.1|  sgkttvalhgiaeaqkaggiaafidaehaldprlaaslgvdvqslyvaqpdsgeqalyvldtlv
gi|294101730|ref|YP_003553588.1|  snnsvdevrelkahvslsafsslykvyiidevhmlslsafnallktlee...............
gi|294102602|ref|YP_003554460.1|  ewngyliniidtpghadfsgevervlstvdsvlllvdaneg.......................
gi|294102663|ref|YP_003554521.1|  gkniysgatdvialrrqvgmvfqkpnpfpmaiydnvaygprlqgiksrekldeivkrsligaal
gi|294101436|ref|YP_003553294.1|  tvefvdlaglsrdaskgaglgnaflsfvaesdalvhvvrtfdnpevphpednidpardwnivem
gi|294102150|ref|YP_003554008.1|  kskdgneyilnlidtpghvdftye........................................
gi|294101607|ref|YP_003553465.1|  gtcrlpqa........................................................
gi|294102035|ref|YP_003553893.1|  dfvkkgsp........................................................
gi|294102412|ref|YP_003554270.1|  veenilgktpefivkkgiamspegrrilphltveenlllgayirddkegiekdmdhvyslfprl
gi|294101660|ref|YP_003553518.1|  ivegfvsrpksqdlrkirrlvglvfqypeqqlfaetvfdevafaprnwgvseedlekvvnetll
gi|294102549|ref|YP_003554407.1|  tiktprdamkygigmvhqhfmlvpslpvyknvvlgdepttrglifnhhgaieavrhlsaqygln
gi|294102841|ref|YP_003554699.1|  ttpdravtsvgyvpqegvrdkifpvsvfdvvlmgrlgigrrkifteedkkiamdvlehmglagr
gi|294101272|ref|YP_003553130.1|  vphlgqiaaymqqkdlllpwlslmqnamlpqvfskekhlrknkkakglferfglngfedylpga
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  eaftamrarg......................................................
gi|294101356|ref|YP_003553214.1|  rlisqsevptegnisygynvkmgffsqesaqnlnynrtiweeisntgylgtdtekrgllgaflf
gi|294102542|ref|YP_003554400.1|  tvsvnyrrsvtlllqntyllkravwenvafglkvrgvrgk........................
gi|294101861|ref|YP_003553719.1|  tgpalekagdiaailsnlepfdvl........................................
gi|294102400|ref|YP_003554258.1|  lvqrmlgseakvnihdirngs...........................................
gi|294102043|ref|YP_003553901.1|  lfvidrcehvsqvispalscgqivlcerytdstrayqiwgrglpeekvedlfawcsfpepdltl
gi|294101077|ref|YP_003552935.1|  gkviknqkdlrylrqtigflfqdpddqlfcptllddvlfgplngginke...............
gi|294102348|ref|YP_003554206.1|  editswsitdrakagltlawqmparyegisirdylrig..........................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lfqgsislptatetevslciredpkictikrefspetgtslfvdgmrirlqdlddvkrqwhmeg
gi|294101367|ref|YP_003553225.1|  ffingqeaqfkspfdaldagigmvhqefslipgftaaenivlnrestqynflvesfgdrlrtln
gi|294101893|ref|YP_003553751.1|  laqsia..........................................................
gi|294101841|ref|YP_003553699.1|  glg.............................................................
gi|294102070|ref|YP_003553928.1|  vegirkqatlaieeshvilfvidgfngpnwmde...............................
gi|294102221|ref|YP_003554079.1|  aenlwgieidaeeeakkymkaiqdkmlhivsaviveeikrqieiaymspgaeeaaifdkfielm
gi|294101356|ref|YP_003553214.1|  igylsqdlveiedtvllhylkkqagialvekelrateediaraakneeeyhsllkrhdhls...
gi|294101345|ref|YP_003553203.1|  vlesslaelshkkraqllsfvisgrpaiqgfsvfelvalgrhpytnwkgeledrdikavekalv
gi|294102145|ref|YP_003554003.1|  ekfirqmvagas....................................................
gi|294101756|ref|YP_003553614.1|  alvkaavrslenadlilyvvevddisispeddriie............................
gi|294102549|ref|YP_003554407.1|  rdithlpplkrrklglayipedriktglaplaslkdnallgyqykppflkrnffqnfrs.....
gi|294101372|ref|YP_003553230.1|  eealraatrtlrgelssfakdiynemltisssievgldfpeedipfienegvesalytlkqgle
gi|294101016|ref|YP_003552874.1|  lkvtyvssekfinefiqsiknnrtqefkskyrsvdilliddiqflgnkgssqeeffhtf.....
gi|294101780|ref|YP_003553638.1|  hnprstvgtvteiydylrllygrlgvpycpscgkavirysldeivdvifrnypdqrleilspqv
gi|294101686|ref|YP_003553544.1|  qvcgamaarg......................................................
gi|294102507|ref|YP_003554365.1|  ssarpdykpsleppfhivhptastvaicgggaslrpgeislahrgilfldeftefrrdllealr
gi|294101471|ref|YP_003553329.1|  ktkkknlrpyfqkihqdpgssfpqnrlirtifedffrwgyhpalssekewwnalgegmekasls
gi|294101845|ref|YP_003553703.1|  ialffcprtlqlpeeisseegnlflkrvftrngrgktfiqgklfplslfnevaapllriqsqfa
gi|294101553|ref|YP_003553411.1|  vglqgsgkttsavkiakriqnahnplvvacdlrrpaaieqlkvlaqqskvafygpsggtqdvik
gi|294101853|ref|YP_003553711.1|  hllvagttgsgksvfvnsciaglcycrkpeelrllmidpkrvelsiyehlphmlakpvtspkka
gi|294101780|ref|YP_003553638.1|  rnvvlvdqspigrtprsnpatytglftlirelfaelpeskirgyapgrfsfnvrggrceacsga
gi|294102079|ref|YP_003553937.1|  ikvslsdgcvyingadvtehirsprvdsivssyaalptvrrcllsiqreqaeegglvadgrdmg
gi|294101472|ref|YP_003553330.1|  kkqnllsvkekelkklwgrylflmpqepstalnpllsvfrqvrevfqhlrgmd...........
gi|294102235|ref|YP_003554093.1|  ideqvaseflikekpelai.............................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  erslleinavsakvselrdlveeaknlkilsgsaaiafvdeiyhfnksqqnallpsvekgdiil
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  vgmmgerlkekdcekgflldgfprtvpqaealdqllatmnls......................
gi|294101715|ref|YP_003553573.1|  wcgfplpakegtvvgnldnvfadigdeqsieqnlstfsahlkniihilseatrsslvlldelga
gi|294101925|ref|YP_003553783.1|  eyasafpsakvfrinapsnplyipfwlmnfdelafflvgakptddqrveyrllrelittfkken
gi|294101367|ref|YP_003553225.1|  tpiilndprsplsvgiasvsedrrgvgllleepiswnviftalqmqqkylkpvlgglfkirdee
gi|294101751|ref|YP_003553609.1|  lgylpgdlrekvepyvrplydafydlfsperflryidknvieiapla.................
gi|294101046|ref|YP_003552904.1|  etgdfkrneeapiicctqeiytlkytkephqkliidefhyifedpdrartyidgirgtapttsi
gi|294101779|ref|YP_003553637.1|  ayipssdtyiekdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfav
gi|294101226|ref|YP_003553084.1|  qvarrmvdegadlaiivldatale........................................
gi|294101892|ref|YP_003553750.1|  aargfkekekwaklieqyi.............................................
gi|294102315|ref|YP_003554173.1|  sedflpwinienataegfppseyaareaekwkkglagwgidgdrikkmresvsfsiytpgsnsg
gi|294102188|ref|YP_003554046.1|  sgtvdgerylalgpkdlmimptaknpvqaelvksgm............................
gi|294102320|ref|YP_003554178.1|  pnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylmvrrtraeieeyfsrd
gi|294102169|ref|YP_003554027.1|  rlsklgvpaiqinthggch.............................................
gi|294101254|ref|YP_003553112.1|  qppkqfiargvryipadrkgtglvpnmdikensilkkywnkpvargpmidwkavfshainlvkk
gi|294102077|ref|YP_003553935.1|  tvgfird.........................................................
gi|294102510|ref|YP_003554368.1|  qffssikq........................................................
gi|294101748|ref|YP_003553606.1|  slllqrgetlskwkqekgilatspggllspfltgegvfplrr......................
gi|294101141|ref|YP_003552999.1|  tsnyelqgmfdnpdprsekefltndrlfavglwqkrlfsatvdqflgfmrhdyrsscllpllad
gi|294101018|ref|YP_003552876.1|  divatvgekniiqcdgkrithgnvrslipalaflpgdlaivdgapsvrrqfldrlcallfplyv
gi|294101692|ref|YP_003553550.1|  ellgydvsfgllkgrgnyvcvrralelehegflsfgdsgaasiylsewlkktqtgdlselklps
gi|294101032|ref|YP_003552890.1|  arckgcgvcadncafgalnqfgthapvvnmqlchgcgvcelvcpqkaikdskasigimniknqe
gi|294101031|ref|YP_003552889.1|  dterctvcggcvgfcrfnalekanngitllpwkcegcggcalvcphqaismhsyeqgqywrgtt
gi|294101431|ref|YP_003553289.1|  idldllesqlakllkgeevrvpefdfikgkkfpgatlrlnkhdvliiegihgln..........
gi|294102167|ref|YP_003554025.1|  svvasivfsdmteyewvcdmihpfvriemerkvaslqgwviae.....................
gi|294101458|ref|YP_003553316.1|  qgdrrvgviwhtqgsgkslsmvfyagklvideelenptivvitdrndlddqlfstflkseellr
gi|294102320|ref|YP_003554178.1|  swpnvfsdfrvpadyesigrldnliergtekytniiideahrfrte..................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ikkvnklinpkietltkgdktyndpanqvkgtlftveyydhpslefrkhnskannryaikpyyg
gi|294101830|ref|YP_003553688.1|  llndlfsvvdslkgtiplvqvlfldssdeslvrrfettrrrhplgdh.................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  devfsaadfvdksmaaierimnrgkiplfvggtpfyyhalfegvltkd................
gi|294102787|ref|YP_003554645.1|  ggkqkgsliieslkgerfslvmngrnstfsgarngtsledllgyvdremyerifsvgledmqki
gi|294102032|ref|YP_003553890.1|  sdpsrplainlpagkgkemgsafeellselkiaiskafeksqyedakaqlvknfqeqvnglmee
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  dyidiydmtravedgttvkifyesriakldlpeemkpqidseyeeiteyqeysqkerlkskwar
gi|294102625|ref|YP_003554483.1|  ysinegltvgqtalwdiarriwnagehgwplgetwdilrepclagreiatsppadiftlnekgw
gi|294102478|ref|YP_003554336.1|  plllasrlphvpvavsrd..............................................
gi|294101874|ref|YP_003553732.1|  p...............................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  aittahnllaalldnhlhqgnplnidprrvvfrrvidlneralryvnvglggktngvpresgfd
gi|294102529|ref|YP_003554387.1|  aitsahnllsalidnhlhqgnplnidprrvvfrrvvdlneralrhvivglggkadgvpresgfd
gi|294102437|ref|YP_003554295.1|  rgigpcyvdkfnrcgiriedlfdpdilreklsfnlelknllltkvynaepvafddiyaqarawg
gi|294102168|ref|YP_003554026.1|  dlkldpkqidptnvldhiskaktegnhktlepvglegiehevyrkyhdelrrqnavdfddllil
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  addndiviaeiggtvgdiegqpfl........................................
gi|294101625|ref|YP_003553483.1|  vnkmdrvgadfy....................................................
gi|294101185|ref|YP_003553043.1|  gagaaegaidagnmlkpmlargelhcigattideyrkriekdaalarrfqpvl...........
gi|294102626|ref|YP_003554484.1|  lfwkeaeealdrwdgnwfakssshlwaqriaklfsdplfmdsvntfgpnatvelaksslalfas
gi|294101765|ref|YP_003553623.1|  feqrdlellekllsqkeglilvtgptgsgksttlhalikqvnaltlnvttiedpverfh.....
gi|294102479|ref|YP_003554337.1|  tfitslpegydtevgergvtlsggqrqrvaiarai.............................
gi|294101904|ref|YP_003553762.1|  erfphqlsggeqqrvalarvlvidprvllmdeplsnldaklri.....................
gi|294102557|ref|YP_003554415.1|  lesrqpsqlsggqqqrvalaraiimepalllfdeplsnldaklreqmr................
gi|294101807|ref|YP_003553665.1|  rtvmfvnladdpaierittprlaltaa.....................................
gi|294101806|ref|YP_003553664.1|  snmpvaareasi....................................................
gi|294102649|ref|YP_003554507.1|  dlsdkaqsypsqlsggqkq.............................................
gi|294101185|ref|YP_003553043.1|  ilfdeiekahhdvfnvllqilddgrvtdsqghvvdfkntviimtsnigaplllegitgdgqike
gi|294102868|ref|YP_003554726.1|  dqlsggeqqrvalarslvtepkvllldeplsnldaklrirmrr.....................
gi|294102500|ref|YP_003554358.1|  vdallprperktsmpdfmkifsgkeaeetppqeedtirestrnkvyallkagkldereveleva
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  vskl............................................................
gi|294101565|ref|YP_003553423.1|  vlfdeiekah......................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ngiffmnlasdsaverlltprmaltaaeyfaf................................
gi|294101061|ref|YP_003552919.1|  fadhyptqlsggqaqrvsiaralamdpdvmlfdeptsald........................
gi|294101048|ref|YP_003552906.1|  sslsggmrqrvgiaralvmdt...........................................
gi|294101977|ref|YP_003553835.1|  ylgmtlaeyfrdmgyntaimadstsrwaealr................................
gi|294101084|ref|YP_003552942.1|  rllekvglsehahkypatlsggqtqrgaiaralamnpkvm........................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  qtmdlvglakr.....................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  trksesasitrdvsgegvqqallkilegtlsnvppkggrkh.......................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  mdtvglaerlttsfpheldgg...........................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  rahemlalvgirperg................................................
gi|294101359|ref|YP_003553217.1|  tpvfislteegeahe.................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  kasemmelvgidpvrmsdyphqfs........................................
gi|294101376|ref|YP_003553234.1|  visqflaemsgieelkgvtvlatt........................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  rrflyppqlsggeqqrvaiaramanspaifiadeptgnldihtaedv.................
gi|294101577|ref|YP_003553435.1|  ipgyalsggerrrveiarclsimpdfllldep................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ksmkllqsvslaqdanv...............................................
gi|294102187|ref|YP_003554045.1|  desvsflrvatearyniivtggtgsgktttlnvlssfipnrerivtiedaaels..........
gi|294102332|ref|YP_003554190.1|  aldv............................................................
gi|294102831|ref|YP_003554689.1|  gllti...........................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  lryldemsggelqkvtiara............................................
gi|294102759|ref|YP_003554617.1|  rsl.............................................................
gi|294101055|ref|YP_003552913.1|  vglfeevkdslsmnatllsggqqqrlciaralavepeillldepcssldvkntq..........
gi|294101254|ref|YP_003553112.1|  vdpdakiwqlsigeqqrvai............................................
gi|294102760|ref|YP_003554618.1|  lktlgieeerillsrvrsglsggqr.......................................
gi|294101659|ref|YP_003553517.1|  mqnptyslsggekqrlavagalaldppclvldeptamld.........................
gi|294101172|ref|YP_003553030.1|  rdqyagtlsggeqqmlaigralmsrprlllldepslglapiiirdifkelr.............
gi|294102017|ref|YP_003553875.1|  deigrgtstydgmsiawavley..........................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  dasepttdqdkkmaaqviekgkglillinkwdtleaadklgdemr...................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  rsg.............................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  wsevkdnlkssglglsggqqqrlciaraiatepevllmdeptsaldpmatar............
gi|294101436|ref|YP_003553294.1|  eliyrdlgvidnrlsrlaakkrllpeeeeekkllercqaflmeekplrelglsedeq.......
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  rerawqkggtlsggeq................................................
gi|294101660|ref|YP_003553518.1|  evgipldfldrnpfqlsggekrrialasvlaaepaylvldeptagldatgrkdl..........
gi|294102549|ref|YP_003554407.1|  idplapvhslpvgiqqrveilkllyrkaeilifdeptavlspreieg.................
gi|294102841|ref|YP_003554699.1|  rndpm...........................................................
gi|294101272|ref|YP_003553130.1|  vsggmkqrcalirtlmfereivlldep.....................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  sgddiyklisvlsggeksrvallkllleetnllildep..........................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  widtplpvainrikttrghfdriesetdgfln................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  eqfafigqgevaeaihhrpqqrrsilealfgidqyrkkredanqklkfaseelarletlvselt
gi|294101367|ref|YP_003553225.1|  teemrqrgenaieklnvvispdtlvsempvghkqft............................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  esi.............................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  evnawhlsgrdfaklsdgesqrvliaralaqdtpillldeptafldlpr...............
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  dlldrc..........................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  rgkkgefknlfaqnrekgfmrvrvdgtiywleeeialdknkrhtievvidrlkvlddrkgrise
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  qpledgsivvsra...................................................
gi|294101471|ref|YP_003553329.1|  erllhrypcqlsggelqrfallrallfsplflvad.............................
gi|294101845|ref|YP_003553703.1|  qlelldsdrqrdildsyggeeiiclknelrsvfsnallkekelrsvekkqkevidryenansil
gi|294101553|ref|YP_003553411.1|  vakealayaedhlndviifd............................................
gi|294101853|ref|YP_003553711.1|  iqalawavremeqrydifakarvrnlagynekaipkdrlphivi....................
gi|294101780|ref|YP_003553638.1|  gsvkvsmlflpdvyvdc...............................................
gi|294102079|ref|YP_003553937.1|  tvvfp...........................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  vgt.............................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  gtdpqegaal......................................................
gi|294101925|ref|YP_003553783.1|  cklksgdvtqefitadspipfsarklwyemnwwlnasfestkkdeqkretkyeinkgdyenlig
gi|294101367|ref|YP_003553225.1|  airevtkkyidtleikctgdyqrvqelsggnqqkvclakafalhpkllfvseptrgidv.....
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  lvmsatfsqpgvigryletitersftvyesqervtdlvyvpkkpa...................
gi|294101779|ref|YP_003553637.1|  gekwdrrgfmerlidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideid
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ikvnvlgsfrcpsekiindhdlflekvqnttstllsllniesdplsgrehlliskifeqswrng
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ikeqglkfpkvakpvplfyelnekedfifnrtiehianqfkyarympmlyyknelnqlerqsqr
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ys..............................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  savvfdeihsfdqtlfsallgflrefnvpalcmtaslpinrldqlreaglkifpesiasfpdlk
gi|294101018|ref|YP_003552876.1|  rkmsdcrralrh....................................................
gi|294101692|ref|YP_003553550.1|  dfpifprvaaqvrgclghrcpyrdrcfiqkalkkaqnwdvivsnyhmyfayvmngkgtfpvdfd
gi|294101032|ref|YP_003552890.1|  sfwflegildigepnpvplihavlkkadslpfpqivdgppgnacpmvaaveqs...........
gi|294101031|ref|YP_003552889.1|  tygplwharlhageensgmlvarlkk......................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ntpvqaqdrvhlrellnnrtsggiifttiqkfapftn...........................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  knrgdtlpfcpviylglgrlfpfgefqndeairgvkgelpstyqdeiktfyedftg........
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  rplndrgiqsrffsagaglgtaslptflaslsnqekalyriqggarssaeinvflkkiqetkeq
gi|294102032|ref|YP_003553890.1|  vrawagekgfalkrtpqgfvnipmieettesgdvskrelqqeefeslseekqkelqgkseeisq
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  leaivgteqrikqiakdivehfekrdl.....................................
gi|294102625|ref|YP_003554483.1|  igflehaapergldsfkkmclfvktikkggtpveilsalyslaaenpswgkelslwamd.....
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  itvasevmailclsesikelkerlaqivvaytydgtavtagdlnaqgsmavvlkdalkpnlvqt
gi|294102529|ref|YP_003554387.1|  itvasevmailclsanikelkerlskivvgytyngtvvtagdlnahgsmaallkdalkpnlvqt
gi|294102437|ref|YP_003554295.1|  kalepyv.........................................................
gi|294102168|ref|YP_003554026.1|  plhllmvdeklreqeqsrldwilvdeyqdvnkpqyfllrrligtkgnimvvgdpdqsiygwrga
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  qgqtpkdlwqwgsdlfsrdqdavdtarltlfrrwedewhrflqpesgifynlnelggtgklcgn
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  dareavmkelrqafrpeflnrv..........................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  esasmgipilggagmdsmgmninemlsgllpkktkkrrmkvsdgkkllqaeeaeklidmesvar
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  srrdeiaamvtiaekarrlldeldekrrgyyfsrraflerelysfqsrihalerrknraaewet
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  qsfksispesnseaiwegrlerisksidehtkleqilarltggktgegiadsienlcleltqii
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  aeftshlttannqpphvsqhkdfysye.....................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  pvsghtlkqlpkasifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtry
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  kdvdlpmiingiqtppfaqigvmptdtfyppserfklal.........................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  nmgrfmkillvkrlessffafrntgqrflnsynmflkelddgfiyvskkysnkifellesddde
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ekasam..........................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  vlicdeahrmvdaarsissvrvswedlvrllrskgaataesflsnreeeqgvlrdelssvqeeg
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ikllqqqkdeylqkkeelektghqiesarknleairydlslmewvekarspwvemteaqrklee
gi|294102032|ref|YP_003553890.1|  rtldtlrkirdlekalkeeigkleaeicrsaitpylqdvkekygtteilckwidalaediisnf
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  lehvpafvhggpf...................................................
gi|294102529|ref|YP_003554387.1|  lehvpafvhggpfaniahgcnslqatkyglkladyfiteagfgadlgaekffdikcrignltps
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  dmtmilnfekdfpaakvvvldqnyrstgnilkaanaviisnerrrkknlwtardmge.......
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  vrnlitrwqqqpskenlphfiqslieglkgasgklaneiafhlkepvsqyrnrlikeepwitvf
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ealdkaqeegiifideidkv............................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  iwkeglsfyqslfnsyeqqkkvheerteslgfqretlrrqcfataltvksarerliaqkeekrh
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  spdtekgskyqelgnnalvflqklsqsltvllseqslsdlyaeqeeienklgtlrklkrlag..
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  dmemlaevgycsgienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdra
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  alqklidegkaeryssedfkdelrtdlehdrailmeikrlweqidrdpkllkfkkelstnat..
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  rklfellevsiadgvlipvrneelyrcgllvsshietalkmlrsieelcnekpydvddgplala
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  igevlffpdegllrfkkiheeegarereleelvfqcrnldkqlqafhipsiqkvleqkgairal
gi|294102032|ref|YP_003553890.1|  nifvaaakde......................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  avvivatvralkmhggvakneltgenlealskgipnlekhienmkrfg................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  tqgfdekeqayrscllgfsailwqlwdefrrrknrlsfddmiryamealehspsyaerfkeilv
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  veevlskvdeeatlargtsysltqnlhkkkeevsalwqklsnlrsslraerqrrqeygneyarv
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  rkttlvengfrlpscldnrplnwrefkkylrqvifisatpgdwerevstcvaeqii........
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  lawieevrlfshslqwclavghfpewaywregdalvseptlcsdkvsegilsqkaekiiaisat
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  aqnrnriekeeeiiqnlsldilsmkqrldrevreihqswtiddlesldlsfg............
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  de..............................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  egecvkilsrlqarsealdknekeleeaknkvfvaeketetykkefeythlsykkiierhgeiy
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  mtvegsfdfwkretgiiptdtyvlespfdlekqmkilvvdlglkviekgyd.............
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  vqcqrlatslsqlkknvdvlenqletvlenteqrlypepvrvilaaqklgklpiqiklaaeafk
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                 10          20        30          4
                                                                  |           |         |           
d2eyqa5                             .....................PPARRLAVKTFVRE..YDSMVVREAILREILR..GGQVYYLYN
gi|294102520|ref|YP_003554378.1|  .....................--------------..----------------..-------A-
gi|294102529|ref|YP_003554387.1|  .....................--------------..----------------..---------
gi|294102437|ref|YP_003554295.1|  .....................--------------..----------------..---------
gi|294102168|ref|YP_003554026.1|  .....................--------------..----------------..K--------
gi|294101779|ref|YP_003553637.1|  .....................-------LLGVTGS..GKTFTVANVLAQF---..DRPVLVLAH
gi|294102457|ref|YP_003554315.1|  .....................--------------..----------------..---------
gi|294101625|ref|YP_003553483.1|  .....................--------------..----------------..---------
gi|294101185|ref|YP_003553043.1|  .....................--------------..----------------..-----V---
gi|294102626|ref|YP_003554484.1|  .....................--------------..----------------..---------
gi|294101765|ref|YP_003553623.1|  .....................--------------..----------------..---------
gi|294102479|ref|YP_003554337.1|  .....................--------------..--------------I-..---------
gi|294101904|ref|YP_003553762.1|  .....................--------------..-----Y----------..---------
gi|294102557|ref|YP_003554415.1|  .....................--------------..----------------..---------
gi|294101807|ref|YP_003553665.1|  .....................--------------..----------------..---------
gi|294101806|ref|YP_003553664.1|  .....................--------------..----------------..---------
gi|294102649|ref|YP_003554507.1|  .....................--------------..----------------..---------
gi|294101185|ref|YP_003553043.1|  .....................--------------..----------------..-D-------
gi|294102868|ref|YP_003554726.1|  .....................--------------..----------------..---------
gi|294102500|ref|YP_003554358.1|  .....................--------------..----------------..---------
gi|294102409|ref|YP_003554267.1|  .....................-----------TGE..GKTLVATLAVVLNALS..GNGVHVVTV
gi|294102354|ref|YP_003554212.1|  .....................--------------..----------------..---------
gi|294101565|ref|YP_003553423.1|  .....................--------------..----------------..---------
gi|294101424|ref|YP_003553282.1|  .....................--------------..----------------..---------
gi|294101976|ref|YP_003553834.1|  .....................--------------..--------------E-..---------
gi|294101061|ref|YP_003552919.1|  .....................-------------P..----------------..---------
gi|294101048|ref|YP_003552906.1|  .....................--------------..------P---------..---------
gi|294101977|ref|YP_003553835.1|  .....................--------------..----------------..---------
gi|294101084|ref|YP_003552942.1|  .....................--------------..----------------..---------
gi|294101565|ref|YP_003553423.1|  .....................--------------..GEFEERMRKLLKELRE..TGDVIIFID
gi|294101786|ref|YP_003553644.1|  .....................--------------..----------------..---------
gi|294101493|ref|YP_003553351.1|  .....................--------------..----------------..---------
gi|294101884|ref|YP_003553742.1|  .....................--------------..----------------..---------
gi|294101894|ref|YP_003553752.1|  .....................--------------..----------------..---------
gi|294101778|ref|YP_003553636.1|  .....................--------------..----------------..---------
gi|294102313|ref|YP_003554171.1|  .....................--------------..----------------..---------
gi|294102640|ref|YP_003554498.1|  .....................--------------..----------------..---------
gi|294101376|ref|YP_003553234.1|  .....................--------------..----A-----------..---------
gi|294102641|ref|YP_003554499.1|  .....................--------------..----------------..---------
gi|294101359|ref|YP_003553217.1|  .....................---DITHEVYLVPT..RHKEEGLINVLLW-EK..PSRAIVFCH
gi|294102459|ref|YP_003554317.1|  .....................--------------..----------------..---------
gi|294101785|ref|YP_003553643.1|  .....................--------------..----------------..---------
gi|294101376|ref|YP_003553234.1|  .....................--------------..----------------..--------N
gi|294102074|ref|YP_003553932.1|  .....................--------------..----------------..---------
gi|294102442|ref|YP_003554300.1|  .....................--------------..----------------..---------
gi|294101577|ref|YP_003553435.1|  .....................--------------..----------------..---------
gi|294101171|ref|YP_003553029.1|  .....................--------------..----------------..---------
gi|294102413|ref|YP_003554271.1|  .....................--------------..----------------..---------
gi|294102187|ref|YP_003554045.1|  .....................--------------..----------------..---------
gi|294102332|ref|YP_003554190.1|  .....................--------------..----------------..---------
gi|294102831|ref|YP_003554689.1|  .....................--------------..----------------..---------
gi|294101321|ref|YP_003553179.1|  .....................--------------..----------------..---------
gi|294101626|ref|YP_003553484.1|  .....................--------------..----------------..---------
gi|294101069|ref|YP_003552927.1|  .....................--------------..---------L------..---------
gi|294102759|ref|YP_003554617.1|  .....................--------------..----------------..---------
gi|294101055|ref|YP_003552913.1|  .....................--------------..-----NIEMMLRALCQ..QYSIIIVTH
gi|294101254|ref|YP_003553112.1|  .....................--------------..----------LQMLYR..KAQVLIL--
gi|294102760|ref|YP_003554618.1|  .....................--------------..----------------..---------
gi|294101659|ref|YP_003553517.1|  .....................-------------P..QGRRDLLDVLKTLHAQ..GRTIIYITH
gi|294101172|ref|YP_003553030.1|  .....................--------------..----------------..---------
gi|294102017|ref|YP_003553875.1|  .....................--------------..----------LDHGCG..SKPKVLFAT
gi|294101748|ref|YP_003553606.1|  .....................HPMDRL-LVGDVGF..GKTEIAMRAAFKASEA..GKQVVVLVP
gi|294102409|ref|YP_003554267.1|  .....................-----PDVIYRTSL..EKFHAVAEEVEETYSN..GQPVLVGTT
gi|294102070|ref|YP_003553928.1|  .....................--------------..----------------..---------
gi|294102390|ref|YP_003554248.1|  .....................-PMHRL-LQGDVGS..GKTAVAVLALLQAVEG..GYQGAFMAP
gi|294101403|ref|YP_003553261.1|  .....................--------------..----------------..---------
gi|294101730|ref|YP_003553588.1|  .....................--------------..----------------..P--------
gi|294102602|ref|YP_003554460.1|  .....................--------------..-PMPQTRYVLMRALAM..GLRPIVFI-
gi|294102663|ref|YP_003554521.1|  .....................--------------..------IEELVRTLKE..RYTVIIVTH
gi|294101436|ref|YP_003553294.1|  .....................--------------..----------------..---------
gi|294102150|ref|YP_003554008.1|  .....................--------------..---------V------..---------
gi|294101607|ref|YP_003553465.1|  .....................--------------..----------------..----L----
gi|294102035|ref|YP_003553893.1|  .....................--------------..----------------..---------
gi|294102412|ref|YP_003554270.1|  .....................--------------..----------------..---------
gi|294101660|ref|YP_003553518.1|  .....................--------------..-------IKLLSKQKK..KGRGIIFV-
gi|294102549|ref|YP_003554407.1|  .....................--------------..------LFSIIREFRK..AGKTIIF--
gi|294102841|ref|YP_003554699.1|  .....................--------------..----------------..---------
gi|294101272|ref|YP_003553130.1|  .....................--------------..----------------..---------
gi|294101433|ref|YP_003553291.1|  .....................--------------..----------------..---------
gi|294101963|ref|YP_003553821.1|  .....................--------------..----------------..---------
gi|294101356|ref|YP_003553214.1|  .....................--------------..----------------..---------
gi|294102542|ref|YP_003554400.1|  .....................--------------..----------------..---------
gi|294101861|ref|YP_003553719.1|  .....................--------------..----------------..---------
gi|294102400|ref|YP_003554258.1|  .....................--------------..----------------..---------
gi|294102043|ref|YP_003553901.1|  .....................--------------..----------------..---------
gi|294101077|ref|YP_003552935.1|  .....................--------------..----------------..---------
gi|294102348|ref|YP_003554206.1|  .....................--------------..----------------..---------
gi|294102040|ref|YP_003553898.1|  .....................------------GS..GKTTTAAKLAEQFHRQ..GKKVILG--
gi|294101613|ref|YP_003553471.1|  ceeklaapleaylggrqfwlf--------------..----------------..-------V-
gi|294101367|ref|YP_003553225.1|  .....................---------E----..----------------..---------
gi|294101893|ref|YP_003553751.1|  .....................--------------..----------------..---------
gi|294101841|ref|YP_003553699.1|  .....................--------------..----------------..----IYFLR
gi|294102070|ref|YP_003553928.1|  .....................--------------..----------------..---------
gi|294102221|ref|YP_003554079.1|  .....................--------------..----------------..---------
gi|294101356|ref|YP_003553214.1|  .....................--------------..----------------..---------
gi|294101345|ref|YP_003553203.1|  .....................--------------..--KVELLSLLRQYAWKm.NKGVLMSVH
gi|294102145|ref|YP_003554003.1|  .....................--------------..----------------..---------
gi|294101756|ref|YP_003553614.1|  .....................--------------..---------ILQEV--..STPIFLVVN
gi|294102549|ref|YP_003554407.1|  .....................--------------..----------------..---------
gi|294101372|ref|YP_003553230.1|  .....................--------------..----------------..---------
gi|294101016|ref|YP_003552874.1|  .....................--------------..----------------..---------
gi|294101780|ref|YP_003553638.1|  .....................--------------..----------------..---------
gi|294101686|ref|YP_003553544.1|  .....................--------------..----------------..---------
gi|294102507|ref|YP_003554365.1|  .....................--------------..----------------..---------
gi|294101471|ref|YP_003553329.1|  .....................--------------..----------------..---------
gi|294101845|ref|YP_003553703.1|  .....................--------------..----------------..---------
gi|294101553|ref|YP_003553411.1|  .....................--------------..----------------..---------
gi|294101853|ref|YP_003553711.1|  .....................--------------..----------------..---------
gi|294101780|ref|YP_003553638.1|  .....................--------------..----------------..--------E
gi|294102079|ref|YP_003553937.1|  .....................--------------..----------------..---------
gi|294101472|ref|YP_003553330.1|  .....................--------------..----------------..---------
gi|294102235|ref|YP_003554093.1|  .....................---------TVVDA..SNLERSLYLVVQMLEA..GQPLIIALN
gi|294102390|ref|YP_003554248.1|  .....................-PPGRTPIQTRWLK..KKEEGRLWAFIRERCSa.RERIYWVCP
gi|294101443|ref|YP_003553301.1|  .....................--------------..----------------..---------
gi|294101748|ref|YP_003553606.1|  .....................PPYNRVPVLTMVGP..RKKNLIHRAVLQELNR..GGQVFFVSN
gi|294101649|ref|YP_003553507.1|  .....................--------------..----------------..---------
gi|294101715|ref|YP_003553573.1|  .....................--------------..----------------..---------
gi|294101925|ref|YP_003553783.1|  .....................--------------..-K--------------..---------
gi|294101367|ref|YP_003553225.1|  .....................--------------..GAKRVVLD--------..---------
gi|294101751|ref|YP_003553609.1|  .....................--------------..------------Y---..---------
gi|294101046|ref|YP_003552904.1|  .....................--------------..------------QLFS..VHDALVFVF
gi|294101779|ref|YP_003553637.1|  .....................RPTGVVDPEVVVSPatGQVDDLVDRLRGITAR..GERALVTTL
gi|294101226|ref|YP_003553084.1|  .....................--------------..----RNLYLAFQAMER..GIHTIVALN
gi|294101892|ref|YP_003553750.1|  .....................--------------..----------------..---------
gi|294102315|ref|YP_003554173.1|  .....................--------------..----------------..---------
gi|294102188|ref|YP_003554046.1|  .....................--------------..----------------..---------
gi|294102320|ref|YP_003554178.1|  .....................--------------..--------------LQ..KNHLIIFTE
gi|294102169|ref|YP_003554027.1|  .....................--------------..----------------..---------
gi|294101254|ref|YP_003553112.1|  .....................--------------..----------------..---------
gi|294102077|ref|YP_003553935.1|  .....................--------------..----------------..---------
gi|294102510|ref|YP_003554368.1|  .....................--------------..----------------..---------
gi|294101748|ref|YP_003553606.1|  .....................--------------..----------------..---------
gi|294101141|ref|YP_003552999.1|  .....................--------RYRVKQ..CKKEEALEEALKAYKN..GEKVLWVVN
gi|294101018|ref|YP_003552876.1|  .....................--------------..----------------..---------
gi|294101692|ref|YP_003553550.1|  .....................--------------..----ERVCRVVERLCNdnGGSSLVLLS
gi|294101032|ref|YP_003552890.1|  .....................--------------..----------------..---------
gi|294101031|ref|YP_003552889.1|  .....................--------------..----------------..---------
gi|294101431|ref|YP_003553289.1|  .....................--------------..----------------..---------
gi|294102167|ref|YP_003554025.1|  .....................--------------..----------------..---------
gi|294101458|ref|YP_003553316.1|  .....................--------------..----------------..---------
gi|294102320|ref|YP_003554178.1|  .....................--------------..----------------..---------
gi|294101940|ref|YP_003553798.1|  .....................-----------QGS..LKTSLALHGAVNFLQGnpERRVLFFSL
gi|294102120|ref|YP_003553978.1|  .....................--------------..--KTHLAIAMIQELTA..KGKSAVFVP
gi|294101791|ref|YP_003553649.1|  .....................--------------..----------------..---------
gi|294102136|ref|YP_003553994.1|  .....................--------------..----------------..---------
gi|294101830|ref|YP_003553688.1|  .....................--------------..----------------..---------
gi|294102042|ref|YP_003553900.1|  .....................--------------..----------------..---------
gi|294102015|ref|YP_003553873.1|  .....................--------------..----------------..---------
gi|294102787|ref|YP_003554645.1|  .....................--------------..----------------..---------
gi|294102032|ref|YP_003553890.1|  .....................--------------..----------------..---------
gi|294102010|ref|YP_003553868.1|  .....................-----------LGS..GKTEWVLNMALALLEA..GEKVT----
gi|294101586|ref|YP_003553444.1|  .....................--------------..----------------..---------
gi|294101458|ref|YP_003553316.1|  .....................--------------..-----------AQENE..GGKGMIVAM
gi|294102625|ref|YP_003554483.1|  .....................--------------..----------------..---------
gi|294102478|ref|YP_003554336.1|  .....................--------------..----------------..---------
gi|294101874|ref|YP_003553732.1|  .....................--------------..E---------------..---------
gi|294102071|ref|YP_003553929.1|  .....................--------------..---------------H..PGPAILLFP


                                    0                50                                       60    
                                    |                 |                                        |    
d2eyqa5                             DVENIQKA........AERLAELV....................P..EAR.........IAIGH
gi|294102520|ref|YP_003554378.1|  --------........--------....................-..---.........-----
gi|294102529|ref|YP_003554387.1|  --------........--------....................-..---.........-----
gi|294102437|ref|YP_003554295.1|  --------........--------....................-..---.........-----
gi|294102168|ref|YP_003554026.1|  --------........--------....................-..---.........-----
gi|294101779|ref|YP_003553637.1|  NKTLAAQL........YTEFKTFF....................P..HNA.........VHYFV
gi|294102457|ref|YP_003554315.1|  --------........--------....................-..---.........-----
gi|294101625|ref|YP_003553483.1|  --------........--------....................-..---.........-----
gi|294101185|ref|YP_003553043.1|  --------........--------....................-..---.........-----
gi|294102626|ref|YP_003554484.1|  --------........-------F....................-..---.........-----
gi|294101765|ref|YP_003553623.1|  --------........--------....................-..---.........-----
gi|294102479|ref|YP_003554337.1|  --------........--------....................-..---.........-----
gi|294101904|ref|YP_003553762.1|  --------........--------....................-..---.........-----
gi|294102557|ref|YP_003554415.1|  ------I-........--------....................-..---.........-----
gi|294101807|ref|YP_003553665.1|  --------........--------....................-..---.........-----
gi|294101806|ref|YP_003553664.1|  --YTAITM........AEYYRDM-....................-..GYS.........VALMA
gi|294102649|ref|YP_003554507.1|  --------........--------....................-..---.........-----
gi|294101185|ref|YP_003553043.1|  --------........--------....................-..---.........-----
gi|294102868|ref|YP_003554726.1|  --------........--E-----....................-..---.........-----
gi|294102500|ref|YP_003554358.1|  --------........--------....................-..---.........-----
gi|294102409|ref|YP_003554267.1|  NDYLAKRD........AEWMGPIY....................RflGLS.........VKCIY
gi|294102354|ref|YP_003554212.1|  --------........--------....................-..---.........-----
gi|294101565|ref|YP_003553423.1|  -----E--........--------....................-..---.........-----
gi|294101424|ref|YP_003553282.1|  -KKEAEDL........AIRLLERV....................Gl.GDK.........VYAKP
gi|294101976|ref|YP_003553834.1|  --------........--------....................-..---.........-----
gi|294101061|ref|YP_003552919.1|  --------........--------....................-..---.........-----
gi|294101048|ref|YP_003552906.1|  --------........--------....................-..---.........-----
gi|294101977|ref|YP_003553835.1|  --------........-----E--....................-..---.........-----
gi|294101084|ref|YP_003552942.1|  --------........--------....................-..---.........-----
gi|294101565|ref|YP_003553423.1|  EIHS----........--------....................-..---.........-----
gi|294101786|ref|YP_003553644.1|  --------........--------....................-..---.........-----
gi|294101493|ref|YP_003553351.1|  --------........--------....................-..---.........-----
gi|294101884|ref|YP_003553742.1|  --------........--------....................-..---.........-----
gi|294101894|ref|YP_003553752.1|  --------........--------....................-..---.........-----
gi|294101778|ref|YP_003553636.1|  -------H........--------....................-..---.........-----
gi|294102313|ref|YP_003554171.1|  --------........--------....................-..---.........-----
gi|294102640|ref|YP_003554498.1|  --------........--------....................-..---.........-----
gi|294101376|ref|YP_003553234.1|  --------........--------....................-..---.........-----
gi|294102641|ref|YP_003554499.1|  --------........--------....................-..---.........-----
gi|294101359|ref|YP_003553217.1|  TRAETVEL........TRRLHDE-....................-..NFQ.........AMCLH
gi|294102459|ref|YP_003554317.1|  --------........--------....................-..---.........-----
gi|294101785|ref|YP_003553643.1|  --------........--------....................-..---.........-----
gi|294101376|ref|YP_003553234.1|  --------........--------....................-..---.........-----
gi|294102074|ref|YP_003553932.1|  --------........--------....................-..---.........-----
gi|294102442|ref|YP_003554300.1|  --------........--------....................-..---.........-----
gi|294101577|ref|YP_003553435.1|  --------........--------....................-..---.........-----
gi|294101171|ref|YP_003553029.1|  --------........--------....................-..---.........-----
gi|294102413|ref|YP_003554271.1|  --------........--------....................-..---.........---L-
gi|294102187|ref|YP_003554045.1|  --------........--------....................-..---.........-----
gi|294102332|ref|YP_003554190.1|  --------........--------....................-..EHR.........AKAMP
gi|294102831|ref|YP_003554689.1|  --------........--------....................-..---.........-----
gi|294101321|ref|YP_003553179.1|  --------........--------....................-..---.........-----
gi|294101626|ref|YP_003553484.1|  --------........--------....................-..---.........-----
gi|294101069|ref|YP_003552927.1|  --------........--------....................-..---.........-----
gi|294102759|ref|YP_003554617.1|  --------........--------....................-..---.........-----
gi|294101055|ref|YP_003552913.1|  NLFQARRI........--------....................-..---.........-----
gi|294101254|ref|YP_003553112.1|  --------........--------....................-..---.........-----
gi|294102760|ref|YP_003554618.1|  --------........--------....................-..---.........-----
gi|294101659|ref|YP_003553517.1|  RLEETVH-........--------....................-..---.........-----
gi|294101172|ref|YP_003553030.1|  --------........--------....................-..---.........-----
gi|294102017|ref|YP_003553875.1|  HYHELVAL........EDHLNGL-....................-..---.........-----
gi|294101748|ref|YP_003553606.1|  TTILAQQH........YHTFRSRM....................A..GFPir.......VEVLS
gi|294102409|ref|YP_003554267.1|  SIENSERI........SKLLKAR-....................-..KIP.........HQVLN
gi|294102070|ref|YP_003553928.1|  --------........-----K--....................-..---.........-----
gi|294102390|ref|YP_003554248.1|  TEILAQQH........YYRLHSFL....................EplGVS.........VVLLI
gi|294101403|ref|YP_003553261.1|  --------........--------....................-..---.........-----
gi|294101730|ref|YP_003553588.1|  --------........--------....................-..---.........-----
gi|294102602|ref|YP_003554460.1|  --------........--------....................-..---.........-----
gi|294102663|ref|YP_003554521.1|  NMQQAARI........--------....................-..---.........-----
gi|294101436|ref|YP_003553294.1|  --------........--------....................-..---.........-----
gi|294102150|ref|YP_003554008.1|  --------........--------....................-..---.........-----
gi|294101607|ref|YP_003553465.1|  --------........--------....................-..---.........-----
gi|294102035|ref|YP_003553893.1|  --------........--------....................-..---.........-----
gi|294102412|ref|YP_003554270.1|  --------........--------....................-..---.........-----
gi|294101660|ref|YP_003553518.1|  --------........--------....................-..---.........-----
gi|294102549|ref|YP_003554407.1|  --------........--------....................-..---.........-----
gi|294102841|ref|YP_003554699.1|  --------........--------....................-..---.........-----
gi|294101272|ref|YP_003553130.1|  --------........--------....................-..---.........-----
gi|294101433|ref|YP_003553291.1|  --------........--------....................-..---.........-----
gi|294101963|ref|YP_003553821.1|  --------........--------....................-..---.........-----
gi|294101356|ref|YP_003553214.1|  --------........--------....................-..---.........-----
gi|294102542|ref|YP_003554400.1|  --------........--------....................-..---.........-----
gi|294101861|ref|YP_003553719.1|  --------........--------....................-..---.........-----
gi|294102400|ref|YP_003554258.1|  --------........--------....................-..---.........-----
gi|294102043|ref|YP_003553901.1|  -------Rvceg....YKELSKRF....................P..-HR.........IVRID
gi|294101077|ref|YP_003552935.1|  --------........--------....................-..---.........-----
gi|294102348|ref|YP_003554206.1|  --------........--------....................-..---.........-----
gi|294102040|ref|YP_003553898.1|  --------........--------....................-..---.........-----
gi|294101613|ref|YP_003553471.1|  --------........--------....................-..---.........-----
gi|294101367|ref|YP_003553225.1|  --------........--------....................-..---.........-----
gi|294101893|ref|YP_003553751.1|  --------........--------....................-..---.........-----
gi|294101841|ref|YP_003553699.1|  HIERTRVL........IHVL----....................-..---.........-----
gi|294102070|ref|YP_003553928.1|  ------D-........--------....................-..---.........-----
gi|294102221|ref|YP_003554079.1|  --------........--------....................-..---.........-----
gi|294101356|ref|YP_003553214.1|  --------........--------....................-..---.........-----
gi|294101345|ref|YP_003553203.1|  DIDLALRF........ADR-----....................-..---.........-----
gi|294102145|ref|YP_003554003.1|  --------........--------....................-..---.........-----
gi|294101756|ref|YP_003553614.1|  KIDQVQQS........E-------....................-..---.........-----
gi|294102549|ref|YP_003554407.1|  ----IREF........ALHLMERYnimaas..............E..NIQ.........AGTLS
gi|294101372|ref|YP_003553230.1|  --------........--------....................-..---.........-----
gi|294101016|ref|YP_003552874.1|  --------........--------....................-..---.........-----
gi|294101780|ref|YP_003553638.1|  --------........--------....................-..---.........-----
gi|294101686|ref|YP_003553544.1|  --------........--------....................-..---.........-----
gi|294102507|ref|YP_003554365.1|  --------........--------....................-..---.........-----
gi|294101471|ref|YP_003553329.1|  ------E-........--------....................-..---.........-----
gi|294101845|ref|YP_003553703.1|  -V------........--------....................-..---.........-----
gi|294101553|ref|YP_003553411.1|  --------........--------....................-..---.........-----
gi|294101853|ref|YP_003553711.1|  --------........--------....................-..---.........-----
gi|294101780|ref|YP_003553638.1|  --------........--------....................-..---.........-----
gi|294102079|ref|YP_003553937.1|  --------........--------....................-..---.........-----
gi|294101472|ref|YP_003553330.1|  --------........--------....................-..---.........-----
gi|294102235|ref|YP_003554093.1|  MADVAENKgirih...REKLEKAL....................-..---.........-----
gi|294102390|ref|YP_003554248.1|  LIDESETLsvasvterYEYLKKLF....................P..DLN.........VGLLH
gi|294101443|ref|YP_003553301.1|  --------........--------....................-..---.........-----
gi|294101748|ref|YP_003553606.1|  RINRLKGK........YEELKIMF....................P..EAR.........ISMAH
gi|294101649|ref|YP_003553507.1|  --------........--------....................-..---.........-----
gi|294101715|ref|YP_003553573.1|  --------........--------....................-..---.........-----
gi|294101925|ref|YP_003553783.1|  --------........--------....................-..---.........-----
gi|294101367|ref|YP_003553225.1|  --------........--------....................-..---.........-----
gi|294101751|ref|YP_003553609.1|  --------........--------....................-..---.........-----
gi|294101046|ref|YP_003552904.1|  SQRGTMDL........AYTIARTRrrlpreqrsrlyelatildvP..KVQmpllcg...IGIYH
gi|294101779|ref|YP_003553637.1|  TKKSSEDL........AEYLADL-....................-..QFK.........VKYIH
gi|294101226|ref|YP_003553084.1|  MVDE----........--------....................-..---.........-----
gi|294101892|ref|YP_003553750.1|  --------........--------....................-..---.........-----
gi|294102315|ref|YP_003554173.1|  --------........--------....................-..---.........-----
gi|294102188|ref|YP_003554046.1|  --------........--------....................-..---.........-----
gi|294102320|ref|YP_003554178.1|  SKETANYL........FEEINKEY....................P..-KK.........VLLFT
gi|294102169|ref|YP_003554027.1|  --------........--------....................-..---.........-----
gi|294101254|ref|YP_003553112.1|  --------........--------....................-..---.........-----
gi|294102077|ref|YP_003553935.1|  -------L........--------....................-..---.........-----
gi|294102510|ref|YP_003554368.1|  ----K---........--------....................-..---.........-----
gi|294101748|ref|YP_003553606.1|  --------........--------....................-..---.........-----
gi|294101141|ref|YP_003552999.1|  TVKRCQEI........AMELQESF....................-..AEN.........LLCYH
gi|294101018|ref|YP_003552876.1|  --------........------R-....................-..---.........-----
gi|294101692|ref|YP_003553550.1|  SMRLVKKV........GNWLKGS-....................-..QHP.........YTVYV
gi|294101032|ref|YP_003552890.1|  --------........--------....................-..---.........-----
gi|294101031|ref|YP_003552889.1|  --------........--------....................-..---.........-----
gi|294101431|ref|YP_003553289.1|  --------........--------....................-..---.........-----
gi|294102167|ref|YP_003554025.1|  --------........--------....................-..---.........-----
gi|294101458|ref|YP_003553316.1|  --------........-E------....................-..---.........-----
gi|294102320|ref|YP_003554178.1|  ----TTIT........YEKLAEIC....................R..GKR.........VILVT
gi|294101940|ref|YP_003553798.1|  DMSKEETT........QRLFMREL....................-..EVS.........TNALH
gi|294102120|ref|YP_003553978.1|  VVEILDEIragfdegtA-------....................-..---.........-----
gi|294101791|ref|YP_003553649.1|  --------........--------....................-..---.........-----
gi|294102136|ref|YP_003553994.1|  --------........--------....................-..---.........-----
gi|294101830|ref|YP_003553688.1|  --------........--------....................-..---.........-----
gi|294102042|ref|YP_003553900.1|  --------........--------....................-..---.........-----
gi|294102015|ref|YP_003553873.1|  -L------........--------....................-..---.........-----
gi|294102787|ref|YP_003554645.1|  --------........--------....................-..---.........-----
gi|294102032|ref|YP_003553890.1|  --------........--------....................-..---.........-----
gi|294102010|ref|YP_003553868.1|  --------........--------....................-..---.........-----
gi|294101586|ref|YP_003553444.1|  ---LCLLL........LKYLKEA-....................-..GIH.........VGYI-
gi|294101458|ref|YP_003553316.1|  SRRIAIDL........YKEIVALR....................P..DWHsddlmsgkiK----
gi|294102625|ref|YP_003554483.1|  --------........--------....................-..---.........-----
gi|294102478|ref|YP_003554336.1|  --------........--------....................-..---.........-----
gi|294101874|ref|YP_003553732.1|  --------........--------....................-..---.........-----
gi|294102071|ref|YP_003553929.1|  ERALAEFF........YSFLETE-....................-..GVE.........NIFLW


                                                        70                  80        90         100
                                                         |                   |         |           |
d2eyqa5                             GQ................MREREL....ERVMNDF......HHQRFNVLVCTT.II.ETGIDIP
gi|294102520|ref|YP_003554378.1|  --................------....-------......------------.--.-------
gi|294102529|ref|YP_003554387.1|  --................------....-------......----I-------.--.-------
gi|294102437|ref|YP_003554295.1|  A-................------....-------......------------.--.-------
gi|294102168|ref|YP_003554026.1|  --................------....-------......------------.--.-------
gi|294101779|ref|YP_003553637.1|  --................------....-------......------------.--.-------
gi|294102457|ref|YP_003554315.1|  --................------....-------......------------.--.-------
gi|294101625|ref|YP_003553483.1|  --................------....-------......------------.--.-------
gi|294101185|ref|YP_003553043.1|  --................------....-------......------------.--.-------
gi|294102626|ref|YP_003554484.1|  --................------....-------......------------.--.-------
gi|294101765|ref|YP_003553623.1|  E-................------....-------......------------.--.-------
gi|294102479|ref|YP_003554337.1|  --................------....-------......------------.--.-------
gi|294101904|ref|YP_003553762.1|  --................------....-------......------------.--.-------
gi|294102557|ref|YP_003554415.1|  --................------....-------......------------.--.-------
gi|294101807|ref|YP_003553665.1|  --................------....-------......------------.--.-------
gi|294101806|ref|YP_003553664.1|  DS................------....-------......------------.--.-------
gi|294102649|ref|YP_003554507.1|  --................------....-R-----......------------.--.-------
gi|294101185|ref|YP_003553043.1|  --................------....-------......------------.--.-------
gi|294102868|ref|YP_003554726.1|  --................------....-------......------------.--.-------
gi|294102500|ref|YP_003554358.1|  --................------....-------......------------.--.-------
gi|294102409|ref|YP_003554267.1|  AY................MDQKER....KEAY---......------------.--.-------
gi|294102354|ref|YP_003554212.1|  --................-D----....-------......------------.--.-------
gi|294101565|ref|YP_003553423.1|  --................------....-------......------------.--.-------
gi|294101424|ref|YP_003553282.1|  SQ................LSGGQQ....QRV----......------------.--.-------
gi|294101976|ref|YP_003553834.1|  --................------....-------......------------.--.-------
gi|294101061|ref|YP_003552919.1|  --................------....-------......------------.--.-------
gi|294101048|ref|YP_003552906.1|  --................------....-------......------------.--.-------
gi|294101977|ref|YP_003553835.1|  --................------....-------......------------.--.-------
gi|294101084|ref|YP_003552942.1|  --................------....-------......------------.--.-------
gi|294101565|ref|YP_003553423.1|  --................------....-------......------------.--.-------
gi|294101786|ref|YP_003553644.1|  --................------....-------......------------.--.-------
gi|294101493|ref|YP_003553351.1|  --................------....-------......------------.--.-------
gi|294101884|ref|YP_003553742.1|  --................------....-A-----......------------.--.-------
gi|294101894|ref|YP_003553752.1|  --................------....-------......------------.--.-------
gi|294101778|ref|YP_003553636.1|  --................------....-------......------------.--.-------
gi|294102313|ref|YP_003554171.1|  --................------....-------......------------.--.-------
gi|294102640|ref|YP_003554498.1|  --................------....-------......------------.--.-------
gi|294101376|ref|YP_003553234.1|  --................------....-------......------------.--.-------
gi|294102641|ref|YP_003554499.1|  --................------....-------......------------.--.-------
gi|294101359|ref|YP_003553217.1|  GE................MSQRER....NMALSQF......RSGRTPLLVATN.VA.ARGLDVE
gi|294102459|ref|YP_003554317.1|  --................------....-------......------------.--.-------
gi|294101785|ref|YP_003553643.1|  --................------....-------......------------.--.-------
gi|294101376|ref|YP_003553234.1|  --................------....-------......------------.--.-------
gi|294102074|ref|YP_003553932.1|  --................------....-------......------------.--.-------
gi|294102442|ref|YP_003554300.1|  --................------....-------......------------.--.-------
gi|294101577|ref|YP_003553435.1|  --................------....-------......------------.--.-----F-
gi|294101171|ref|YP_003553029.1|  --................------....-------......------------.--.-------
gi|294102413|ref|YP_003554271.1|  --................------....-------......------------.--.-------
gi|294102187|ref|YP_003554045.1|  --................------....-------......------------.--.-------
gi|294102332|ref|YP_003554190.1|  SQ................LSGGEQ....QR-----......------------.--.-------
gi|294102831|ref|YP_003554689.1|  --................------....-------......------------.--.-------
gi|294101321|ref|YP_003553179.1|  --................------....-------......------------.--.-------
gi|294101626|ref|YP_003553484.1|  --................------....-------......------------.--.-------
gi|294101069|ref|YP_003552927.1|  --................------....-------......------------.--.-------
gi|294102759|ref|YP_003554617.1|  --................------....-------......L-----------.--.-------
gi|294101055|ref|YP_003552913.1|  --................------....-------......------------.--.-------
gi|294101254|ref|YP_003553112.1|  --................------....-------......------------.--.-------
gi|294102760|ref|YP_003554618.1|  --................------....Q------......------------.--.-------
gi|294101659|ref|YP_003553517.1|  --................------....-------......------------.--.-------
gi|294101172|ref|YP_003553030.1|  --................------....-------......------------.--.-------
gi|294102017|ref|YP_003553875.1|  --................------....-------......------------.--.-------
gi|294101748|ref|YP_003553606.1|  RF................VSTSRQ....KRILEDT......KKGLVDILIGTQrLL.QKDIEFK
gi|294102409|ref|YP_003554267.1|  AK................YHEKEA....QIVAQAG......RFGA--VTVATN.MA.GRGTDI-
gi|294102070|ref|YP_003553928.1|  --................------....-------......------------.--.-------
gi|294102390|ref|YP_003554248.1|  GS................LKNRAR....ELTLQKI......STGEAHVVVGTH.ALfSDPVTFS
gi|294101403|ref|YP_003553261.1|  --................------....-------......---A--------.--.-------
gi|294101730|ref|YP_003553588.1|  --................------....-------......------------.--.-------
gi|294102602|ref|YP_003554460.1|  --................------....-------......------------.--.-------
gi|294102663|ref|YP_003554521.1|  --................------....-------......------------.--.-------
gi|294101436|ref|YP_003553294.1|  --................------....-------......------------.--.-------
gi|294102150|ref|YP_003554008.1|  --................------....-------......------------.--.-------
gi|294101607|ref|YP_003553465.1|  --................------....-------......------------.--.-------
gi|294102035|ref|YP_003553893.1|  --................------....-------......------------.--.-------
gi|294102412|ref|YP_003554270.1|  --................------....-------......------------.--.-------
gi|294101660|ref|YP_003553518.1|  --................------....-------......------------.--.-------
gi|294102549|ref|YP_003554407.1|  --................------....-------......------------.--.-------
gi|294102841|ref|YP_003554699.1|  GD................LSQGQR....QRVL---......------------.--.-------
gi|294101272|ref|YP_003553130.1|  --................------....-------......------------.--.-------
gi|294101433|ref|YP_003553291.1|  --................--G---....-------......------------.--.-------
gi|294101963|ref|YP_003553821.1|  --................------....-------......------------.--.-------
gi|294101356|ref|YP_003553214.1|  --................------....-------......------------.--.-------
gi|294102542|ref|YP_003554400.1|  --................------....-------......------------.--.-------
gi|294101861|ref|YP_003553719.1|  --................------....-------......------------.--.-------
gi|294102400|ref|YP_003554258.1|  --................------....-------......----F-------.--.-------
gi|294102043|ref|YP_003553901.1|  GS................QPTEEV....SA-----......------------.--.-------
gi|294101077|ref|YP_003552935.1|  --................----E-....-------......------------.--.-------
gi|294102348|ref|YP_003554206.1|  --................------....-------......------------.--.-------
gi|294102040|ref|YP_003553898.1|  --................------....-------......------------.--.-------
gi|294101613|ref|YP_003553471.1|  --................------....-------......------------.--.-------
gi|294101367|ref|YP_003553225.1|  --................------....-------......------------.--.-------
gi|294101893|ref|YP_003553751.1|  --................------....-------......------------.--.-------
gi|294101841|ref|YP_003553699.1|  --................------....-------......------------.--.-------
gi|294102070|ref|YP_003553928.1|  --................------....-------......------------.--.-------
gi|294102221|ref|YP_003554079.1|  --................------....-------......------------.--.-------
gi|294101356|ref|YP_003553214.1|  --................------....-------......------------.--.-------
gi|294101345|ref|YP_003553203.1|  --................------....-------......------------.--.-------
gi|294102145|ref|YP_003554003.1|  --................------....-------......------------.--.-------
gi|294101756|ref|YP_003553614.1|  --................------....-------......------------.--.-------
gi|294102549|ref|YP_003554407.1|  GG................---NMQ....RLVMARE......LEQQPDFLLVSQ.P-.TRGVDIG
gi|294101372|ref|YP_003553230.1|  --................------....-------......------------.--.-------
gi|294101016|ref|YP_003552874.1|  --................------....----NQL......HVSKKQIVICS-.--.-------
gi|294101780|ref|YP_003553638.1|  --................------....-------......------------.--.-------
gi|294101686|ref|YP_003553544.1|  --................------....-------......------------.--.-------
gi|294102507|ref|YP_003554365.1|  --................------....-------......------------.--.-------
gi|294101471|ref|YP_003553329.1|  --................------....-------......------------.--.-------
gi|294101845|ref|YP_003553703.1|  --................------....-------......------------.--.-------
gi|294101553|ref|YP_003553411.1|  --................------....-------......------------.--.-------
gi|294101853|ref|YP_003553711.1|  --................------....-------......------------.--.-------
gi|294101780|ref|YP_003553638.1|  --................------....-------......------------.--.-------
gi|294102079|ref|YP_003553937.1|  --................------....-------......------------.--.-------
gi|294101472|ref|YP_003553330.1|  --................------....-------......------------.--.-------
gi|294102235|ref|YP_003554093.1|  --................------....-------......------------.--.-------
gi|294102390|ref|YP_003554248.1|  GQ................LPSSEK....ETIMRSF......ARGHLDLIVSTT.VI.EVGVDVP
gi|294101443|ref|YP_003553301.1|  --................------....-------......-----------T.--.-------
gi|294101748|ref|YP_003553606.1|  GQ................MAEKDL....ERTMLDF......YNGNLDILVCTT.IV.ESGLDIP
gi|294101649|ref|YP_003553507.1|  --................------....-------......------------.--.-------
gi|294101715|ref|YP_003553573.1|  --................------....-------......------------.--.-------
gi|294101925|ref|YP_003553783.1|  --................------....-------......------------.--.-------
gi|294101367|ref|YP_003553225.1|  --................------....-------......------------.--.-------
gi|294101751|ref|YP_003553609.1|  --................------....-------......------------.--.-------
gi|294101046|ref|YP_003552904.1|  GS................MLPKEK....LLVESAF......RERILDVVVGTN.AL.ALGVNLP
gi|294101779|ref|YP_003553637.1|  SE................LNAFER....AELIRDL......RSGEVSILVGIN.LL.REGMDLP
gi|294101226|ref|YP_003553084.1|  --................------....-------......------------.--.-------
gi|294101892|ref|YP_003553750.1|  --................------....-------......------------.--.-------
gi|294102315|ref|YP_003554173.1|  --................------....-------......------------.--.-------
gi|294102188|ref|YP_003554046.1|  --................------....-------......------------.--.-------
gi|294102320|ref|YP_003554178.1|  GD................SKEAVR....DKVIANFdararsKKGDYRILISTE.VL.SEGVNLH
gi|294102169|ref|YP_003554027.1|  --................L-----....-------......------------.--.-------
gi|294101254|ref|YP_003553112.1|  --................------....-------......--------V---.--.-------
gi|294102077|ref|YP_003553935.1|  --................------....-------......------------.--.-------
gi|294102510|ref|YP_003554368.1|  --................------....-------......------------.--.-------
gi|294101748|ref|YP_003553606.1|  -E................------....-------......------------.--.-------
gi|294101141|ref|YP_003552999.1|  SR................FRLKDRqkwhKKLIEKF......RDPEPMIAITTQ.VC.EMSLDLS
gi|294101018|ref|YP_003552876.1|  --................------....-------......------------.--.-------
gi|294101692|ref|YP_003553550.1|  QN................--ELPR....TELLERF......RSDLSSVLIGSV.SF.REGVDVP
gi|294101032|ref|YP_003552890.1|  --................------....-------......------------.--.-------
gi|294101031|ref|YP_003552889.1|  --................---E--....-------......------------.--.-------
gi|294101431|ref|YP_003553289.1|  --................------....-------......------------.--.-------
gi|294102167|ref|YP_003554025.1|  --................------....-------......------------.--.-------
gi|294101458|ref|YP_003553316.1|  --................------....-------......------------.--.-------
gi|294102320|ref|YP_003554178.1|  A-................------....-------......------------.--.-------
gi|294101940|ref|YP_003553798.1|  G-................------....-------......------------.--.-------
gi|294102120|ref|YP_003553978.1|  --................------....-------......------------.--.-------
gi|294101791|ref|YP_003553649.1|  --................------....-------......------------.--.-------
gi|294102136|ref|YP_003553994.1|  --................------....-------......------------.--.-------
gi|294101830|ref|YP_003553688.1|  --................------....-------......------------.--.-------
gi|294102042|ref|YP_003553900.1|  --................------....-------......------------.--.-----V-
gi|294102015|ref|YP_003553873.1|  --................------....-------......------------.--.-------
gi|294102787|ref|YP_003554645.1|  --................------....-------......------------.--.-------
gi|294102032|ref|YP_003553890.1|  --................------....-S-----......------------.--.-------
gi|294102010|ref|YP_003553868.1|  --................------....-------......------------.--.-------
gi|294101586|ref|YP_003553444.1|  --................------....-------......------------.--.-------
gi|294101458|ref|YP_003553316.1|  -VvitgsssdpsdwqafiGSKADR....ETLAKRMkd....RNDELKLVIVRD.MW.LTGFDVP
gi|294102625|ref|YP_003554483.1|  --................------....-------......------------.--.-------
gi|294102478|ref|YP_003554336.1|  --................-----R....LKDVEAL......QKHNVELIVA--.--.-------
gi|294101874|ref|YP_003553732.1|  --................------....-------......------------.--.-------
gi|294102071|ref|YP_003553929.1|  PS................VGGKKL....WEAWNRT......RSGEHKIIIG--.--.-------


                                                    110                                             
                                                      |                                             
d2eyqa5                             T..ANTIII.......ERADHFG.........................................
gi|294102520|ref|YP_003554378.1|  -..------.......-------.........................................
gi|294102529|ref|YP_003554387.1|  -..------.......-------.........................................
gi|294102437|ref|YP_003554295.1|  -..------.......-------.........................................
gi|294102168|ref|YP_003554026.1|  -..------.......-------.........................................
gi|294101779|ref|YP_003553637.1|  -..------.......-------.........................................
gi|294102457|ref|YP_003554315.1|  -..------.......-------.........................................
gi|294101625|ref|YP_003553483.1|  -..------.......-------.........................................
gi|294101185|ref|YP_003553043.1|  -..------.......-------.........................................
gi|294102626|ref|YP_003554484.1|  -..------.......-------.........................................
gi|294101765|ref|YP_003553623.1|  -..------.......-------.........................................
gi|294102479|ref|YP_003554337.1|  -..------.......-------.........................................
gi|294101904|ref|YP_003553762.1|  -..------.......-------.........................................
gi|294102557|ref|YP_003554415.1|  -..------.......-------.........................................
gi|294101807|ref|YP_003553665.1|  -..------.......-------.........................................
gi|294101806|ref|YP_003553664.1|  -..------.......-------.........................................
gi|294102649|ref|YP_003554507.1|  -..------.......-------.........................................
gi|294101185|ref|YP_003553043.1|  -..------.......-------.........................................
gi|294102868|ref|YP_003554726.1|  -..------.......-------.........................................
gi|294102500|ref|YP_003554358.1|  -..------.......-------.........................................
gi|294102409|ref|YP_003554267.1|  -..------.......-------.........................................
gi|294102354|ref|YP_003554212.1|  -..------.......-------.........................................
gi|294101565|ref|YP_003553423.1|  -..------.......-------.........................................
gi|294101424|ref|YP_003553282.1|  -..------.......-------.........................................
gi|294101976|ref|YP_003553834.1|  -..------.......-------.........................................
gi|294101061|ref|YP_003552919.1|  -..------.......-------.........................................
gi|294101048|ref|YP_003552906.1|  -..------.......-------.........................................
gi|294101977|ref|YP_003553835.1|  -..------.......-------.........................................
gi|294101084|ref|YP_003552942.1|  -..------.......-------.........................................
gi|294101565|ref|YP_003553423.1|  -..------.......-------.........................................
gi|294101786|ref|YP_003553644.1|  -..------.......-----F-.........................................
gi|294101493|ref|YP_003553351.1|  -..------.......-------.........................................
gi|294101884|ref|YP_003553742.1|  -..------.......-------.........................................
gi|294101894|ref|YP_003553752.1|  -..------.......-------.........................................
gi|294101778|ref|YP_003553636.1|  -..------.......-------.........................................
gi|294102313|ref|YP_003554171.1|  -..------.......-------.........................................
gi|294102640|ref|YP_003554498.1|  -..------.......-------.........................................
gi|294101376|ref|YP_003553234.1|  -..------.......-------.........................................
gi|294102641|ref|YP_003554499.1|  -..------.......-------.........................................
gi|294101359|ref|YP_003553217.1|  G..VSHVIQ.......MGLPDNR.........................................
gi|294102459|ref|YP_003554317.1|  -..------.......-------.........................................
gi|294101785|ref|YP_003553643.1|  -..------.......-------.........................................
gi|294101376|ref|YP_003553234.1|  -..------.......-------.........................................
gi|294102074|ref|YP_003553932.1|  -..------.......-------.........................................
gi|294102442|ref|YP_003554300.1|  -..------.......-------.........................................
gi|294101577|ref|YP_003553435.1|  -..------.......-------.........................................
gi|294101171|ref|YP_003553029.1|  -..------.......-------.........................................
gi|294102413|ref|YP_003554271.1|  -..------.......-------.........................................
gi|294102187|ref|YP_003554045.1|  -..------.......-------.........................................
gi|294102332|ref|YP_003554190.1|  -..------.......-------.........................................
gi|294102831|ref|YP_003554689.1|  -..------.......-------.........................................
gi|294101321|ref|YP_003553179.1|  -..------.......-------.........................................
gi|294101626|ref|YP_003553484.1|  -..------.......-------.........................................
gi|294101069|ref|YP_003552927.1|  -..------.......-------.........................................
gi|294102759|ref|YP_003554617.1|  -..------.......-------.........................................
gi|294101055|ref|YP_003552913.1|  -..------.......-------.........................................
gi|294101254|ref|YP_003553112.1|  -..------.......-------.........................................
gi|294102760|ref|YP_003554618.1|  -..------.......-------.........................................
gi|294101659|ref|YP_003553517.1|  -..------.......-------.........................................
gi|294101172|ref|YP_003553030.1|  -..------.......-------.........................................
gi|294102017|ref|YP_003553875.1|  -..------.......-------.........................................
gi|294101748|ref|YP_003553606.1|  D..LGLLII.......DEEHRFG.........................................
gi|294102409|ref|YP_003554267.1|  -..----VL.......GGNPDFLaketlrkegnvedldpskyqqlleeyrqicakerdevldkg
gi|294102070|ref|YP_003553928.1|  -..------.......-------.........................................
gi|294102390|ref|YP_003554248.1|  N..LGFAVI.......DEQHRFG.........................................
gi|294101403|ref|YP_003553261.1|  -..------.......-------.........................................
gi|294101730|ref|YP_003553588.1|  -..------.......-------.........................................
gi|294102602|ref|YP_003554460.1|  -..------.......-------.........................................
gi|294102663|ref|YP_003554521.1|  -..------.......-------.........................................
gi|294101436|ref|YP_003553294.1|  -..------.......-------.........................................
gi|294102150|ref|YP_003554008.1|  -..------.......-------.........................................
gi|294101607|ref|YP_003553465.1|  -..------.......-------.........................................
gi|294102035|ref|YP_003553893.1|  -..------.......-------.........................................
gi|294102412|ref|YP_003554270.1|  -..------.......-------.........................................
gi|294101660|ref|YP_003553518.1|  -..------.......-------.........................................
gi|294102549|ref|YP_003554407.1|  -..------.......-------.........................................
gi|294102841|ref|YP_003554699.1|  -..------.......-------.........................................
gi|294101272|ref|YP_003553130.1|  -..------.......----L--.........................................
gi|294101433|ref|YP_003553291.1|  -..------.......-------.........................................
gi|294101963|ref|YP_003553821.1|  -..------.......-------.........................................
gi|294101356|ref|YP_003553214.1|  -..------.......-------.........................................
gi|294102542|ref|YP_003554400.1|  -..------.......-------.........................................
gi|294101861|ref|YP_003553719.1|  -..----F-.......-------.........................................
gi|294102400|ref|YP_003554258.1|  -..------.......-------.........................................
gi|294102043|ref|YP_003553901.1|  -..------.......-------.........................................
gi|294101077|ref|YP_003552935.1|  -..------.......-------.........................................
gi|294102348|ref|YP_003554206.1|  -..------.......-------.........................................
gi|294102040|ref|YP_003553898.1|  -..------.......-------.........................................
gi|294101613|ref|YP_003553471.1|  -..------.......-------.........................................
gi|294101367|ref|YP_003553225.1|  -..------.......-------.........................................
gi|294101893|ref|YP_003553751.1|  -..------.......-------.........................................
gi|294101841|ref|YP_003553699.1|  -..------.......-------.........................................
gi|294102070|ref|YP_003553928.1|  -..------.......-------.........................................
gi|294102221|ref|YP_003554079.1|  -..------.......-------.........................................
gi|294101356|ref|YP_003553214.1|  -..------.......-------.........................................
gi|294101345|ref|YP_003553203.1|  -..------.......-------.........................................
gi|294102145|ref|YP_003554003.1|  -..------.......-------.........................................
gi|294101756|ref|YP_003553614.1|  -..------.......-------.........................................
gi|294102549|ref|YP_003554407.1|  G..ISFIH-.......-------.........................................
gi|294101372|ref|YP_003553230.1|  -..------.......-------.........................................
gi|294101016|ref|YP_003552874.1|  -..------.......-------.........................................
gi|294101780|ref|YP_003553638.1|  -..------.......-------.........................................
gi|294101686|ref|YP_003553544.1|  -..------.......-------.........................................
gi|294102507|ref|YP_003554365.1|  -..------.......-------.........................................
gi|294101471|ref|YP_003553329.1|  -..------.......-------.........................................
gi|294101845|ref|YP_003553703.1|  -..------.......-------.........................................
gi|294101553|ref|YP_003553411.1|  -..------.......--T----.........................................
gi|294101853|ref|YP_003553711.1|  -..-----I.......-------.........................................
gi|294101780|ref|YP_003553638.1|  -..------.......-------.........................................
gi|294102079|ref|YP_003553937.1|  -..------.......-D-----.........................................
gi|294101472|ref|YP_003553330.1|  -..------.......-------.........................................
gi|294102235|ref|YP_003554093.1|  -..------.......-------.........................................
gi|294102390|ref|YP_003554248.1|  Q..ATVMVI.......EDADRFG.........................................
gi|294101443|ref|YP_003553301.1|  -..------.......-------.........................................
gi|294101748|ref|YP_003553606.1|  R..ANTLIV.......DDAQELG.........................................
gi|294101649|ref|YP_003553507.1|  -..LDAVIL.......LDVDDEV.........................................
gi|294101715|ref|YP_003553573.1|  -..------.......-------.........................................
gi|294101925|ref|YP_003553783.1|  -..------.......-------.........................................
gi|294101367|ref|YP_003553225.1|  -..------.......-------.........................................
gi|294101751|ref|YP_003553609.1|  -..------.......-------.........................................
gi|294101046|ref|YP_003552904.1|  -..AESVIFaqlvqfhDNAPISK.........................................
gi|294101779|ref|YP_003553637.1|  E..VSLVAI.......LDADREGflrs.....................................
gi|294101226|ref|YP_003553084.1|  -..------.......-------.........................................
gi|294101892|ref|YP_003553750.1|  -..------.......-------.........................................
gi|294102315|ref|YP_003554173.1|  -..------.......-------.........................................
gi|294102188|ref|YP_003554046.1|  -..------.......-------.........................................
gi|294102320|ref|YP_003554178.1|  R..SNVVVN.......YDIPWNP.........................................
gi|294102169|ref|YP_003554027.1|  -..------.......-------.........................................
gi|294101254|ref|YP_003553112.1|  -..------.......-------.........................................
gi|294102077|ref|YP_003553935.1|  -..------.......-------.........................................
gi|294102510|ref|YP_003554368.1|  -..------.......-------.........................................
gi|294101748|ref|YP_003553606.1|  -..------.......-------.........................................
gi|294101141|ref|YP_003552999.1|  -..ASLLI-.......--SEFAP.........................................
gi|294101018|ref|YP_003552876.1|  -..------.......-------.........................................
gi|294101692|ref|YP_003553550.1|  GegLTQVII.......DRIPFPHpkdpvvqsrnelegrkafvtvilpqa...............
gi|294101032|ref|YP_003552890.1|  -..------.......-------.........................................
gi|294101031|ref|YP_003552889.1|  -..------.......-------.........................................
gi|294101431|ref|YP_003553289.1|  -..------.......-------.........................................
gi|294102167|ref|YP_003554025.1|  -..------.......-------.........................................
gi|294101458|ref|YP_003553316.1|  -..------.......-------.........................................
gi|294102320|ref|YP_003554178.1|  -..------.......-------.........................................
gi|294101940|ref|YP_003553798.1|  -..------.......-------.........................................
gi|294102120|ref|YP_003553978.1|  -..------.......-------.........................................
gi|294101791|ref|YP_003553649.1|  -..------.......-------.........................................
gi|294102136|ref|YP_003553994.1|  -..------.......-------.........................................
gi|294101830|ref|YP_003553688.1|  -..------.......-------.........................................
gi|294102042|ref|YP_003553900.1|  -..------.......-------.........................................
gi|294102015|ref|YP_003553873.1|  -..------.......-------.........................................
gi|294102787|ref|YP_003554645.1|  -..------.......-------.........................................
gi|294102032|ref|YP_003553890.1|  -..------.......-------.........................................
gi|294102010|ref|YP_003553868.1|  -..------.......-------.........................................
gi|294101586|ref|YP_003553444.1|  -..------.......-------.........................................
gi|294101458|ref|YP_003553316.1|  S..MHSMY-.......VDKPMSG.........................................
gi|294102625|ref|YP_003554483.1|  -..------.......-------.........................................
gi|294102478|ref|YP_003554336.1|  -..------.......-------.........................................
gi|294101874|ref|YP_003553732.1|  -..------.......-------.........................................
gi|294102071|ref|YP_003553929.1|  -..------.......-------.........................................


                                                   120       130         140          150       160 
                                                     |         |           |            |         | 
d2eyqa5                             ............LAQLHQLRGRVGRSHHQ.AYAWLLTP.HPKAMTTDAQ...KRLEAIASLEDL
gi|294102520|ref|YP_003554378.1|  ............-----------------.--------.----------...------------
gi|294102529|ref|YP_003554387.1|  ............-----------------.--------.----------...------------
gi|294102437|ref|YP_003554295.1|  ............-----------------.--------.----------...------------
gi|294102168|ref|YP_003554026.1|  ............-----------------.--------.----------...------------
gi|294101779|ref|YP_003553637.1|  ............-----------------.--------.----------...------------
gi|294102457|ref|YP_003554315.1|  ............EAIR-QMATRVGRQNVL.YCHVTLVP.Y---------...------------
gi|294101625|ref|YP_003553483.1|  ............-----------------.--------.----------...------------
gi|294101185|ref|YP_003553043.1|  ............-----------------.--------.----------...------------
gi|294102626|ref|YP_003554484.1|  ............-----------------.--------.----------...------------
gi|294101765|ref|YP_003553623.1|  ............-----------------.--------.----------...------------
gi|294102479|ref|YP_003554337.1|  ............-----------------.--------.----------...------------
gi|294101904|ref|YP_003553762.1|  ............-----------------.--------.----------...------------
gi|294102557|ref|YP_003554415.1|  ............-----------------.--------.----------...------------
gi|294101807|ref|YP_003553665.1|  ............-----------------.--------.----------...----------E-
gi|294101806|ref|YP_003553664.1|  ............-----------------.--------.----------...------------
gi|294102649|ref|YP_003554507.1|  ............-----------------.--------.----------...------------
gi|294101185|ref|YP_003553043.1|  ............-----------------.--------.----------...------------
gi|294102868|ref|YP_003554726.1|  ............-----------------.--------.----------...------------
gi|294102500|ref|YP_003554358.1|  ............-----------------.--------.-----V----...------------
gi|294102409|ref|YP_003554267.1|  ............-----------------.--------.----------...------------
gi|294102354|ref|YP_003554212.1|  ............-----------------.--------.----------...------------
gi|294101565|ref|YP_003553423.1|  ............-----------------.--------.----------...------------
gi|294101424|ref|YP_003553282.1|  ............-----------------.--------.----------...------------
gi|294101976|ref|YP_003553834.1|  ............-----------------.--------.----------...------------
gi|294101061|ref|YP_003552919.1|  ............-----------------.--------.----------...------------
gi|294101048|ref|YP_003552906.1|  ............-----------------.--------.----------...------------
gi|294101977|ref|YP_003553835.1|  ............-----------------.--------.----------...------------
gi|294101084|ref|YP_003552942.1|  ............-----------------.-----L--.----------...------------
gi|294101565|ref|YP_003553423.1|  ............-----------------.--------.----------...------------
gi|294101786|ref|YP_003553644.1|  ............-----------------.--------.----------...------------
gi|294101493|ref|YP_003553351.1|  ............-----------------.--------.----------...------------
gi|294101884|ref|YP_003553742.1|  ............-----------------.--------.----------...------------
gi|294101894|ref|YP_003553752.1|  ............-----------------.--------.----------...------------
gi|294101778|ref|YP_003553636.1|  ............-----------------.--------.----------...------------
gi|294102313|ref|YP_003554171.1|  ............-----------------.--------.----------...------------
gi|294102640|ref|YP_003554498.1|  ............------------R----.--------.----------...------------
gi|294101376|ref|YP_003553234.1|  ............-----------------.--------.----------...------------
gi|294102641|ref|YP_003554499.1|  ............K----------------.--------.----------...------------
gi|294101359|ref|YP_003553217.1|  ............ETFVHRS-GRTGRAGHE.GRNLLVLS.PKE-------...------------
gi|294102459|ref|YP_003554317.1|  ............-----------------.--------.----------...-----------S
gi|294101785|ref|YP_003553643.1|  ............--------G--------.--------.----------...------------
gi|294101376|ref|YP_003553234.1|  ............-----------------.--------.----------...------------
gi|294102074|ref|YP_003553932.1|  ............----------------D.GVDYRFLS.EEEFKKLVEE...KKFLEWAVVH--
gi|294102442|ref|YP_003554300.1|  ............-----------------.--------.----------...--M---------
gi|294101577|ref|YP_003553435.1|  ............-----------------.--------.----------...------------
gi|294101171|ref|YP_003553029.1|  ............-----------------.--------.----------...-------R----
gi|294102413|ref|YP_003554271.1|  ............-----------------.--------.----------...------------
gi|294102187|ref|YP_003554045.1|  ............-----------------.--------.----------...-------M----
gi|294102332|ref|YP_003554190.1|  ............-----------------.--------.----------...------------
gi|294102831|ref|YP_003554689.1|  ............-----------------.--------.----------...---N--------
gi|294101321|ref|YP_003553179.1|  ............-----------------.--------.----------...-V----------
gi|294101626|ref|YP_003553484.1|  ............-----------------.--------.----------...-V----------
gi|294101069|ref|YP_003552927.1|  ............-----------------.--------.----------...------------
gi|294102759|ref|YP_003554617.1|  ............-----------------.--------.----------...------------
gi|294101055|ref|YP_003552913.1|  ............-----------------.--------.----------...------------
gi|294101254|ref|YP_003553112.1|  ............-----------------.--------.----------...------------
gi|294102760|ref|YP_003554618.1|  ............-----------------.--------.----------...------------
gi|294101659|ref|YP_003553517.1|  ............-----------------.--------.----------...------------
gi|294101172|ref|YP_003553030.1|  ............------------R----.--------.----------...------------
gi|294102017|ref|YP_003553875.1|  ............-----------------.--------.----------...------------
gi|294101748|ref|YP_003553606.1|  ............VM---------------.--------.----------...------------
gi|294102409|ref|YP_003554267.1|  glkiigterhesRRIDNQLRGRSGRQGDP.GSSRFYLSlEDDLLRLFGS...ERIQGIMEKLGM
gi|294102070|ref|YP_003553928.1|  ............-----------------.--------.----------...------------
gi|294102390|ref|YP_003554248.1|  ............VLQ--------------.--------.----------...------------
gi|294101403|ref|YP_003553261.1|  ............-----------------.--------.----------...------------
gi|294101730|ref|YP_003553588.1|  ............-----------------.--------.----------...------------
gi|294102602|ref|YP_003554460.1|  ............-----------------.--------.----------...------------
gi|294102663|ref|YP_003554521.1|  ............-----------------.--------.----------...------------
gi|294101436|ref|YP_003553294.1|  ............-----------------.--------.----------...------------
gi|294102150|ref|YP_003554008.1|  ............-----------------.--------.----------...------------
gi|294101607|ref|YP_003553465.1|  ............-----------------.--------.----------...------------
gi|294102035|ref|YP_003553893.1|  ............-----------------.--------.----L-----...------------
gi|294102412|ref|YP_003554270.1|  ............-----------------.--------.----------...------------
gi|294101660|ref|YP_003553518.1|  ............-----------------.--------.----------...------------
gi|294102549|ref|YP_003554407.1|  ............-----------------.--------.----------...------------
gi|294102841|ref|YP_003554699.1|  ............-----------------.--------.----------...------------
gi|294101272|ref|YP_003553130.1|  ............-----------------.--------.----------...------------
gi|294101433|ref|YP_003553291.1|  ............-----------------.--------.----------...------------
gi|294101963|ref|YP_003553821.1|  ............-------------AQAT.DIAILVVA.ADDGLMP---...------------
gi|294101356|ref|YP_003553214.1|  ............-----------------.--------.----------...------------
gi|294102542|ref|YP_003554400.1|  ............-----------------.--------.----------...E-----------
gi|294101861|ref|YP_003553719.1|  ............-----------------.--------.----------...------------
gi|294102400|ref|YP_003554258.1|  ............-----------------.--------.----------...------------
gi|294102043|ref|YP_003553901.1|  ............-----------------.--------.----------...------------
gi|294101077|ref|YP_003552935.1|  ............-----------------.--------.----------...------------
gi|294102348|ref|YP_003554206.1|  ............-----------------.--------.----------...------------
gi|294102040|ref|YP_003553898.1|  ............-----------------.--------.----------...------------
gi|294101613|ref|YP_003553471.1|  ............-----------------.--------.----------...------------
gi|294101367|ref|YP_003553225.1|  ............-----------------.--------.----------...------------
gi|294101893|ref|YP_003553751.1|  ............---------R-------.--------.----------...------------
gi|294101841|ref|YP_003553699.1|  ............-----------------.--------.----------...------------
gi|294102070|ref|YP_003553928.1|  ............-----------------.--------.----------...------------
gi|294102221|ref|YP_003554079.1|  ............--------------GNP.YDVIVFDT.APTGHTLRLI...TLPEILGIWIEH
gi|294101356|ref|YP_003553214.1|  ............-----------------.--------.----------...-------H----
gi|294101345|ref|YP_003553203.1|  ............-----------------.--------.----------...------------
gi|294102145|ref|YP_003554003.1|  ............-----------------.G-------.----------...------------
gi|294101756|ref|YP_003553614.1|  ............-----------------.--------.----------...------------
gi|294102549|ref|YP_003554407.1|  ............-----------------.--------.----------...------------
gi|294101372|ref|YP_003553230.1|  ............-----------------.--------.----------...------------
gi|294101016|ref|YP_003552874.1|  ............-----------------.--------.----------...------------
gi|294101780|ref|YP_003553638.1|  ............-----------------.--------.----------...------------
gi|294101686|ref|YP_003553544.1|  ............-----------------.-ERVLYIS.GEESASQVAL...R-----------
gi|294102507|ref|YP_003554365.1|  ............----------A------.--------.----------...------------
gi|294101471|ref|YP_003553329.1|  ............-----------------.--------.----------...------------
gi|294101845|ref|YP_003553703.1|  ............-----------------.--------.----------...------------
gi|294101553|ref|YP_003553411.1|  ............-----------------.--------.----------...------------
gi|294101853|ref|YP_003553711.1|  ............-----------------.--------.----------...------------
gi|294101780|ref|YP_003553638.1|  ............-----------------.--------.----------...------------
gi|294102079|ref|YP_003553937.1|  ............-----------------.--------.----------...------------
gi|294101472|ref|YP_003553330.1|  ............-----------------.--------.----------...------------
gi|294102235|ref|YP_003554093.1|  ............-----------------.--------.----------...------------
gi|294102390|ref|YP_003554248.1|  ............LSQLHQLRGRVGRGGNQ.SYCVLLSN.PTTRE---GV...ERLKVMCATTD-
gi|294101443|ref|YP_003553301.1|  ............-----------------.--------.----------...------------
gi|294101748|ref|YP_003553606.1|  ............LAQMYQLRGRVGRREEG.AYAYFLYP.ETMPLQKETM...ERFEAISAFSDI
gi|294101649|ref|YP_003553507.1|  ............-----------------.--------.----------...------------
gi|294101715|ref|YP_003553573.1|  ............-----------------.----G---.----------...------------
gi|294101925|ref|YP_003553783.1|  ............-----------------.--------.----------...------------
gi|294101367|ref|YP_003553225.1|  ............-----------------.--------.----------...------------
gi|294101751|ref|YP_003553609.1|  ............-----------------.--------.----------...------------
gi|294101046|ref|YP_003552904.1|  ............NEFL-QMAGRAGRKGLF.DTGY----.----------...------------
gi|294101779|ref|YP_003553637.1|  ............HRSLIQIMGRAAR-NTR.GQVVLYAD.VETESIRTSVqetRRRREIQMLFNE
gi|294101226|ref|YP_003553084.1|  ............-----------------.--------.----------...------------
gi|294101892|ref|YP_003553750.1|  ............-----------------.--------.----------...----TQRETL--
gi|294102315|ref|YP_003554173.1|  ............-----------------.--------.--------A-...------------
gi|294102188|ref|YP_003554046.1|  ............-----------------.--------.----------...------------
gi|294102320|ref|YP_003554178.1|  ............TRMM-QRVGRINRVDTP.FDVIHTFN.----------...------------
gi|294102169|ref|YP_003554027.1|  ............-----------------.--------.----------...------------
gi|294101254|ref|YP_003553112.1|  ............-----------------.--------.----------...------------
gi|294102077|ref|YP_003553935.1|  ............-----------------.--------.----------...------------
gi|294102510|ref|YP_003554368.1|  ............-----------------.--------.----------...------------
gi|294101748|ref|YP_003553606.1|  ............-----------------.--------.----------...------------
gi|294101141|ref|YP_003552999.1|  ............VTSLIQRMGRCNRY---.--------.----------...------------
gi|294101018|ref|YP_003552876.1|  ............-----------------.--------.----------...------------
gi|294101692|ref|YP_003553550.1|  ............KMFLRQALGRLIRSKSDqGRVV----.----------...------------
gi|294101032|ref|YP_003552890.1|  ............-----------------.-NFVILVT.EPTPFGLSDL...ALATETVRELHI
gi|294101031|ref|YP_003552889.1|  ............-----------------.--------.----------...------------
gi|294101431|ref|YP_003553289.1|  ............-----------------.--------.----------...----------E-
gi|294102167|ref|YP_003554025.1|  ............-----------------.--------.----------...------------
gi|294101458|ref|YP_003553316.1|  ............-----------------.--------.----------...------------
gi|294102320|ref|YP_003554178.1|  ............-----------------.--------.----------...------------
gi|294101940|ref|YP_003553798.1|  ............-----------------.--------.----------...------------
gi|294102120|ref|YP_003553978.1|  ............-----------------.--------.----------...------------
gi|294101791|ref|YP_003553649.1|  ............-----------------.--------.----------...------------
gi|294102136|ref|YP_003553994.1|  ............-----------------.--------.----------...------------
gi|294101830|ref|YP_003553688.1|  ............-----------------.--------.---IPVLEGI...QKERALLAPVRE
gi|294102042|ref|YP_003553900.1|  ............-----------------.--------.----------...------------
gi|294102015|ref|YP_003553873.1|  ............-----------------.--------.----------...------------
gi|294102787|ref|YP_003554645.1|  ............-----------------.--------.----------...------------
gi|294102032|ref|YP_003553890.1|  ............-----------------.--------.----------...------------
gi|294102010|ref|YP_003553868.1|  ............-----------------.--------.----------...------------
gi|294101586|ref|YP_003553444.1|  ............-----------------.--------.----------...------------
gi|294101458|ref|YP_003553316.1|  ............HNLM-QAIARVNRV---.--------.----------...------------
gi|294102625|ref|YP_003554483.1|  ............-----------------.--------.--H-------...------------
gi|294102478|ref|YP_003554336.1|  ............-----------------.--------.----------...------------
gi|294101874|ref|YP_003553732.1|  ............-----------------.--------.----------...------------
gi|294102071|ref|YP_003553929.1|  ............-----------------.--------.----------...------------


                                          170       180       190       200       210               
                                            |         |         |         |         |               
d2eyqa5                             GAGFALATHDLEIRGAGELLGEEQSGSMETIGFSLYMELLENAVDALK--ag............
gi|294102520|ref|YP_003554378.1|  --------------------------------------------------niahgcnsiqatky
gi|294102529|ref|YP_003554387.1|  --------------------------------------------------pvvvainrfptdte
gi|294102437|ref|YP_003554295.1|  --------------------------------------------------dvslalreamlegk
gi|294102168|ref|YP_003554026.1|  --------------------------------------------------iyvllapneyqead
gi|294101779|ref|YP_003553637.1|  --------------------------------------------------syydyyqpeayips
gi|294102457|ref|YP_003554315.1|  --------------------------------------------------leaarelktkptqh
gi|294101625|ref|YP_003553483.1|  ------------------------------------Q-------------vvngirtrlgarsv
gi|294101185|ref|YP_003553043.1|  --------------------------------------------------eqpdvedtisilrg
gi|294102626|ref|YP_003554484.1|  --------------------------------------------------qdtnplqdrliqav
gi|294101765|ref|YP_003553623.1|  --------------------------------------------------ginqvevderagrt
gi|294102479|ref|YP_003554337.1|  --------------------------------------------------rnprilildeatss
gi|294101904|ref|YP_003553762.1|  --------------------------------------------------mraeirkiqkklgi
gi|294102557|ref|YP_003554415.1|  --------------------------------------------------eirhlqkrlgitsv
gi|294101807|ref|YP_003553665.1|  --------------------------------------------------ylafeqdmhvvvil
gi|294101806|ref|YP_003553664.1|  --------------------------------------------------tsrwaealremsgr
gi|294102649|ref|YP_003554507.1|  --------------------------------------------------vgiaralannpsll
gi|294101185|ref|YP_003553043.1|  --------------------------------------------------dvvlfkplqrheir
gi|294102868|ref|YP_003554726.1|  --------------------------------------------------irqlqkgigitaiy
gi|294102500|ref|YP_003554358.1|  --------------------------------------------------argtssgpdvsreg
gi|294102409|ref|YP_003554267.1|  --------------------------------------------------lsdvtygtnsefgf
gi|294102354|ref|YP_003554212.1|  --------------------------------------------------rensdyartlddik
gi|294101565|ref|YP_003553423.1|  --------------------------------------------------dvfnillqiledgr
gi|294101424|ref|YP_003553282.1|  --------------------------------------------------aiaralamqpkiml
gi|294101976|ref|YP_003553834.1|  --------------------------------------------------kgydvlvimtdmly
gi|294101061|ref|YP_003552919.1|  --------------------------------------------------eligevlevmrnla
gi|294101048|ref|YP_003552906.1|  --------------------------------------------------illmdepfsgldpl
gi|294101977|ref|YP_003553835.1|  --------------------------------------------------iggrleempgeegy
gi|294101084|ref|YP_003552942.1|  --------------------------------------------------ydeptsaldpelvg
gi|294101565|ref|YP_003553423.1|  --------------------------------------------------iigaggaegavdaa
gi|294101786|ref|YP_003553644.1|  --------------------------------------------------ansypheldggrrq
gi|294101493|ref|YP_003553351.1|  --------H-----------------------------------------alqivdledranhq
gi|294101884|ref|YP_003553742.1|  --------------------------------------------------vkildacgkdvvii
gi|294101894|ref|YP_003553752.1|  ------P-------------------------------------------yqdfiqmdtsnilf
gi|294101778|ref|YP_003553636.1|  --------------------------------------------------rgaglggghdereq
gi|294102313|ref|YP_003554171.1|  -----------------E--------------------------------wlgltdkidsrpsq
gi|294102640|ref|YP_003554498.1|  --------------------------------------------------rqrigvaralaldp
gi|294101376|ref|YP_003553234.1|  --------------------------------------------------qllalmdglesrgq
gi|294102641|ref|YP_003554499.1|  --------------------------------------------------eyphqfsggmrqrv
gi|294101359|ref|YP_003553217.1|  --------------------------------------------------a.............
gi|294102459|ref|YP_003554317.1|  --------------------------------------------------vdgeiiastfdrpa
gi|294101785|ref|YP_003553643.1|  --------------------------------------------------gmkqrvviamalac
gi|294101376|ref|YP_003553234.1|  --------------------------------------------------ridlidpallssgr
gi|294102074|ref|YP_003553932.1|  --------------------------------------------------ehlygtlksdvekv
gi|294102442|ref|YP_003554300.1|  --------------------------------------------------rllvalnaagatvi
gi|294101577|ref|YP_003553435.1|  --------------------------------------------------sgidpiavydiqqi
gi|294101171|ref|YP_003553029.1|  --------------------------------------------------smellnrvgladra
gi|294102413|ref|YP_003554271.1|  --------------------------------------------------ssslpygaqrrlei
gi|294102187|ref|YP_003554045.1|  --------------------------------------------------qqdhvvrmesrpvn
gi|294102332|ref|YP_003554190.1|  --------------------------------------------------vaiarglvnrppvi
gi|294102831|ref|YP_003554689.1|  --------------------------------------------------alvaahklvvpiqc
gi|294101321|ref|YP_003553179.1|  --------------------------------------------------vvfmnktdqvddde
gi|294101626|ref|YP_003553484.1|  --------------------------------------------------vvfmnktdqvddde
gi|294101069|ref|YP_003552927.1|  --------------------------------------------------vqeprillldepis
gi|294102759|ref|YP_003554617.1|  --------------------------------------------------eeadlewslanryp
gi|294101055|ref|YP_003552913.1|  --------------------------------------------------shrtffildgeiie
gi|294101254|ref|YP_003553112.1|  --------------------------------------------------deptavltpqealr
gi|294102760|ref|YP_003554618.1|  --------------------------------------------------rvsiarslilepal
gi|294101659|ref|YP_003553517.1|  --------------------------------------------------cdralvlksgkvqw
gi|294101172|ref|YP_003553030.1|  --------------------------------------------------insegvtillveqn
gi|294102017|ref|YP_003553875.1|  --------------------------------------------------knlsmavhegergi
gi|294101748|ref|YP_003553606.1|  --------------------------------------------------hkeklkdtregldv
gi|294102409|ref|YP_003554267.1|  --------------------------------------------------eegeai........
gi|294102070|ref|YP_003553928.1|  --------------------------------------------------rvrdempflshapl
gi|294102390|ref|YP_003554248.1|  --------------------------------------------------knalrakganegqa
gi|294101403|ref|YP_003553261.1|  --------------------------------------------------vdlvvvdsvaaltp
gi|294101730|ref|YP_003553588.1|  --------------------------------------------------pshvvfilatteph
gi|294102602|ref|YP_003554460.1|  --------------------------------------------------nkvdrphanpmsal
gi|294102663|ref|YP_003554521.1|  --------------------------------------------------sdytafflmgelie
gi|294101436|ref|YP_003553294.1|  ---------------------R----------------------------klsgfafltlkpem
gi|294102150|ref|YP_003554008.1|  --------------------------------------------------srsiascegallvv
gi|294101607|ref|YP_003553465.1|  --------------------------------------------------irdkrvdnlfllpa
gi|294102035|ref|YP_003553893.1|  --------------------------------------------------qfdieeaqrglela
gi|294102412|ref|YP_003554270.1|  ------------------------Q-------------------------mlavgralmsrpdl
gi|294101660|ref|YP_003553518.1|  --------------------------------------------------thdletalmssdsi
gi|294102549|ref|YP_003554407.1|  --------------------------------------------------iahnlnevlavsdv
gi|294102841|ref|YP_003554699.1|  --------------------------------------------------iaralasrprillm
gi|294101272|ref|YP_003553130.1|  --------------------------------------------------saldaitrrslqsl
gi|294101433|ref|YP_003553291.1|  --------------------------------------------------psvpklmgvtdspy
gi|294101963|ref|YP_003553821.1|  --------------------------------------------------qtkeainharaagv
gi|294101356|ref|YP_003553214.1|  -----T--------------------------------------------nhldmrtrdifqqa
gi|294102542|ref|YP_003554400.1|  --------------------------------------------------lmksmeealyfvgl
gi|294101861|ref|YP_003553719.1|  --------------------------------------------------ideihrlpanveei
gi|294102400|ref|YP_003554258.1|  --------------------------------------------------aekdwekladaagr
gi|294102043|ref|YP_003553901.1|  --------------------------------------------------qiwkvvevhls...
gi|294101077|ref|YP_003552935.1|  --------------------------------------------------ayeqainvlktlni
gi|294102348|ref|YP_003554206.1|  -------------------------------P------------------qnssernleeamdf
gi|294102040|ref|YP_003553898.1|  --------------------------------------------------aadtfraaaidqlk
gi|294101613|ref|YP_003553471.1|  --------------------------------------------------ksleeaqlgielvk
gi|294101367|ref|YP_003553225.1|  --------------------------------------------------iareidkkktqllv
gi|294101893|ref|YP_003553751.1|  --------------------------------------------------algrrfvnfslggv
gi|294101841|ref|YP_003553699.1|  --------------------------------------------------dlsvgtpedvlyqw
gi|294102070|ref|YP_003553928.1|  --------------------------------------------------vahilrrsgkpviv
gi|294102221|ref|YP_003554079.1|  LI------------------------------------------------ekranamelmkvaa
gi|294101356|ref|YP_003553214.1|  --------------------------------------------------ryeqlggyefaama
gi|294101345|ref|YP_003553203.1|  --------------------------------------------------iwvmspshsftvgi
gi|294102145|ref|YP_003554003.1|  --------------------------------------------------idavmlvvaadegv
gi|294101756|ref|YP_003553614.1|  --------------------------------------------------rrlmavaslfkekl
gi|294102549|ref|YP_003554407.1|  --------------------------------------------------drllslrragkail
gi|294101372|ref|YP_003553230.1|  --------------------N-----------------------------tgfllregirvalv
gi|294101016|ref|YP_003552874.1|  --------------------------------------------------drppkeiqniedrl
gi|294101780|ref|YP_003553638.1|  ---A----------------------------------------------veaalslsggyvll
gi|294101686|ref|YP_003553544.1|  --------------------------------------------------arrllalhnnldlf
gi|294102507|ref|YP_003554365.1|  --------------------------------------------------grvefpcrvlllaa
gi|294101471|ref|YP_003553329.1|  --------------------------------------------------ptsrldpsvqakva
gi|294101845|ref|YP_003553703.1|  --------------------------------------------------rtleeltnyckeae
gi|294101553|ref|YP_003553411.1|  --------------------------------------------------agrlhvdedlmeel
gi|294101853|ref|YP_003553711.1|  --------------------------------------------------vdeladlmftaqkd
gi|294101780|ref|YP_003553638.1|  --------------------------------------------------vcggtrynretlev
gi|294102079|ref|YP_003553937.1|  --------------------------------------------------atikiyltasdsvr
gi|294101472|ref|YP_003553330.1|  -----R--------------------------------------------htartatqnlfsal
gi|294102235|ref|YP_003554093.1|  --------------------------------------------------gvpvvptvarerkg
gi|294102390|ref|YP_003554248.1|  --GFKIAEADLRLRGPGEVCGVRQHGITDFRVADLLK-------------d.............
gi|294101443|ref|YP_003553301.1|  --------------------------------------------------tenpwfeinktlls
gi|294101748|ref|YP_003553606.1|  GSGYSLALQDLQIRGSGDIIGVSQHGQDERVGYRFYYKMLEEEI------ar............
gi|294101649|ref|YP_003553507.1|  --------------------------------------------------vvkrlcgrrmcrqc
gi|294101715|ref|YP_003553573.1|  --------------------------------------------------ialidtlrekksit
gi|294101925|ref|YP_003553783.1|  --------------------------------------------------kllarlkdsrfnfm
gi|294101367|ref|YP_003553225.1|  --------------------------------------------------tlreynqkrgttiv
gi|294101751|ref|YP_003553609.1|  --------------------------------------------------mrgrtlndsfiild
gi|294101046|ref|YP_003552904.1|  --------------------------------------------------vtwl..........
gi|294101779|ref|YP_003553637.1|  KHGIIPQT------------------------------------------is............
gi|294101226|ref|YP_003553084.1|  --------------------------------------------------arhrgisidvekle
gi|294101892|ref|YP_003553750.1|  --------------------------------------------------qllvhlvdfrhgll
gi|294102315|ref|YP_003554173.1|  --------------------------------------------------lnqilaspafnqwm
gi|294102188|ref|YP_003554046.1|  ----------------GDRLIESLSDRFDYIVVDL---------------hrnfgditielaeg
gi|294102320|ref|YP_003554178.1|  --------------------------------------------------ffpttqsndqiklk
gi|294102169|ref|YP_003554027.1|  --------------------------------------------------eanlvskafkelpl
gi|294101254|ref|YP_003553112.1|  --------------------------------------------------stpsietpvknlsg
gi|294102077|ref|YP_003553935.1|  --------------------------------------------------ppaliaafrttlee
gi|294102510|ref|YP_003554368.1|  --------------------------------------------------awafnflegriqll
gi|294101748|ref|YP_003553606.1|  --------------------------------------------------mgeergrllrwlev
gi|294101141|ref|YP_003552999.1|  --------------------------------------------------leiceggrilly..
gi|294101018|ref|YP_003552876.1|  --------------------------------------------------villrerkdpslts
gi|294101692|ref|YP_003553550.1|  --------------------------------------------------il............
gi|294101032|ref|YP_003552890.1|  PAGVVINRSDLG--------------------------------------nieeaeifcknlal
gi|294101031|ref|YP_003552889.1|  --------------------------------------------------srkealkegvpfiv
gi|294101431|ref|YP_003553289.1|  --------------------------------------------------kvtavvpeemkfgi
gi|294102167|ref|YP_003554025.1|  --------I-----------------------------------------pllfenripwwvdl
gi|294101458|ref|YP_003553316.1|  --------------------------------------------------tngevidfnrwgrv
gi|294102320|ref|YP_003554178.1|  --------------------------------------------------tpynnspkdilsll
gi|294101940|ref|YP_003553798.1|  --------------------------------------------------likvnsprireare
gi|294102120|ref|YP_003553978.1|  --------------------------------------------------ykiqqavkdadcva
gi|294101791|ref|YP_003553649.1|  -----------------------------------Y--------------egrlplahvdlyrl
gi|294102136|ref|YP_003553994.1|  ----------I---------------------------------------siessspqqmgdfk
gi|294101830|ref|YP_003553688.1|  YADVVLDTSGLSIRGL----------------------------------kdrliae.......
gi|294102042|ref|YP_003553900.1|  --------------------------------------------------ascrlvviqsadtl
gi|294102015|ref|YP_003553873.1|  --------------------------------------------------prdrkltdelekfa
gi|294102787|ref|YP_003554645.1|  --------------------------------------V-----------sqkagdlekqkedf
gi|294102032|ref|YP_003553890.1|  --------------------------------------------------teidfsrytinvfv
gi|294102010|ref|YP_003553868.1|  --------------------------------------------------iadidiinpyfcir
gi|294101586|ref|YP_003553444.1|  --------------------------------------------------khshekvlspmdtd
gi|294101458|ref|YP_003553316.1|  --------------------------------------------------fkekqgglvvdyi.
gi|294102625|ref|YP_003554483.1|  --------------------------------------------------pefdesirrlqaal
gi|294102478|ref|YP_003554336.1|  --------------------------------------------------ddafqhrrlgrdvd
gi|294101874|ref|YP_003553732.1|  --------------------------------------------------hreevvsflekqap
gi|294102071|ref|YP_003553929.1|  --------------------------------------------------gpgaifaplpdpql


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  glklsdyfiteagfgadlgaekffdikcregnlhpsavvivatvralkmhggvakseltgenle
gi|294102529|ref|YP_003554387.1|  aelelvkehcvalgvqqvlsevwakggeggielaervleavekpntfhklydaslspkekieki
gi|294102437|ref|YP_003554295.1|  gilfegaqgtlldvdhgtypfvtssspiaaggcvglgvgpsdvdrvigvvkayctrvgegpfpt
gi|294102168|ref|YP_003554026.1|  filsemhrlhnfcgyrygdmavlyrinamsriyeqkciekgvpyrvvrgtafydrkeikdvlsf
gi|294101779|ref|YP_003553637.1|  sdtyiekdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavgekwd
gi|294102457|ref|YP_003554315.1|  svqelrrigilpdiiicrshypicdemkekialfcnvpkeaviealdeptiyqvplslqaqefd
gi|294101625|ref|YP_003553483.1|  plqlpigsedrfsgivdliqmkavffqddlgtapvvgeipgelmadvkkardllienladfdes
gi|294101185|ref|YP_003553043.1|  lkerlevhhgvrirdnalvgaavlsnryitdrflpdkaidlvdeacamirteidslpaeldaas
gi|294102626|ref|YP_003554484.1|  rshsqrlfivgdlkqsiyrfrhadlslfgsyikkakyghgdyilldtsfrskeilvhevndlfs
gi|294101765|ref|YP_003553623.1|  fevvlrsllrqdpdiilvgeirdsetahlvmraaltghlvlstlhtddaanaplrliemgvppf
gi|294102479|ref|YP_003554337.1|  ldvavesqiqeamekamegrtsfviahrlstvrsadrilvlskghivesgthdellekggiyrh
gi|294101904|ref|YP_003553762.1|  tcihvthdqkealtiadrivvlnkgkieqvaapfelyanpatlfvadfigqanifkg.......
gi|294102557|ref|YP_003554415.1|  yvthdqaeamsisdrvvvmnkgrieqvgtpielyarpsnsfvaafigkvnfmpak.........
gi|294101807|ref|YP_003553665.1|  tdltnycealreisaarkevpgrrgypgylytdlatmyeragrlkgkkgsitqipiltmpeddk
gi|294101806|ref|YP_003553664.1|  leempgeegypaylgtrlasfyeragraiclgsdgregsvtaigavsppggdlsepvsqntlrv
gi|294102649|ref|YP_003554507.1|  lcdeatsaldpkttqsilalldeinrklgitivlvthemgvirqichrvavlehgqvvelgavk
gi|294101185|ref|YP_003553043.1|  qivkllaqelqkrlkdhridlelseeavdyiadagydpvfgarplkrfivkqletrmarslvag
gi|294102868|ref|YP_003554726.1|  vthdqeealalsdrivvmekgeiiqidtprniyfhaqnsfvadfigrsniit............
gi|294102500|ref|YP_003554358.1|  vqrdllpivegstvqtkygtvktdhilfiaagafssvkpsdlvpelqgrfpirvelqplgreel
gi|294102409|ref|YP_003554267.1|  dylrdnmavakdqlvqrghhfcivdevdsilideartpliisgpsednvemyttadqiarqlke
gi|294102354|ref|YP_003554212.1|  kqlsdkavpfflpigkeasfkgvvdilnqkayeyvtdgsgsfkeisipaemvdevsaareslie
gi|294101565|ref|YP_003553423.1|  ltdgqghtvdfrnaviimtsnigakdwvkgtslgfsisgeadgyfdwdktksdildavqktfrp
gi|294101424|ref|YP_003553282.1|  fdeptsaldpelvgevleviaqlaetgmtmviithemlfakdvsdriifmadgniveqgspqdi
gi|294101976|ref|YP_003553834.1|  yceslreisaareevpgrrgypgymysdlaeiyeragcvencqgsitqipiitmpdddmthpvv
gi|294101061|ref|YP_003552919.1|  kggmtmlvvthemgfacsvaneimfmeegrilesgspdkllntpqyertrqf............
gi|294101048|ref|YP_003552906.1|  irremqdelirlqkelkktiffvthdldeamrmgdrmavmkngtivqmgapaqilanpadeyva
gi|294101977|ref|YP_003553835.1|  paylgtrlaqyyeragrakllglperegsvtvinavspaggdfsepvtqaslrlsgafwaldkr
gi|294101084|ref|YP_003552942.1|  evlqvmkdldnegmtqiivthqmrfarnasdyivfmdggeivemadgdvlfetpqnkrtkaf..
gi|294101565|ref|YP_003553423.1|  nilkpslsrgefqvigattldeyrkyiekdaalerrfqpvmveepsvddtisileglrdryesh
gi|294101786|ref|YP_003553644.1|  rigiaraltlnpkfivcdepvsaldvsiqaqilnliqdlqvqfgltylfithdlsvvkhlstni
gi|294101493|ref|YP_003553351.1|  pqqlsggqqqrvaiaralandapliladeptgnldsktgidvmklfvrlnvesgktiiqvther
gi|294101884|ref|YP_003553742.1|  etvgvgqseidivkladtvclvlvpgmgddiqimkagimeiadifvvnkadrpgaekietevkl
gi|294101894|ref|YP_003553752.1|  icggafagieevigrrvnkkmigfggdilsvkehrnyelmrqvqpedlmafgfipeligrlpvv
gi|294101778|ref|YP_003553636.1|  tlnqllveldgfdestgiiliaatnrpdildpallrpgrfdrhivvdrpdvkgreeilavhvrn
gi|294102313|ref|YP_003554171.1|  lsggecqrvavaravvkrpeliladeptanldsensynilemmvrlnkelettfifathdekvm
gi|294102640|ref|YP_003554498.1|  efivldepvsaldvciqaqilnllgdlkkergytylfishnlsvvryvsdevavmylgqvveka
gi|294101376|ref|YP_003553234.1|  vivigatnipntldpalrrpgrfdreisipipdrngrfeilqihtrgmplaedvdlmrlsdith
gi|294102641|ref|YP_003554499.1|  giaialaceptlliadepttaldvtiqaqvldliknlqkivntslllithdlgivaeicdevai
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  eehlrvanlalekakrlvetgkdvvllldsitrlarasnlvvppsgrtlsggmdpaalyfpkrf
gi|294101785|ref|YP_003553643.1|  npkvliadepttaldvtiqaqvlemmnelkkkfnmatilithdlgivaqtcekaaviyageive
gi|294101376|ref|YP_003553234.1|  fdvvlelpmpdakarleifqihlqkkplaedvhleelvrsteghsggdihficrkasalairdf
gi|294102074|ref|YP_003553932.1|  leagvdvvleidvqgalqvknafddsvlifimppskeelerrlrnrgteeedtvqlrlsnalke
gi|294102442|ref|YP_003554300.1|  mathdqylvdayrqrvvelqegrivrdeekg.................................
gi|294101577|ref|YP_003553435.1|  ilslrakgygilltdhnvrdtlaitdrtylihqgeiviegspdevaqsevarkfy.........
gi|294101171|ref|YP_003553029.1|  lqpagtlpygyqrrleiaralaldprlllldepaagmnpeevmalneliksihmefqlailvie
gi|294102413|ref|YP_003554271.1|  aralatdpsfllldepaagmnpletvdlmsfirrirdefnltilliehdmkvvmgiceyiwvld
gi|294102187|ref|YP_003554045.1|  iegtgaitirmlvrnslrmrpdriivgecrgeeafdmlqamntghdgslttlhansprdvlsrl
gi|294102332|ref|YP_003554190.1|  ladeptapldseralavirilndmaqrfetavivvthdekiiptfkriyhirdgvtyeeegq..
gi|294102831|ref|YP_003554689.1|  eyyalegvgqlahtiglvrdclnpdlavdgvlltmydsrtrlandvveevrrqfgeivfstivp
gi|294101321|ref|YP_003553179.1|  lldlvemeirellskydfpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapq
gi|294101626|ref|YP_003553484.1|  lldlvemeirellskydfpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapq
gi|294101069|ref|YP_003552927.1|  sldvknqieimetmkhiikghglsavmslhdltmalrygdrfvfmkkgeiryilardeis....
gi|294102759|ref|YP_003554617.1|  helsggqkqraaiatalacdpdflladepttaldvitqkeiiltlerlargrnmglllvthdlp
gi|294101055|ref|YP_003552913.1|  agptkdlfenp.....................................................
gi|294101254|ref|YP_003553112.1|  lfstiqqmtaeghgivfishkldevlslsdrisilrkgekt.......................
gi|294102760|ref|YP_003554618.1|  llcdeptsmqdastrseiihvlnervkegmamvfvthdlylargaakrgivllegecceenste
gi|294101659|ref|YP_003553517.1|  dgtiselfrhte....................................................
gi|294101172|ref|YP_003553030.1|  arqalllshrgyvlqtgsiimagtsedllnsadirnaylg........................
gi|294102017|ref|YP_003553875.1|  sflykvvdgpadrsygievarlagippavlkrafhlletfe.......................
gi|294101748|ref|YP_003553606.1|  ltlsatpiprtlslslrglrsfsiistpp...................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  lfvsaltkrglnkltqtiknvqenrsrrigttelnrlirdvlafqtlptsrkgrvlkiyyctqt
gi|294102390|ref|YP_003554248.1|  philvmtatpiprtltlsvygdlsvsvidempp...............................
gi|294101403|ref|YP_003553261.1|  qaeidgkigdsqlglqarlmsyalrrltsaisrsncvvvfinqlrakistgyssgpqetttggr
gi|294101730|ref|YP_003553588.1|  kvpvtirsrcqhipfrkidvqnivkslsmvahnenrnaeeealweiarqadgamrdalslleqv
gi|294102602|ref|YP_003554460.1|  nqtfdlfielgaaeeqldfpvlygsgldgwavrdlnkyahegmkhlfetiaeyvpapkvnlhap
gi|294102663|ref|YP_003554521.1|  ygktpklftspg....................................................
gi|294101436|ref|YP_003553294.1|  ivlnldetqteghvpgldaimsiakerglglvqvfgrmememadlsedeqrefmadlgikeagr
gi|294102150|ref|YP_003554008.1|  dasqgveaqtvanaymavdqgleiipvinkidlpsahpesvqkeieevvgidadgailasakeg
gi|294101607|ref|YP_003553465.1|  aqtrtkdavspdqmvelcemlkkegfdfilldspagieggfknaaagatealvvttpeipsvrd
gi|294102035|ref|YP_003553893.1|  kkwiekglfdivildeinvaldyelveldqvidilkkrppfvevvltgrnppvalleyadlite
gi|294102412|ref|YP_003554270.1|  vmmdepslglapmlvkevfdiireinaqgktvllveqnafaalkvahhayilevgsivlsgpge
gi|294101660|ref|YP_003553518.1|  lvleggrevvqgapgkiieels..........................................
gi|294102549|ref|YP_003554407.1|  itvmrkgkhiatlprseat.............................................
gi|294102841|ref|YP_003554699.1|  deplasidpeargvlyedlasfagnvtiilvshdlsviangatavacv................
gi|294101272|ref|YP_003553130.1|  llslqkdfkktvlmithdidealyladtvlvltqapmkirdritlpsekprnldsseyiaik..
gi|294101433|ref|YP_003553291.1|  gspqgiippassifdikvmsvnlllddptkpvvwrgpiiasvikqfwedvawdktdfiivdlpp
gi|294101963|ref|YP_003553821.1|  pivvavnkidkpaarpdrvrqqlsdvglvpeewggdsimvdvsaktgegiphllemvllvaeme
gi|294101356|ref|YP_003553214.1|  lteyhgtiiivshdryfldklvsrvieiregkileypgnysyfiq...................
gi|294102542|ref|YP_003554400.1|  apsqfarrkwyelsggeaqrvalasrlaikpevllldeptasvdrvsaelikqgvrmcrekwgt
gi|294101861|ref|YP_003553719.1|  lypsmedfslhiivgkgplannicltlppftlvgattrlglltsplrarfgiveqlalynvdet
gi|294102400|ref|YP_003554258.1|  lsqaplfiddssmlstlefrararrfksrfenlglivvdylqlmsfarridskqqevaeisral
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  dnlahtppyalsggqkrlgalaavlamkpdlllldepssglderawqnlvdvlnqldmaliias
gi|294102348|ref|YP_003554206.1|  vqmsplfldraidkslsggerkrielasiylmkprlaildepdsgvdllalrevlgllrlladq
gi|294102040|ref|YP_003553898.1|  iwgertgsrviaqqqgsdsaavaydalqaarasgadvliidtagrlhskhnlmeeltkivrvie
gi|294101613|ref|YP_003553471.1|  qkragritflpleqchprnpdygfplpcqgtvgwatdliaseqlwspavnhllgdlliveeydv
gi|294101367|ref|YP_003553225.1|  ldeptavlteseaeillasmrklaalgiaivfishrlhevidvcdkivvlrdgqvvhettpak.
gi|294101893|ref|YP_003553751.1|  rdeaeirghrrtyvgaqpgriiqkmrqagtknpimlmdeidkigqdfrgdpasallevldpaqn
gi|294101841|ref|YP_003553699.1|  evicsefkaykesllerpymvvgnkidierghenapaiesfmkarnipyyntsaitgegiaefm
gi|294102070|ref|YP_003553928.1|  vanklddgihedrvydayslgfehvvgisalhkryiddlmdmavsllpsdeee...........
gi|294102221|ref|YP_003554079.1|  kydkdlqekikedpiidtlqarrdkfalarkiltdkkntafyfvlnaeklpiietkraieilqk
gi|294101356|ref|YP_003553214.1|  qkvmkglgfsdgdgqrytstfsggwkmrislaamllsspdillldeptnhldtesmewledwll
gi|294101345|ref|YP_003553203.1|  pedl............................................................
gi|294102145|ref|YP_003554003.1|  mpqtrehlailnllgvhdgviviskadlvdeellelaiadvtdfvqgtflegkvvvpvssvtnk
gi|294101756|ref|YP_003553614.1|  pivgalgvsakkgynidklvqilkdklpagfpwydeeiltdrperflageiirekvlllth...
gi|294102549|ref|YP_003554407.1|  misadldeilslsdriavmnrgeivavlprkeasr.............................
gi|294101372|ref|YP_003553230.1|  grpnvgkssllnallkesraivtaipgttrdlieevltyrgipirlvdtagigapgdeieamgi
gi|294101016|ref|YP_003552874.1|  vsrfewglvtdiqmpdletriailqkkaqirnyevpedvisflaqnvpsnirelegalnri...
gi|294101780|ref|YP_003553638.1|  vteggkeqlltenyacpdcgislpeieprlfsfnnpygacpdcsglgshehfseehaidpvrsv
gi|294101686|ref|YP_003553544.1|  cdtdldgalshveghgfvvldsvqamrssledgwpgtpsqvravaqqcidsakktgipfvvvgh
gi|294102507|ref|YP_003554365.1|  cnpcpcgwagdpvescscsayekeryskrlsgpildridlhvsvprllpkelisfedqsgedse
gi|294101471|ref|YP_003553329.1|  hmlveeahvksiavlfishdevllnalcsriirl..............................
gi|294101845|ref|YP_003553703.1|  mnltwlnesyrrseqsgaeakklrreasrlalelrkkrertarsleeavnhslrdmameditfs
gi|294101553|ref|YP_003553411.1|  srlkdlvnpheillvvdamtgqeavkvatsfheklsltgvvlskldgdarggaalairattqvp
gi|294101853|ref|YP_003553711.1|  vedyicrlaqmaratgihlllatqrpsvnvvtglikaniparvaftlpsqadsrtiidvsgaek
gi|294101780|ref|YP_003553638.1|  rykgrniadvlnmtvddafeffkeipriasklaliqeaglgyirlgqsaltlsggeaqrvklak
gi|294102079|ref|YP_003553937.1|  akrrhlqllergekvsfdevlrqiqnrdqfdsnreiaplcqasdaifvdtssmtedevvdylvr
gi|294101472|ref|YP_003553330.1|  gitqeasrerpgklsggmaqrallamalaspaefilldeptkgldssrkedatalvkgiinagk
gi|294102235|ref|YP_003554093.1|  ledlvkrvkdrfengvsl..............................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  rlvvfqlkplaeedlvqilykalkdeekglgalklavsedvitvlakmaggdarqaltrlella
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  geiyhvtfkpssqgmrcekcggelfqrdddketvirsrlkvyhdqtaplisyydekgllrkvna
gi|294101715|ref|YP_003553573.1|  latthhnpiksyalttphvetasmefnvetlaptyhllmgipgrsnaiyiaerygmpsevlqka
gi|294101925|ref|YP_003553783.1|  fhpgdykdassskdlhnllnewigsenklaildlsgvpfevldiaiglitrfvydsmywgkyes
gi|294101367|ref|YP_003553225.1|  misseleelrsicdriaivnegkiagt.....................................
gi|294101751|ref|YP_003553609.1|  eaqnttpeqmkmfltrlgfgskavvtgditqidlpsgkksgliqvreilegikg..........
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  kllgvpvvptvalsgqginriiqripearkghippl............................
gi|294101892|ref|YP_003553750.1|  kndqelqewisqigipslvvftkadkiskgrhkgmlhsyirkglksievpfivsaqdksgvgef
gi|294102315|ref|YP_003554173.1|  tgvpleigsflhspegkprasiftvshlsdnermffismvlneivgwmrtqtgtpslrailyid
gi|294102188|ref|YP_003554046.1|  cqriwlvtdcsctgvknlhlvtglldqlriswiergvivnkaeredrsivekiqreygvkgllp
gi|294102320|ref|YP_003554178.1|  eaaegkinafltllggdaellt..........................................
gi|294102169|ref|YP_003554027.1|  edldvifienvgnlvcpaefdigedmkvavssvpegadkplkyphlfseakavlltkmdlapyv
gi|294101254|ref|YP_003553112.1|  gnlqklmlgrelcdapkaliavhptwgldvaatqfvreqlllerdrgaavflvsedleellsls
gi|294102077|ref|YP_003553935.1|  isvsslillvldgsmpdvmetldvveetlsdigagaiprlivlnkidkidlslipflqtrlqgr
gi|294102510|ref|YP_003554368.1|  rrdlaklrpahrelrlavvgipnvgkslflnllvgkkrapvggvpgitrgvswykgqdilavds
gi|294101748|ref|YP_003553606.1|  agyervdlvwtpgqyvvrgfivdiydpayalpirieffdeivesirsfhpqsqmsaatldeiei
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  kvlaplvswiwstraaavdllkigiqefrillpsdivltferggaldlqdpmqdywesvrkwre
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  pilarlpfskevarayakgiapilidkqwqeaasdilnhvkevl....................
gi|294101031|ref|YP_003552889.1|  idgppgiscpaisaltgatlavavtepslsglhdllrlsklcasldvplaivlnksdlseakge
gi|294101431|ref|YP_003553289.1|  fvspltginldehnrtsttdnrllrrmirdyrtrghsaertldlwpsvikgareyifpyqssav
gi|294102167|ref|YP_003554025.1|  svyvtapldlrlarnevrgwnkeeierrerflrnaeekraeadlvirndssidtleqslsr...
gi|294101458|ref|YP_003553316.1|  aensspytantmltdrrnvvviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyi
gi|294102320|ref|YP_003554178.1|  klfqkgqkstipnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylmvrrt
gi|294101940|ref|YP_003553798.1|  gmkkhlnrlevvgeesgqrwtidrlekhvalripslvvidyltllkrpgqsdleaveevmprlk
gi|294102120|ref|YP_003553978.1|  iddlgaqrkdkswvderlfslidaryrsgkqtiittnacsmsqlkemlgehgtrivsrltema.
gi|294101791|ref|YP_003553649.1|  ergdeyelglceyaddgfvlviewpdrlaeqpt...............................
gi|294102136|ref|YP_003553994.1|  tradfisdvegidsntisagednlfilltaiislkyyyeatalshevtsillvdeidatlhpsi
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  llpaansmlkiveeppehgvilfllendkflptlksrcwnlal.....................
gi|294102015|ref|YP_003553873.1|  skhgnqalhdqlsaidpkrasqlhvndvr...................................
gi|294102787|ref|YP_003554645.1|  rnqhvirnetceqarkardearsllktrkehvekmernvsplsvqtlrekcgslrqfftrwhqi
gi|294102032|ref|YP_003553890.1|  andpengvpviwetnptyynltgkveyesrqgylytdfhkivsgafqkanggylvldaekvlln
gi|294102010|ref|YP_003553868.1|  qvsdvlekkglsvitmpeqakwldmslvtpkvdwalhdestrllmdiggdaegalalkqfepii
gi|294101586|ref|YP_003553444.1|  tgkvlsqgipalywgvdgcryekpgeisiydiqnrigsnfdillleggksfpchkiw.......
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  retehkveslgelqdrigpagqvrfsgseavsflhhwtsmatiwlppaikgalslfigtppvle
gi|294102478|ref|YP_003554336.1|  ivlvdaccpfgngrlvpagilreppkaiqrahivvitkadqvs.....................
gi|294101874|ref|YP_003553732.1|  ctvmiiatstamalkivrilnlpqperfi...................................
gi|294102071|ref|YP_003553929.1|  ilvdeesspayrmqaapllhi...........................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  alskgipnlekhienmqgfgvpvvvainrfptdteaelklvhercaafgvpvalseiwakggeg
gi|294102529|ref|YP_003554387.1|  akeiygaksvaymaqaekdleeihrlgkdnllvcmgktqasisdnpaligrpegfeltvrevrl
gi|294102437|ref|YP_003554295.1|  edlgdhgqtlrdrggeygattgrprrcgwldmvalkyavrvngmssialtkldvltgfekikic
gi|294102168|ref|YP_003554026.1|  mrlavnpldgaslgrianvptrgigkksqeklmeglgaipemeaeqlwravadgkdlgltgkak
gi|294101779|ref|YP_003553637.1|  rrgfmerlidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidpvsgh
gi|294102457|ref|YP_003554315.1|  rlvmrllsf.......................................................
gi|294101625|ref|YP_003553483.1|  vmesylegqdvpeetlrrairentiqqrivpvlcgsafknkgiqllldavvdylps........
gi|294101185|ref|YP_003553043.1|  rkvmqleieeaalkkekdaaslerlsvlqkelqeareeadalraqyesekeviskvrkmreeid
gi|294102626|ref|YP_003554484.1|  svwkdglgqelplpfeslevphylsthelrqqctvdpfltyleggkegekirearlrqirrlal
gi|294101765|ref|YP_003553623.1|  livsslkavvsqrlirllcplckkpdsnspvgcsycggrgfhgrvgvfeylpitervqelllhk
gi|294102479|ref|YP_003554337.1|  lyelqf..........................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  thpipdltgyitegqiilsrglhrkgiyppvdvmpslsrlkdk.....................
gi|294101806|ref|YP_003553664.1|  tkvfwgldaslayqrhfpainwllsyslytdt................................
gi|294102649|ref|YP_003554507.1|  dvfmkpqsktaref..................................................
gi|294101185|ref|YP_003553043.1|  evregskvyvtvkdkalaf.............................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  arilvepenslikqyqallsterievrfsedaieeiaamaekmnaemenigarrlhtmveqlle
gi|294102409|ref|YP_003554267.1|  grdfekdekernvaftedgiarcenllkmpglfsdaansdlahrivqavkahvlfqkdvhyvvk
gi|294102354|ref|YP_003554212.1|  svveaddevmmmylegdeisheeivkvarkairerqifpvlpasgtanigvhqvldflgdmfps
gi|294101565|ref|YP_003553423.1|  efinrvdemvvfrplskkemlvivdimlsdvrerlryqdidikvseeakafilekgynprygar
gi|294101424|ref|YP_003553282.1|  mvkpahprtqaf....................................................
gi|294101976|ref|YP_003553834.1|  dlsgyitegqivldrgihdrgayppinvlpslsrlmnk..........................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  rfvqdk..........................................................
gi|294101977|ref|YP_003553835.1|  laqqrhfpainwqqsytlyegs..........................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  hrvkisddalvaaarlssryiterflpdkaidlideaaararlktmeipanlkdiehdleevrk
gi|294101786|ref|YP_003553644.1|  mvmylgqvveladskklfknpvhpytktl...................................
gi|294101493|ref|YP_003553351.1|  dmalfgsriitvkdgtivhderv.........................................
gi|294101884|ref|YP_003553742.1|  mldligktdwfppihmtvaekgdgvaelvegiekhgaflkqsihgikkqkrklaeeikdilsrd
gi|294101894|ref|YP_003553752.1|  vpleeldddalarilvepknalirqyqktfeiegvklffeqdaikaiakearkkntgarglrsi
gi|294101778|ref|YP_003553636.1|  kkiaddvdlgvvarrtpgfvgadlanlvneaallaaragkslitmaefeegidr..........
gi|294102313|ref|YP_003554171.1|  kylrrkihlfdgrvaqde..............................................
gi|294102640|ref|YP_003554498.1|  gntilfkdplhpytqal...............................................
gi|294101376|ref|YP_003553234.1|  gfvgadlealakeaamsslrellpcidyeqavipyekllsmnvtmenfldalkevepsa.....
gi|294102641|ref|YP_003554499.1|  myagrlveysdirqlyskpmhpytqg......................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  fgaarnieeggsltvigtalvdtgsrmddviyeefkgtgnmelhlsrklaeqrifpavditksg
gi|294101785|ref|YP_003553643.1|  ygtvheifknmrhpyti...............................................
gi|294101376|ref|YP_003553234.1|  lkigekgapciekhhfeials...........................................
gi|294102074|ref|YP_003553932.1|  mekmhmydyvvvndsvlraaleikriiasynl................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  hhmdlvmeicpriicmnfgakiaegspeeiqansevlkaylge.....................
gi|294102413|ref|YP_003554271.1|  ygkliaegnpdeiqsnprvieaylge......................................
gi|294102187|ref|YP_003554045.1|  esmvlmagmelpvraireqissgidlivhqerlkdgtrr.........................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  rnvklseapshampiayyeptctgakaymnfsmevaerwl........................
gi|294101321|ref|YP_003553179.1|  retdkpflmpiedvftitgrgt..........................................
gi|294101626|ref|YP_003553484.1|  retdkpflmpiedvftitgrgt..........................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  lavqicdaiavmhegeiveegapadivtkprhrhttq...........................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  allsapkhaytralv.................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  siepptfvffvndpeivsqsfnkhienkiremdtfdgtplrlywr...................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  alkfyssvrvevkrgksinkgedaighelwmkvvknkqappfrtahasliygkgv.........
gi|294101730|ref|YP_003553588.1|  ma..............................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  erliqeaysllglisffttgkdevkawtlkkdata.............................
gi|294102150|ref|YP_003554008.1|  igiqdilerivaqvpapegdteaplqalifdsvynnyrg.........................
gi|294101607|ref|YP_003553465.1|  adriigllesmekkpirlvinrvkpsmvkegemldvqdvldvlaieligivpdddsvvksanrg
gi|294102035|ref|YP_003553893.1|  mkeirhpfqkgitgrrgiey............................................
gi|294102412|ref|YP_003554270.1|  dllknprvkeayl...................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  gtadapltvmqtidldgflvvtspqelsvmvvekalnmtkmmevpllgavenmsyvtcpdcgka
gi|294101963|ref|YP_003553821.1|  elradp..........................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  tlvlvshdvlwvkslsdrhliltegelstss.................................
gi|294101861|ref|YP_003553719.1|  seivqrgakvlgieieeeaayeiarrsrgtprvairllkrvrdvaevrqspsintavasvalnm
gi|294102400|ref|YP_003554258.1|  kgvareldvpvialsqlsraveqrnekmpqlsdlrdsgaieqdadlvmllyrpgyydtaaspee
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  hdipflehvtrrgyelssg.............................................
gi|294102348|ref|YP_003554206.1|  gsgvmvithredvaagcdrsylmcdgriilegsaaavkry........................
gi|294102040|ref|YP_003553898.1|  revgrdsmenllvldavmgqngfaqaesfhkalslngvilskydntakggvilaiahrlalpir
gi|294101613|ref|YP_003553471.1|  gmnlaragasfpivtlqgdvftvggsvsggkfrktggaierrlqiedleknlkdkrgslervvs
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  snftdhyiesafdlsnvifittanvthtipaplldrmevirlpgyvaeekihiakkhllpklfk
gi|294101841|ref|YP_003553699.1|  gnivalcrehtrphsei...............................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  hdigiggvivnkvipeeagpffekrrvdqeqylkqidemfggfgvariplldsdikgieql...
gi|294101356|ref|YP_003553214.1|  nfngtliaishdrhfldkictstaelsqgaislykg............................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  nipllmeelaklidrvqprtrrgpffmpidrafpisgfgt........................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  araekammeadvriwvidgsepltpadlalvqkisatnhivtinkadlplviseemingllpqs
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  eegallpwkkkhymlrklytfsqskewdltqpygtlpknvqnfilygsderlpmffsdrgerhq
gi|294101686|ref|YP_003553544.1|  itkegriagpmllehmvdavllfsgedtsayrmirgtknrygntdelgifemtekgl.......
gi|294102507|ref|YP_003554365.1|  tvrqrvcearekqrlrwrkygfhcnaelperiikrelnlgtdvrpflirmadnlrlsgrgisrv
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  itlsdlgkikstgadeisflmasgmmppgpvmkiasggelsrlllalqlalpdsqlpgtlvfde
gi|294101553|ref|YP_003553411.1|  ikfagvgegidaielfdakrmaqriigmgdvmglaekvqqvtsqedvakitkslkkdkltmedl
gi|294101853|ref|YP_003553711.1|  llgkgdmlfvsprfpkpvrlqspyiedgksle................................
gi|294101780|ref|YP_003553638.1|  elskrftgptlylldepttglfytdvkkllhilhrivdqgntvvtiehnldvllssdyiidlgp
gi|294102079|ref|YP_003553937.1|  lvke............................................................
gi|294101472|ref|YP_003553330.1|  tllcithdfslpkqiggqtgvlfsgllvesgdsqivlqhpshpytqgl................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ssvaasgaaeltmah.................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  gtssssvmaeiealv.................................................
gi|294101715|ref|YP_003553573.1|  ratlkeq.........................................................
gi|294101925|ref|YP_003553783.1|  ytgknrplllayeeahtylnkndnnsysknaverifkegrkfgvgalvisqrpseisetilaqv
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  rqfltqyl........................................................
gi|294102315|ref|YP_003554173.1|  evfgymppvkeppskkplitllkqarafgigvvlatqnpvdldykglsnigtwfigrlqtqrdk
gi|294102188|ref|YP_003554046.1|  fdeklekgwlkgeplilsqprspyskvireiaselvgke.........................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  pfdmdlykndlqhlnprvecieiealngkgidrwvslvetwlke....................
gi|294101254|ref|YP_003553112.1|  drlavifkgeimgildhpe.............................................
gi|294102077|ref|YP_003553935.1|  skakvlpicalsgvgvtellqevey.......................................
gi|294102510|ref|YP_003554368.1|  pgildprshnevhrrl................................................
gi|294101748|ref|YP_003553606.1|  hsitaarekkleemipdschtvlfepsqienkaesy............................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  kehitgvpqvgpqrddmiittkgqsvsivmsrgqrrrtavalmlaagwaverklrrkpllilde
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  eikneakkenwhflgsipfrpnvveaiskkeiplea............................
gi|294101431|ref|YP_003553289.1|  amfnsslpyelavlrgyaqpllqtvpesssmhgearrllsmlkfvpplpsenvpsnsilrefig
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  gftgtpveltdkntrvvfgdyidiydmtravedgttvkifyesriakldlpeemkp........
gi|294102320|ref|YP_003554178.1|  raeie...........................................................
gi|294101940|ref|YP_003553798.1|  tltqrlkirtlilsqlgraskldqrkgatgghakgggiveelvhseieiqkdgldkngqprlia
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  lykllklfedysnrykiqiictshslsliefalarkynviylldn...................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  qnqikenemnldlfrqkkelqwggaaagtlglaflgagyrtgdifflktgitaiaaslgfiivd
gi|294102032|ref|YP_003553890.1|  fmswealkralrtgeatienlgeqygaipisslrpqpipinvkvvmvgtpylyallqyydpefl
gi|294102010|ref|YP_003553868.1|  kkvgyrlilvvnafrpqtasvtriqkmmkkmesicglevgalisnshlmh..............
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  knslwimpnitasiwpgkmsessllpdrhklalhdltgterghlpllkekrdqrealfrrlvac
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  gielaerileavekpnsfhplydvaqspkekiekiakeiygakgvtytaqaekdleeihrlgkd
gi|294102529|ref|YP_003554387.1|  sagagfivpitgsimtmpglpkvpaamkidvdddgnitg.........................
gi|294102437|ref|YP_003554295.1|  thyevngekhenyltntsllakaspvyttldgwkedisgcrdfeklpeaarryveyieketgvp
gi|294102168|ref|YP_003554026.1|  igamelgrhmfniikrsgsfhdvllyildsieyedqlkkddpegweervenirelgslvtsggd
gi|294101779|ref|YP_003553637.1|  tlkqlpkasifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtrydmeml
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  avkreiekaereydlnkaaelkhgrlpelqqqlkkeegahaagqegdqllreevtedeiaeivs
gi|294102626|ref|YP_003554484.1|  lfsqyyeekrtvwdkqkeclrpvqwkdmailvpsrtswfpllekiffeefqlpiyfegstsyfs
gi|294101765|ref|YP_003553623.1|  apvqkirtqarkegmrtlvengmlkverglttyeeil...........................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  eisftaperqgevvdinaqfvkerlsplmedt................................
gi|294102409|ref|YP_003554267.1|  dgeiiivdeftgrlmfgrrysdglhqaieakekvrvgresqtlatitlqnyfrmyrklagmtgt
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  plrrkiqqliedrmadmllegkikkgslvsidedk.............................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ekeaavtsqefekaarlrdterkiseeleekkkdwqsrryqekplvsfddiativsewtnipvt
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  iaknv...........................................................
gi|294101894|ref|YP_003553752.1|  meylmldlmyeipsrsnevekiiitkevvek.................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  trreell.........................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  epltsgdtslasmafsniadrllgkev.....................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ievfgpshvkeieekfslpvlgkfpldlelshlgdqgr..........................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ednratiriakhrngptgdvnlvfl.......................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  yiglgesvddlrlfepqefvralle.......................................
gi|294101613|ref|YP_003553471.1|  llqeaeelecviakerafwkekeqeaekkllshsirferqreeivrlekersfflndvedsgkl
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ehgltdkmisitsktvektirdytreagvrnlqrslatlcrkv.....................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  pvfvisaekregiealkdai............................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ymgryegllpwlegrwnetesenvleelagyrvedicqtchgyrlrpealmvqlnhhtidelve
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  lkvartiadldnssrvrvphisealay.....................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  veaglggkaavlagyklkqlaekcrvilitheatiaalaeqhfvvarqenksfikeiek.....
gi|294101553|ref|YP_003553411.1|  llqfeqieklgpldkvidml............................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  eggmeggs........................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  gtlialrltnsgdqsivkssspdnlnslidllpslrigeavivgesikipsrirvklnnprp..
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  drvleglerlenasgydrqfldkaitglkkrefllnnvhenspsif..................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  iaaelddrgrnilidalvesswqvfaata...................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ggc.............................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  titkarhgtkgsfeleyig.............................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ffqkrkffnekeellcrlrknlveteeelshtveglaiecpkdylelekaemyiddcidgirey
gi|294102032|ref|YP_003553890.1|  kmfkikaefdrdmprtfeseqqmaqficgfvrnegkipftvkavaeviewagrlaehqnrvtte
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  gedllilsspstdalgkplppspflg......................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  nlvicmaktqasisdnpaligrpegfeltvrevrlsagagfiiaitgsimtmpglpkvpaamki
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  vqligvgpgrsqtilr................................................
gi|294102168|ref|YP_003554026.1|  laevlaevalftdlettdmddleavnfltlhaakglefpvvflvgleeaifphfkclevqesle
gi|294101779|ref|YP_003553637.1|  aevgycsgienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdrarkttl
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  rwtg............................................................
gi|294102626|ref|YP_003554484.1|  rseiqdliallnflddpgkelylmsflssplsslsleevrdlaldapkgyrlqafqekwphlar
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  avteseefkeiygldvivvptn..........................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  qlteeetqrllrm...................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lkrtqhslkeleeaiasfgdfpdetelerelasakgeeavlcekvksgevlinrieseaaqlte
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  mpvdrllpvlkemefteneqkimgqvmielekrlsflvdvgvgylslmrradtlsggesqrirl
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  dqalqsqrdaeeelgrrqrkledcesslnsikklldqtdaewksfveekgfsaslkvehwtefe
gi|294102032|ref|YP_003553890.1|  fnkiieviveatawalsenatlvedrhvykaieekrfrsnliqeriqraye.............
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  dvdndgnitg......................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  eerrlcyvgmtraeeklymsgarsrrlfgtvfrnglsrflweipd...................
gi|294101779|ref|YP_003553637.1|  vengfrlpscldnrplnwrefkkylrqvifisatpgdwerevstcvaeqiirp...........
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  qiddwrlmahflgpsavlasfleksdsflrafpawkrrgvaanmrkaidmarefeeaigtslpg
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  rlrslsgelentelsldegldrlrelgvqsyelwenikeidserarlsaeteslvertsllrer
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  atqigsklsgvlyvldeptiglhsrdtdrllrtlrsirdlgntvvvvehdretmlaadaivemg
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  slvkqlrgrlaqirdmekqlsssqeyisakeeeihslfrslslgpwsklslvspidiltsrlee
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  casylreamerqekfaepdvsnekenvirvmtvhgskglefpvlavlglertssagekgslmps
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  caeahervqieeekvkdsqrqvdsarlelnqiislwedayhypgtenisleeyeeeslahvrrl
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  pgageqgg........................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  aeeqwnqitmiqrekkrneeiyerahkawnesrtlkkelfeqakvhdepsflelgerwqrcndl
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  pkmgvalsripgernsgqaplawslsrlfeeqeeyeewqrlfyvactrardslilcghlpwrrd
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ekkvrelgdydlgvlseneslknrlafltvqiedvhggigelqsliqstdervgllfgealknt
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  kkiienhrlsllaiaggnenltkvleelpkrtpaesqiligeskeqeqllsqqleelneerghl
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  g...............................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  derfnslfqrlfgggeahleleeglslweagvdifarppgkrlqnlaqlsggeqsltaiallfa
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ktridelekdkelsalflerekleeelrlalkewlavvacrcvleqtrqkheqerqpevfkkag
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d2eyqa5                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  tmevaevplaildevdasldeynllrfidlvsdyamhmqilamthrrstmeradvlygvtmdep
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  dflelmtegryslistaseeggfsveleeksgflrkkedvwssgladqvylsirlalaelygkr
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                
                                                                                
d2eyqa5                             ............................................
gi|294102520|ref|YP_003554378.1|  ............................................
gi|294102529|ref|YP_003554387.1|  ............................................
gi|294102437|ref|YP_003554295.1|  ............................................
gi|294102168|ref|YP_003554026.1|  ............................................
gi|294101779|ref|YP_003553637.1|  ............................................
gi|294102457|ref|YP_003554315.1|  ............................................
gi|294101625|ref|YP_003553483.1|  ............................................
gi|294101185|ref|YP_003553043.1|  ............................................
gi|294102626|ref|YP_003554484.1|  ............................................
gi|294101765|ref|YP_003553623.1|  ............................................
gi|294102479|ref|YP_003554337.1|  ............................................
gi|294101904|ref|YP_003553762.1|  ............................................
gi|294102557|ref|YP_003554415.1|  ............................................
gi|294101807|ref|YP_003553665.1|  ............................................
gi|294101806|ref|YP_003553664.1|  ............................................
gi|294102649|ref|YP_003554507.1|  ............................................
gi|294101185|ref|YP_003553043.1|  ............................................
gi|294102868|ref|YP_003554726.1|  ............................................
gi|294102500|ref|YP_003554358.1|  ............................................
gi|294102409|ref|YP_003554267.1|  ............................................
gi|294102354|ref|YP_003554212.1|  ............................................
gi|294101565|ref|YP_003553423.1|  ............................................
gi|294101424|ref|YP_003553282.1|  ............................................
gi|294101976|ref|YP_003553834.1|  ............................................
gi|294101061|ref|YP_003552919.1|  ............................................
gi|294101048|ref|YP_003552906.1|  ............................................
gi|294101977|ref|YP_003553835.1|  ............................................
gi|294101084|ref|YP_003552942.1|  ............................................
gi|294101565|ref|YP_003553423.1|  ............................................
gi|294101786|ref|YP_003553644.1|  ............................................
gi|294101493|ref|YP_003553351.1|  ............................................
gi|294101884|ref|YP_003553742.1|  ............................................
gi|294101894|ref|YP_003553752.1|  ............................................
gi|294101778|ref|YP_003553636.1|  ............................................
gi|294102313|ref|YP_003554171.1|  ............................................
gi|294102640|ref|YP_003554498.1|  ............................................
gi|294101376|ref|YP_003553234.1|  ............................................
gi|294102641|ref|YP_003554499.1|  ............................................
gi|294101359|ref|YP_003553217.1|  ............................................
gi|294102459|ref|YP_003554317.1|  ............................................
gi|294101785|ref|YP_003553643.1|  ............................................
gi|294101376|ref|YP_003553234.1|  ............................................
gi|294102074|ref|YP_003553932.1|  ............................................
gi|294102442|ref|YP_003554300.1|  ............................................
gi|294101577|ref|YP_003553435.1|  ............................................
gi|294101171|ref|YP_003553029.1|  ............................................
gi|294102413|ref|YP_003554271.1|  ............................................
gi|294102187|ref|YP_003554045.1|  ............................................
gi|294102332|ref|YP_003554190.1|  ............................................
gi|294102831|ref|YP_003554689.1|  ............................................
gi|294101321|ref|YP_003553179.1|  ............................................
gi|294101626|ref|YP_003553484.1|  ............................................
gi|294101069|ref|YP_003552927.1|  ............................................
gi|294102759|ref|YP_003554617.1|  ............................................
gi|294101055|ref|YP_003552913.1|  ............................................
gi|294101254|ref|YP_003553112.1|  ............................................
gi|294102760|ref|YP_003554618.1|  ............................................
gi|294101659|ref|YP_003553517.1|  ............................................
gi|294101172|ref|YP_003553030.1|  ............................................
gi|294102017|ref|YP_003553875.1|  ............................................
gi|294101748|ref|YP_003553606.1|  ............................................
gi|294102409|ref|YP_003554267.1|  ............................................
gi|294102070|ref|YP_003553928.1|  ............................................
gi|294102390|ref|YP_003554248.1|  ............................................
gi|294101403|ref|YP_003553261.1|  ............................................
gi|294101730|ref|YP_003553588.1|  ............................................
gi|294102602|ref|YP_003554460.1|  ............................................
gi|294102663|ref|YP_003554521.1|  ............................................
gi|294101436|ref|YP_003553294.1|  ............................................
gi|294102150|ref|YP_003554008.1|  ............................................
gi|294101607|ref|YP_003553465.1|  ............................................
gi|294102035|ref|YP_003553893.1|  ............................................
gi|294102412|ref|YP_003554270.1|  ............................................
gi|294101660|ref|YP_003553518.1|  ............................................
gi|294102549|ref|YP_003554407.1|  ............................................
gi|294102841|ref|YP_003554699.1|  ............................................
gi|294101272|ref|YP_003553130.1|  ............................................
gi|294101433|ref|YP_003553291.1|  ............................................
gi|294101963|ref|YP_003553821.1|  ............................................
gi|294101356|ref|YP_003553214.1|  ............................................
gi|294102542|ref|YP_003554400.1|  ............................................
gi|294101861|ref|YP_003553719.1|  ............................................
gi|294102400|ref|YP_003554258.1|  ............................................
gi|294102043|ref|YP_003553901.1|  ............................................
gi|294101077|ref|YP_003552935.1|  ............................................
gi|294102348|ref|YP_003554206.1|  ............................................
gi|294102040|ref|YP_003553898.1|  ............................................
gi|294101613|ref|YP_003553471.1|  gls.........................................
gi|294101367|ref|YP_003553225.1|  ............................................
gi|294101893|ref|YP_003553751.1|  ............................................
gi|294101841|ref|YP_003553699.1|  ............................................
gi|294102070|ref|YP_003553928.1|  ............................................
gi|294102221|ref|YP_003554079.1|  ............................................
gi|294101356|ref|YP_003553214.1|  ............................................
gi|294101345|ref|YP_003553203.1|  ............................................
gi|294102145|ref|YP_003554003.1|  ............................................
gi|294101756|ref|YP_003553614.1|  ............................................
gi|294102549|ref|YP_003554407.1|  ............................................
gi|294101372|ref|YP_003553230.1|  ............................................
gi|294101016|ref|YP_003552874.1|  ............................................
gi|294101780|ref|YP_003553638.1|  ............................................
gi|294101686|ref|YP_003553544.1|  ............................................
gi|294102507|ref|YP_003554365.1|  ............................................
gi|294101471|ref|YP_003553329.1|  ............................................
gi|294101845|ref|YP_003553703.1|  ............................................
gi|294101553|ref|YP_003553411.1|  ............................................
gi|294101853|ref|YP_003553711.1|  ............................................
gi|294101780|ref|YP_003553638.1|  ............................................
gi|294102079|ref|YP_003553937.1|  ............................................
gi|294101472|ref|YP_003553330.1|  ............................................
gi|294102235|ref|YP_003554093.1|  ............................................
gi|294102390|ref|YP_003554248.1|  ............................................
gi|294101443|ref|YP_003553301.1|  ............................................
gi|294101748|ref|YP_003553606.1|  ............................................
gi|294101649|ref|YP_003553507.1|  ............................................
gi|294101715|ref|YP_003553573.1|  ............................................
gi|294101925|ref|YP_003553783.1|  ............................................
gi|294101367|ref|YP_003553225.1|  ............................................
gi|294101751|ref|YP_003553609.1|  ............................................
gi|294101046|ref|YP_003552904.1|  ............................................
gi|294101779|ref|YP_003553637.1|  ............................................
gi|294101226|ref|YP_003553084.1|  ............................................
gi|294101892|ref|YP_003553750.1|  ............................................
gi|294102315|ref|YP_003554173.1|  ............................................
gi|294102188|ref|YP_003554046.1|  ............................................
gi|294102320|ref|YP_003554178.1|  ............................................
gi|294102169|ref|YP_003554027.1|  ............................................
gi|294101254|ref|YP_003553112.1|  ............................................
gi|294102077|ref|YP_003553935.1|  ............................................
gi|294102510|ref|YP_003554368.1|  ............................................
gi|294101748|ref|YP_003553606.1|  ............................................
gi|294101141|ref|YP_003552999.1|  ............................................
gi|294101018|ref|YP_003552876.1|  ............................................
gi|294101692|ref|YP_003553550.1|  ............................................
gi|294101032|ref|YP_003552890.1|  ............................................
gi|294101031|ref|YP_003552889.1|  ............................................
gi|294101431|ref|YP_003553289.1|  ............................................
gi|294102167|ref|YP_003554025.1|  ............................................
gi|294101458|ref|YP_003553316.1|  ............................................
gi|294102320|ref|YP_003554178.1|  ............................................
gi|294101940|ref|YP_003553798.1|  ............................................
gi|294102120|ref|YP_003553978.1|  ............................................
gi|294101791|ref|YP_003553649.1|  ............................................
gi|294102136|ref|YP_003553994.1|  ............................................
gi|294101830|ref|YP_003553688.1|  ............................................
gi|294102042|ref|YP_003553900.1|  ............................................
gi|294102015|ref|YP_003553873.1|  ............................................
gi|294102787|ref|YP_003554645.1|  meplplilddvfvrfderrqigaarvvldvasrgqillfscrrd
gi|294102032|ref|YP_003553890.1|  ............................................
gi|294102010|ref|YP_003553868.1|  ............................................
gi|294101586|ref|YP_003553444.1|  ............................................
gi|294101458|ref|YP_003553316.1|  ............................................
gi|294102625|ref|YP_003554483.1|  ............................................
gi|294102478|ref|YP_003554336.1|  ............................................
gi|294101874|ref|YP_003553732.1|  ............................................
gi|294102071|ref|YP_003553929.1|  ............................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0052549 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes