SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

P-loop containing nucleoside triphosphate hydrolases alignments in Aminobacterium colombiense DSM 12261

These alignments are sequences aligned to the 0054935 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  dieiarsakmkpivevaaqlgideeelelygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102529|ref|YP_003554387.1|  dieiaqnaelkpivevaaqlginedeleyygkykakvtyglwnrikdrpdgklvlvtaitptpa
gi|294102437|ref|YP_003554295.1|  veiiigaqwgdegkgrvvdalgnrvevfaryqgganaghtvivedekyvfhllpsgmlypcklc
gi|294102168|ref|YP_003554026.1|  dsildklnprqqeavrycdgpllvlag.....................................
gi|294101779|ref|YP_003553637.1|  adwgpsgdqpeaieklveslkngt........................................
gi|294102457|ref|YP_003554315.1|  tkfifvtggvvsslgkgitaaslgvllkkrgfrvsiikldpylnvdagtmnpfqhgevfvtddg
gi|294101625|ref|YP_003553483.1|  emkkirnigiaahid.................................................
gi|294101185|ref|YP_003553043.1|  tyealdkygrdlvkmarlgkldpvigrdeevrrvirilsrktknn...................
gi|294102626|ref|YP_003554484.1|  tqpgqfkaitadaplvavsagagtgktwtlawrfiwilvtgradtneiltltftekaalemaer
gi|294101765|ref|YP_003553623.1|  ydaafpakdivdfvdriineaakngasdihieglsawsrvrfridgycravysfsldfhpaiis
gi|294102479|ref|YP_003554337.1|  hpvplgviqga.....................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  yikkivkdfg......................................................
gi|294101807|ref|YP_003553665.1|  tlpvsrdmlgrifngrgepidggapilpdakldingmpmnpfsrdypsefiqtgistidgmnpm
gi|294101806|ref|YP_003553664.1|  vietiaviknesgeeknvvmlqrwpvrkprpvarrlppiiplttgqrvv...............
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ipvtrlmegerekllkldeilhqrvigqdeavelvadavirarsgikdprrpvgs.........
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ltprmivecldryivgqekakravaialrnrmrrrnlprdlanevapk................
gi|294102409|ref|YP_003554267.1|  pneralkryrqiaddinglepeysaksdedlrslvadfkrranegesldnllvevfalvrevsr
gi|294102354|ref|YP_003554212.1|  kpedirs.........................................................
gi|294101565|ref|YP_003553423.1|  ipvtqlteeetqrllrmeeeihcrligqeeavsavarairrarsgmkdprrpvgs.........
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  kmpvglslvgqvlngrgrsidgtplsfidkdlpitgmpinpvrrtspnayvetgissidmmntl
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  dks.............................................................
gi|294101977|ref|YP_003553835.1|  engveltmkqrwevrrprpvlsrlsfdaplltgqrildtl........................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ptldqlgidlseksrkdeldpvigrdkeiqrviqilarrtknn.....................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  aekalhgdiralariislveneapeseeimkylyphtg..........................
gi|294101894|ref|YP_003553752.1|  dtpkpaevkkfldqyvigqedakkilsvavynhfkristmseenddielqk.............
gi|294101778|ref|YP_003553636.1|  dnrpkvtfddvagcdeskeelseviqflrdpgkfralgakvpk.....................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  isyedigglgpqiqrvremielplrfpqvfdr................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  skvlilsptrelsqqiwkeakwfgnyinvsaaslvggmdmsqqirslrdgsavvtgtpgrvldh
gi|294102459|ref|YP_003554317.1|  lrngdviwgmvrppkdqehyeallrvemvnfadpeaarkrphfgtltpifpdsrltletdpdei
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  pdvtwsdiggleaikeelieavqwplkynsvyek..............................
gi|294102074|ref|YP_003553932.1|  m...............................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  l...............................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  einrlhddllnevfgygpiqplldddtvteimvngceqvfverwgkieptdvffnndnhirrii
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  mlsiavtnqkggvgktttcvnlsaelgrlgysvla.............................
gi|294101321|ref|YP_003553179.1|  akphlnvgt.......................................................
gi|294101626|ref|YP_003553484.1|  akphlnvgt.......................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  p...............................................................
gi|294102760|ref|YP_003554618.1|  tdkv............................................................
gi|294101659|ref|YP_003553517.1|  tlqgvg..........................................................
gi|294101172|ref|YP_003553030.1|  ni..............................................................
gi|294102017|ref|YP_003553875.1|  yirpqinnglnlkieggrhpvieatfldlp..................................
gi|294101748|ref|YP_003553606.1|  vldslrgtrwkkavektrervreevknlvrlyarrellkgyafpvaseiyrhfveafpyvetpd
gi|294102409|ref|YP_003554267.1|  pmvrsdfpdviyrtslekfhavaeeveetysngqpvlvgttsienseriskllkarkiphqvln
gi|294102070|ref|YP_003553928.1|  fehvvgisalhkryiddlmdmavsllpsdeeeerdpeeir........................
gi|294102390|ref|YP_003554248.1|  dplpdflrlkhafpplydsilemhypqgreswkkardrlayqelfvlqtgmalrrgersrlaek
gi|294101403|ref|YP_003553261.1|  redilelaiddirskfgegsimrlgdpfkvqvevistgilpldvalgigg..............
gi|294101730|ref|YP_003553588.1|  ekrvsha.........................................................
gi|294102602|ref|YP_003554460.1|  vqaekirnla......................................................
gi|294102663|ref|YP_003554521.1|  i...............................................................
gi|294101436|ref|YP_003553294.1|  lkc.............................................................
gi|294102150|ref|YP_003554008.1|  slsrirnfciiah...................................................
gi|294101607|ref|YP_003553465.1|  prviv...........................................................
gi|294102035|ref|YP_003553893.1|  rrfvqvymgdgkgkttaalglairaagwnmkvgiiqfmkgwpqygelaslarfpeiqlvqtgrp
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  msi.............................................................
gi|294102549|ref|YP_003554407.1|  lw..............................................................
gi|294102841|ref|YP_003554699.1|  pavv............................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  kkdvgkviavgs....................................................
gi|294101963|ref|YP_003553821.1|  khmeprpp........................................................
gi|294101356|ref|YP_003553214.1|  dssekavaihfpqcprsgqe............................................
gi|294102542|ref|YP_003554400.1|  r...............................................................
gi|294101861|ref|YP_003553719.1|  lrpsslqdfvgqqklkdklsiyvqaarqrkeald..............................
gi|294102400|ref|YP_003554258.1|  vtgfstgfyqfdrmtgglqpgslniiaarpsmgktalalniaqyggverkepilifslemsaeq
gi|294102043|ref|YP_003553901.1|  mf..............................................................
gi|294101077|ref|YP_003552935.1|  mp..............................................................
gi|294102348|ref|YP_003554206.1|  l...............................................................
gi|294102040|ref|YP_003553898.1|  ksp.............................................................
gi|294101613|ref|YP_003553471.1|  mfierlrlkgfksfggsheltfspgftaivgpngsgksnildglrwvlgegspnclritrqsdl
gi|294101367|ref|YP_003553225.1|  ep..............................................................
gi|294101893|ref|YP_003553751.1|  pwntyteenlditkaqrildedhyglvkvkerile.............................
gi|294101841|ref|YP_003553699.1|  d...............................................................
gi|294102070|ref|YP_003553928.1|  i...............................................................
gi|294102221|ref|YP_003554079.1|  mvhhvk..........................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  p...............................................................
gi|294102145|ref|YP_003554003.1|  eislvlgtaghid...................................................
gi|294101756|ref|YP_003553614.1|  p...............................................................
gi|294102549|ref|YP_003554407.1|  pflemtrltv......................................................
gi|294101372|ref|YP_003553230.1|  ytgeemveisthggtlvaqkclesligkgarlaepgeftrraflngkidlsqaeavlgiirsks
gi|294101016|ref|YP_003552874.1|  lnpnyifnsfvvgksnrlahaaslavaetpgeayn.............................
gi|294101780|ref|YP_003553638.1|  vitgpsgsgksslafdtlyaegqrryveslsayarqflgiqkkpdvddisglspaisieqkgts
gi|294101686|ref|YP_003553544.1|  idesgcekprssdlmavniidvrppqrftsgipeldrvlgggwv....................
gi|294102507|ref|YP_003554365.1|  pnpdladikgqagakraleiaaag........................................
gi|294101471|ref|YP_003553329.1|  flrkg...........................................................
gi|294101845|ref|YP_003553703.1|  mleelslrniggldsahlhf............................................
gi|294101553|ref|YP_003553411.1|  dvdykvvkslvdsirgrcigqevldsitpgqqvvaivyeelvslmgedvvpfiisskppt....
gi|294101853|ref|YP_003553711.1|  lrveapipgkpyvgieipnpkrrgvllrrilesqafeqadynlplpmgvrvdsrpliigledlp
gi|294101780|ref|YP_003553638.1|  ahhnlkeidvaipsrvfscisgvsgsgkssllydvlykgmkrildkdfreragkhlsidgaeqf
gi|294102079|ref|YP_003553937.1|  mknl............................................................
gi|294101472|ref|YP_003553330.1|  f...............................................................
gi|294102235|ref|YP_003554093.1|  it..............................................................
gi|294102390|ref|YP_003554248.1|  ppgrtpiqtrwlkkkeegrlwafirercsareriywvcplidesetlsvasvteryeylkklfp
gi|294101443|ref|YP_003553301.1|  qwerpladrmrpsslddfvgqnhllapgtplrqilqsgkvps......................
gi|294101748|ref|YP_003553606.1|  ppynrvpvltmvgprkknlihravlqelnrggqvffvsnrinrlkgkyeelkimfpearismah
gi|294101649|ref|YP_003553507.1|  mr..............................................................
gi|294101715|ref|YP_003553573.1|  wtlpelskkpffvfydllhpllgekgipltiecgrsfhvlvvtgpntggktvalktvgmgiila
gi|294101925|ref|YP_003553783.1|  sieigkhsssdnlsvyvdihklilr.......................................
gi|294101367|ref|YP_003553225.1|  lagni...........................................................
gi|294101751|ref|YP_003553609.1|  pvrpktggqklyieam................................................
gi|294101046|ref|YP_003552904.1|  nav.............................................................
gi|294101779|ref|YP_003553637.1|  t...............................................................
gi|294101226|ref|YP_003553084.1|  l...............................................................
gi|294101892|ref|YP_003553750.1|  ppqtlpe.........................................................
gi|294102315|ref|YP_003554173.1|  sdnlvlydskdltthg................................................
gi|294102188|ref|YP_003554046.1|  eriavlscrggaggssfsislalqlasmgkrtalidgdlymgdvafllntpyelnwtswanecl
gi|294102320|ref|YP_003554178.1|  ekytniiideahrfrtettityeklaeicrgkrvilvtatpynnspkdilsllklfqkgqksti
gi|294102169|ref|YP_003554027.1|  svmaadeefarrmrdeshhrgilv........................................
gi|294101254|ref|YP_003553112.1|  kkitvl..........................................................
gi|294102077|ref|YP_003553935.1|  ryrrekagip......................................................
gi|294102510|ref|YP_003554368.1|  hmakgkrkleelvqkldlilevrdaraphltsspmsdqlsricpvyivlsradlaeegatkawl
gi|294101748|ref|YP_003553606.1|  qvhlpvdggarawilggasvpllvvfsdqrqaedfvsdfenlwegeivrllyelplsvegvrnk
gi|294101141|ref|YP_003552999.1|  drtc............................................................
gi|294101018|ref|YP_003552876.1|  lewaaglnllvgnngsgktnaleaihilsgwgpfrssrksflvnwdteekqaylrgyfsgetnl
gi|294101692|ref|YP_003553550.1|  iwdsfmqqrntvfvaeaptgigktfallapalkwalpqekrilfltagitlqeqlirkdlprlk
gi|294101032|ref|YP_003552890.1|  mfrltva.........................................................
gi|294101031|ref|YP_003552889.1|  pk..............................................................
gi|294101431|ref|YP_003553289.1|  ek..............................................................
gi|294102167|ref|YP_003554025.1|  lv..............................................................
gi|294101458|ref|YP_003553316.1|  aplcipqlevlikgmflkdrfldiirhfvlfqsdgkeikkilagyhqyhavnkalqstq.....
gi|294102320|ref|YP_003554178.1|  fkrleyqeqavlnakkivleyggvfisdvvglgktyisamlagqldgrtlviappvllektnpg
gi|294101940|ref|YP_003553798.1|  rlgirrldtafd....................................................
gi|294102120|ref|YP_003553978.1|  rtakglamac......................................................
gi|294101791|ref|YP_003553649.1|  h...............................................................
gi|294102136|ref|YP_003553994.1|  mvkqidirkyrkmedlslvfsqginilsgtngtcktsllhivsnsfqevnkgcpwvtdasclta
gi|294101830|ref|YP_003553688.1|  rc..............................................................
gi|294102042|ref|YP_003553900.1|  iaidiarlllcekknacgqclsccswhekthpdlvlsgslekaptisecreiavelslyp....
gi|294102015|ref|YP_003553873.1|  i...............................................................
gi|294102787|ref|YP_003554645.1|  mrfiefkirsfgllenmeghfpagl.......................................
gi|294102032|ref|YP_003553890.1|  lekfigqeravqaisfglsve...........................................
gi|294102010|ref|YP_003553868.1|  tllaslirlyewp...................................................
gi|294101586|ref|YP_003553444.1|  yif.............................................................
gi|294101458|ref|YP_003553316.1|  vviadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltdkntrvvfg
gi|294102625|ref|YP_003554483.1|  ivagsprmemetlarelvlwknkkgylsgqeilpaetpw.........................
gi|294102478|ref|YP_003554336.1|  ipvisvgnitlggtnktpfvemlsrhfynmgvrvgivsrgyggrtsepvvikgtssereivgde
gi|294101874|ref|YP_003553732.1|  h...............................................................
gi|294102071|ref|YP_003553929.1|  lqehpgpaillfperalaeffysfletegveniflwpsvggkklweawnrtrsgehkiiiggpg


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  gegkttttvglaqglaklgkkvsialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102529|ref|YP_003554387.1|  gegkttttvglgqglaklgkrvcialrepslgpsfgvkggaagggysqvvpmedinlhftgdlh
gi|294102437|ref|YP_003554295.1|  vvgngvvvdpeqllkelhtlqeqgkdrarlmisgsahvvmpyhkildkadeqfrskdkkigttg
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  aetdldlghyerfideslsadnnvttgkiystviskerhgcylggtvqviphitneiqdrilka
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  iknlllqlamelpsqkvffqkaadridegyistihsfsmrvlkecglateldpesgtiappqes
gi|294101765|ref|YP_003553623.1|  rikimasmdisdkrrpqdgqfniktgsqdfldvrvsslptvdgekialrlldsskipdniyqlg
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  vrgqklpifsgsglphnrmaaqiarqatvisghedfavvfaamgitfeeasffmedfrrtgaiq
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  rtlglrhfdvqlmggmalhegkitemktgegktlvatlavvlnalsgngvhvvtvndylakrda
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  vrgqklpifsgsglpaneiaaqivqqaavpgretdflvifaamgitrrearyfidtfestgain
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  irrgtldtsgik....................................................
gi|294102459|ref|YP_003554317.1|  strli...........................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  dkivaplgrrideaspmvdarlpdgsrvnavippvsidgptltvrkfrrepftaqdlialgtls
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  qlraeqeilqdmesshpmdr............................................
gi|294102409|ref|YP_003554267.1|  akyhekeaqivaqagrfgavtvatnmagrgtdivlggnpd........................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  apilpesgrlkerflkeifpyplteaqkkvsleisqdmalnipm....................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  dfvkkgsplqfdieeaqrglelakkwiekglf................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  lvqrmlgsea......................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lfqgsislptatetevslciredpkictikrefspetgtslfvdgmrirlqdlddvkrqwhmeg
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  eealraatrtlrgelssfakdiynemltisssievgldfpeedipfienegvesalytlkqgle
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  hnprstvgtvteiydylrllygrlgvpycpscgkavirysldeivdvifrnypdqrleilspqv
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  rnvvlvdqspigrtprsnpatytglftlirelfaelpeskirgyapgrfsfnvrggrceacsga
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  dlnvgllhgqlpsseketimrsfarghldlivsttvie..........................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  gqmaekdlertm....................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  wcgfplpakegtvvgnldnvfadigdeqsieqnlstfsahlkniihilse..............
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  sgtvdgerylalgpkdlmimptaknpvqaelvksgmgdrlieslsdrfdyivvdlhrn......
gi|294102320|ref|YP_003554178.1|  pnlpnlesffnsldkklkqldrkkdydkyietvkenareirnkvlkylmvrrtraeieeyfsrd
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  qffssikqkawafnflegriqllrrdlaklrpahrel...........................
gi|294101748|ref|YP_003553606.1|  slllqrg.........................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  divatvg.........................................................
gi|294101692|ref|YP_003553550.1|  ellgydvsfgllkgrgnyvcvrralelehegflsfgdsgaasiylsewlkktqtgdlselklps
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  swp.............................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ikkvnklinpkietltkgdktyndpanqvkgtlftveyydhpslefrkhnskannryaikpyyg
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  dyidiydmtravedgttvkifyesriakldlpeemkpqidseyeeiteyqeysqkerlkskwar
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  plllasr.........................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  aifap...........................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  aittahnllaalldnhlhqgnplnidprrvvfrrvidlneralryvn.................
gi|294102529|ref|YP_003554387.1|  aitsahnllsalidnhlhqgnplnidprrvvfrrvvdlneralrhvi.................
gi|294102437|ref|YP_003554295.1|  rgigpcyvdkfnrcgiriedlfdpdilreklsfnle............................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  addndiviaeiggtvgdiegqpflea......................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  lfwkeaeealdrwdgnwfakssshlwaqriaklfsdplfmdsvntfgpnatvelaksslalfas
gi|294101765|ref|YP_003553623.1|  feqrdlellekllsqkeg..............................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  rtvmfvnladdpa...................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ewmgpiyrflg.....................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ngiffmnlasdsaverlltprmaltaaeyfafekgydvlvimtdmlyycesl............
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  desvsflrvatearyn................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  eqfafigqgevaeaihhrpqqrrsilealfgidqyrkkredanqklkfaseelarletlvselt
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  dlldrcn.........................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  rgkkgefknlfaqnrekgfmrvrvdgtiywleeeialdknkrhtievvidrlkvlddrkgrise
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  gsvkvsmlflpdvyvdcevcggtrynretlevrykgrniadvlnmtvddafeffkeipriask.
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ikeqglkfpkvakpvplfyelnekedfifnrtiehianqfkyarympmlyyknelnqlerqsqr
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  dfpifprvaaqvrgclghrcpyrdrcfiqkalkkaqnwdvivsnyhmyfayvmngkgtfpvdfd
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  knrgdtlpfcpviylglgrlfpfgefqndeairgvkgelpstyqdeiktfyedftgisiesssp
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  leaivgteqrikq...................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  qgqtpkdlwqwgsdlfsrdqdavdtarltlfrrwedewhrflqpesgifynlnelggtgklcgn
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  srrdeiaamvtiaekarrlldeldekrrgyyfsrraflerelysfqsrihalerrknraaewet
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  aveaalslsggyvllvteggkeqlltenyacpdcgislpeieprlfsfnnpygacpdcsglgsh
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  nmgrfmkillvkrlessffafrntgqrflnsynmflkelddgfiyvskkysnkifellesddde
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  v...............................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  qqmgdfktradfisdvegidsntisagednlfilltaiislkyyyeatalshevt.........
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  vrnlitrwqq......................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  iwkeglsfyqslfnsyeqqkkvheerteslgfqretlrrqcfataltvksarerliaqkeekrh
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ehfseehaidpvrsveegallpwkkkhymlrklytfsqskewdltqpygtlpknvqnfilygsd
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  alqklidegkaeryssedfkd...........................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  veevlskvdeeatlargtsysltqnlhkkkeevsalwqklsnlrsslraerqrrqeygneyarv
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  erlpmffsdrgerhqymgryegllpwlegrwnetesenvleelagyrvedicqtchgyrlrpea
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  egecvkilsrlqarsealdknekeleeaknkvfvaeketetykkefeythlsykkiierhgeiy
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  lmvqlnhhtidelvempvdrllpvlkemefteneqkimgqvmielekrlsflvdvgvgyls...
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  vqcqrlatslsqlkknvdvlenqletvlenteqrlypepvrvilaaqklgklpiqiklaaeafk
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ceeklaapleaylggrqfwlfvksleeaqlgielvkqkragritflpleqchprnpdygfplpc
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  qgtvgwatdliaseqlwspavnhllgdlliveeydvgmnlaragasfpivtlqgdvftvggsvs
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ggkfrktggaierrlqiedleknlkdkrgslervvsllqeaeelecviakerafwkekeqeaek
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  kllshsirferqreeivrlekersfflndvedsgkllkrtqhslkeleeaiasfgdfpdetele
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  relasakgeeavlcekvksgevlinrieseaaqlterlrslsgelentelsldegldrlrelgv
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  qsyelwenikeidserarlsaeteslvertsllrercaeahervqieeekvkdsqrqvdsarle
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  lnqiislwedayhypgtenisleeyeeeslahvrrlekkvrelgdydlgvlseneslknrlafl
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ................................................................
gi|294102529|ref|YP_003554387.1|  ................................................................
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102626|ref|YP_003554484.1|  ................................................................
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  tvqiedvhggigelqsliqstdervgllfgealkntderfnslfqrlfgggeahleleeglslw
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ................................................................
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  ................................................................
gi|294101779|ref|YP_003553637.1|  ................................................................
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  ................................................................
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ................................................................
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  ................................................................
gi|294101032|ref|YP_003552890.1|  ................................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  ................................................................
gi|294102032|ref|YP_003553890.1|  ................................................................
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ................................................................
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                              10           20        30        40   
                                                               |            |         |         |   
d3dhwc1                             ..................MIKLSNITKVFHQGTRT...IQALNNVSLHVPAGQIYGVIGASGAG
gi|294102520|ref|YP_003554378.1|  ..................-----------------...--------------------------
gi|294102529|ref|YP_003554387.1|  ..................-----------------...--------------------------
gi|294102437|ref|YP_003554295.1|  ..................---L-------------...--------------------------
gi|294102168|ref|YP_003554026.1|  ..................-----------------...----------------------AGSG
gi|294101779|ref|YP_003553637.1|  ..................-----------------...--------------RFQTLLGVTGSG
gi|294102457|ref|YP_003554315.1|  ..................-----------------...--------------------------
gi|294101625|ref|YP_003553483.1|  ..................-----------------...------------------------AG
gi|294101185|ref|YP_003553043.1|  ..................-----------------...----------------PVLIGDPGVG
gi|294102626|ref|YP_003554484.1|  ..................-----------------...--------------------------
gi|294101765|ref|YP_003553623.1|  ..................-----------------...---------------LILVTGPTGSG
gi|294102479|ref|YP_003554337.1|  ..................-IKMEDVWFAYKDE---...QWVLKGVALEVCPGERVAVVGETGGG
gi|294101904|ref|YP_003553762.1|  ..................-ISLTHLTKIFTKGKES...FKAVDDVHLDIDAGELITFLGPSGCG
gi|294102557|ref|YP_003554415.1|  ..................---------SYDDPSNR...VRAVDRVDLHVKEGELITLLGPSGCG
gi|294101807|ref|YP_003553665.1|  ..................-----------------...--------------------------
gi|294101806|ref|YP_003553664.1|  ..................-----------------...-----DAFFPIAKGGTACVPGPFGSG
gi|294102649|ref|YP_003554507.1|  ..................MISIQNLYKTYPCEGGD...FEALRNVSINIQSGEIFGIIGLSGAG
gi|294101185|ref|YP_003553043.1|  ..................-----------------...----------------FIFLGPTGVG
gi|294102868|ref|YP_003554726.1|  ..................-LQLKQLNKKFGHS---...-YAVRDFSFDINEGELVSLLGPSGCG
gi|294102500|ref|YP_003554358.1|  ..................-----------------...---------------NILMVGPTGVG
gi|294102409|ref|YP_003554267.1|  ..................-----------------...--------------------------
gi|294102354|ref|YP_003554212.1|  ..................-----------------...----------------VAIAAHGGAG
gi|294101565|ref|YP_003553423.1|  ..................-----------------...----------------FLFLGPTGVG
gi|294101424|ref|YP_003553282.1|  ..................-IEVKNLHKSFGN----...LHVLQGVSMTVGEGEVVSVIGPSGSG
gi|294101976|ref|YP_003553834.1|  ..................-----------------...--------------------------
gi|294101061|ref|YP_003552919.1|  ..................ILRVEDIHKSYGG----...VEVLRGISFTVRKGETKVFIGPSGTG
gi|294101048|ref|YP_003552906.1|  ..................--------------EDA...VVAVRGVSLAARQGEVFVIMGLSGSG
gi|294101977|ref|YP_003553835.1|  ..................-----------------...--------FPIAIGGAAVLPGGFGTG
gi|294101084|ref|YP_003552942.1|  ..................LIHVENLYKSFEDG---...-EVLNGISIDIHEGDLVSIIGPSGCG
gi|294101565|ref|YP_003553423.1|  ..................-----------------...----------------PVLLGDPGVG
gi|294101786|ref|YP_003553644.1|  ..................LLKVDHLKKHFYTPYGT...LFAVDDVSFSIKEGETLGVVGESGCG
gi|294101493|ref|YP_003553351.1|  ..................LVRVDNIYKTYSMGEVD...VTALQGVSFSVKKGEFLSIMGASGSG
gi|294101884|ref|YP_003553742.1|  ..................-----------------...------------KALVIGITGSPGAG
gi|294101894|ref|YP_003553752.1|  ..................-----------------...--------------SNVLLIGPTGSG
gi|294101778|ref|YP_003553636.1|  ..................-----------------...---------------GVLLLGPPGTG
gi|294102313|ref|YP_003554171.1|  ..................IVNIKELTKRYPMGDHT...FTALSSVDLEFKKGEFCGLIGPSGSG
gi|294102640|ref|YP_003554498.1|  ..................LLDIRNLKKYFNVSKGL...LHAVDDITLTITKGQTLGLVGESGCG
gi|294101376|ref|YP_003553234.1|  ..................-----------------...--------LGVQPPKGVLLYGPPGTG
gi|294102641|ref|YP_003554499.1|  ..................LLDIRNLSVRFNTDSGI...VHAVNNLNLSLRRGKALGFVGETGAG
gi|294101359|ref|YP_003553217.1|  ..................-----------------...--------------------------
gi|294102459|ref|YP_003554317.1|  ..................-----------------...-----DLFAPIGKGQRALLVSPPKAG
gi|294101785|ref|YP_003553643.1|  ..................ILEIRNLRVSYETEDGT...VEALNGIDLDLDEGVTLGIVGETGAG
gi|294101376|ref|YP_003553234.1|  ..................-----------------...--------FNITPPQGILLHGPSGTG
gi|294102074|ref|YP_003553932.1|  ..................-----------------...----------------FVISGPSGAG
gi|294102442|ref|YP_003554300.1|  ..................-IRLAGVTKIFQPD---...IVALEDVYLSIMQGEFVYLVGTTGSG
gi|294101577|ref|YP_003553435.1|  ..................--KARKVCKAFKGR---...-TVVSSVDLDVHMGEIVGLLGPNGAG
gi|294101171|ref|YP_003553029.1|  ..................LLELNGVDKFFGG----...VHAVQSMSFALNEKEIVGLIGPNGAG
gi|294102413|ref|YP_003554271.1|  ..................VLETKGLTMCFGG----...LTAVNSFNMAVPKGSIVGLIGPNGAG
gi|294102187|ref|YP_003554045.1|  ..................-----------------...----------------IIVTGGTGSG
gi|294102332|ref|YP_003554190.1|  ..................-IRISGLRKRYGSGDTA...VDALKMVNMHVAPGEVVGLIGPSGSG
gi|294102831|ref|YP_003554689.1|  ..................-----------------...--------------------------
gi|294101321|ref|YP_003553179.1|  ..................-----------------...-------------------IGHIDHG
gi|294101626|ref|YP_003553484.1|  ..................-----------------...-------------------IGHIDHG
gi|294101069|ref|YP_003552927.1|  ..................ILSVDDLHFSYGE----...TPILKNISLSVKNQEMVMILGPNGSG
gi|294102759|ref|YP_003554617.1|  ..................MIEIVDLSITYKTESHD...VSAVKNAFLSIPRGRITGLVGESGSG
gi|294101055|ref|YP_003552913.1|  ..................ILEIHQLAVAFNNK---...-KILKNINANIYPHQITAIIGPSGCG
gi|294101254|ref|YP_003553112.1|  ..................LVQMQEITKEFAG----...IVANHNIDFDVNRGEVHALLGENGAG
gi|294102760|ref|YP_003554618.1|  ..................-------SVFYPSRDGKnsgQWALRNISLSLQQGESLALIGESGSG
gi|294101659|ref|YP_003553517.1|  ..................--------FSYPE--AD...SSALDQVSFQVREGEWLALLGSNGSG
gi|294101172|ref|YP_003553030.1|  ..................LLDVQNLQVSYGA----...IRALRGISLQVKEGEIVCVIGANGAG
gi|294102017|ref|YP_003553875.1|  ..................-----------------...-FVPNDIVLDGDEERIALITGPNMAG
gi|294101748|ref|YP_003553606.1|  ..................-----------------...-----------------LLVGDVGFG
gi|294102409|ref|YP_003554267.1|  ..................-----------------...--------------------------
gi|294102070|ref|YP_003553928.1|  ..................-----------------...----------------VSIVGRPNVG
gi|294102390|ref|YP_003554248.1|  ..................-----------------...---------------HRLLQGDVGSG
gi|294101403|ref|YP_003553261.1|  ..................-----------------...----------LPKGRIVEIFGPEGSG
gi|294101730|ref|YP_003553588.1|  ..................-----------------...----------------YLFSGPRGCG
gi|294102602|ref|YP_003554460.1|  ..................-----------------...------------------IIAHIDHG
gi|294102663|ref|YP_003554521.1|  ..................---VSNLNLFYGKN---...-QVLHNINMDIFGKTVTALIGPSGCG
gi|294101436|ref|YP_003553294.1|  ..................-----------------...-----------------GIVGLPLCG
gi|294102150|ref|YP_003554008.1|  ..................-----------------...----------------------IDHG
gi|294101607|ref|YP_003553465.1|  ..................-----------------...-----------------VTSGKGGVG
gi|294102035|ref|YP_003553893.1|  ..................-----------------...--------------------------
gi|294102412|ref|YP_003554270.1|  ..................-LKIEELHVYYGG----...IHAVKGISLHIPKGKIVTLIGANGAG
gi|294101660|ref|YP_003553518.1|  ..................--IIKNLTHTYHPSTPLe..TVALEGINLTTEKGQWLSIVGHTGSG
gi|294102549|ref|YP_003554407.1|  ..................---ISRLTKTFGT----...LRAVDDFSLEIASGTVHSLVGENGAG
gi|294102841|ref|YP_003554699.1|  ..................---FEDVSFGYENG---...TMVLDQASFQVPQGEFLVIIGPNGGG
gi|294101272|ref|YP_003553130.1|  ..................MLRLSHLGKKYNG----...LPVIDQFDLDIEKGSFSVLIGPSGCG
gi|294101433|ref|YP_003553291.1|  ..................-----------------...--------------------GKGGVG
gi|294101963|ref|YP_003553821.1|  ..................-----------------...---------------IVTVMGHVDHG
gi|294101356|ref|YP_003553214.1|  ..................VISVKDVKKTYGDN---...-LIFKDISFSVHRGEKIALVGVNGAG
gi|294102542|ref|YP_003554400.1|  ..................---LKNIKHFYSQR---...-CVLQIPSLEIGQGEILGLLGANGSG
gi|294101861|ref|YP_003553719.1|  ..................-----------------...---------------HILFYGPPGLG
gi|294102400|ref|YP_003554258.1|  ..................-----------------...--------------------------
gi|294102043|ref|YP_003553901.1|  ..................-----------------...----------------ITLEGIDGCG
gi|294101077|ref|YP_003552935.1|  ..................LLRLKSIAFAYPRS---...SPLFTHLSFEIFEKEKIYIRGENGAG
gi|294102348|ref|YP_003554206.1|  ..................-LKVDSITVRRDN----...ATILKDISLRVESGEVTGVLGRNGAG
gi|294102040|ref|YP_003553898.1|  ..................-----------------...--------------KVIVLVGVNGSG
gi|294101613|ref|YP_003553471.1|  eagvdifarppgkrlqnl-----------------...--------------------------
gi|294101367|ref|YP_003553225.1|  ..................LLKMENIGKAYFGN---...-RVLKDVSFTLEKGQILGLVGENGAG
gi|294101893|ref|YP_003553751.1|  ..................-----------------...FLAVRQLAGKEAKGQVLCFVGPPGVG
gi|294101841|ref|YP_003553699.1|  ..................-----------------...----------------VGLVGLPNAG
gi|294102070|ref|YP_003553928.1|  ..................-----------------...-----------------AIVGRPNVG
gi|294102221|ref|YP_003554079.1|  ..................-----------------...-------------RQFVFFGGKGGTG
gi|294101356|ref|YP_003553214.1|  ..................-IQLVNITHFYGEQ---...-GLYNSLNWSITHGSKTGLIGSNGTG
gi|294101345|ref|YP_003553203.1|  ..................LLATQDLSIGYGPKKGT...TLVAGPIATSLYEGELVCLIGPNGVG
gi|294102145|ref|YP_003554003.1|  ..................-----------------...------------------------HG
gi|294101756|ref|YP_003553614.1|  ..................-----------------...------------------IVGRPNVG
gi|294102549|ref|YP_003554407.1|  ..................---------SGDRG---...KDVVKNLTLTVHRGEIVGIAGITGNG
gi|294101372|ref|YP_003553230.1|  ..................-----------------...------TGFLLREGIRVALVGRPNVG
gi|294101016|ref|YP_003552874.1|  ..................-----------------...---------------PLFIWGGVGLG
gi|294101780|ref|YP_003553638.1|  ..................-----------------...--------------------------
gi|294101686|ref|YP_003553544.1|  ..................-----------------...------------SGGVVLLGGQPGIG
gi|294102507|ref|YP_003554365.1|  ..................-----------------...-------------HHNLLFIGSPGSG
gi|294101471|ref|YP_003553329.1|  ..................--------------GSQ...IVLFSHLSVSFKKGEVVGLVGPSGKG
gi|294101845|ref|YP_003553703.1|  ..................-----------------...------------KGRFIAITGESGAG
gi|294101553|ref|YP_003553411.1|  ..................-----------------...---------------LCMMVGLQGSG
gi|294101853|ref|YP_003553711.1|  ..................-----------------...---------------HLLVAGTTGSG
gi|294101780|ref|YP_003553638.1|  ..................-----------------...--------------------------
gi|294102079|ref|YP_003553937.1|  ..................-----------------...---------------VVAIDGPAGAG
gi|294101472|ref|YP_003553330.1|  ..................-LSVENLSILDEEN---...KPLVRNVSFSIPSESVFFLVGETGSG
gi|294102235|ref|YP_003554093.1|  ..................-----------------...----------------LALAGNPNTG
gi|294102390|ref|YP_003554248.1|  ..................-----------------...--------------------------
gi|294101443|ref|YP_003553301.1|  ..................-----------------...----------------CVLYGPPGVG
gi|294101748|ref|YP_003553606.1|  ..................-----------------...--------------------------
gi|294101649|ref|YP_003553507.1|  ..................-----------------...----------------VILLGPPGAG
gi|294101715|ref|YP_003553573.1|  ..................-----------------...--------------------------
gi|294101925|ref|YP_003553783.1|  ..................-----------------...---------------HCAILGSTGSG
gi|294101367|ref|YP_003553225.1|  ..................-LKVEHLWVDMPG----...-ETVRDVSFTVKEGEIFGIGGLAGQG
gi|294101751|ref|YP_003553609.1|  ..................-----------------...-----------RAHDIVFAIGPAGTG
gi|294101046|ref|YP_003552904.1|  ..................-----------------...------------------LSAPTGAG
gi|294101779|ref|YP_003553637.1|  ..................-----------------...------------------LLGVTGSG
gi|294101226|ref|YP_003553084.1|  ..................-----------------...------------------LIGNPNVG
gi|294101892|ref|YP_003553750.1|  ..................-----------------...----------------VAFVGRSNVG
gi|294102315|ref|YP_003554173.1|  ..................-----------------...-----------------MIIGMTGSG
gi|294102188|ref|YP_003554046.1|  ..................-----------------...--------------------------
gi|294102320|ref|YP_003554178.1|  ..................-----------------...--------------------------
gi|294102169|ref|YP_003554027.1|  ..................-----------------...----------------INIIGSPGAG
gi|294101254|ref|YP_003553112.1|  ..................-------------GDRG...IPVVKDLSIDVREREILGLAGIAGNG
gi|294102077|ref|YP_003553935.1|  ..................-----------------...---------------TVALTGYTNSG
gi|294102510|ref|YP_003554368.1|  ..................-----------------...---------------RLAVVGIPNVG
gi|294101748|ref|YP_003553606.1|  ..................-----------------...--------------------------
gi|294101141|ref|YP_003552999.1|  ..................-----------------...------------------LLAPCGSG
gi|294101018|ref|YP_003552876.1|  ..................-----------------...--------------------------
gi|294101692|ref|YP_003553550.1|  ..................-----------------...--------------------------
gi|294101032|ref|YP_003552890.1|  ..................-----------------...-------------------SGKGGTG
gi|294101031|ref|YP_003552889.1|  ..................-----------------...--------------EIVIISGKGGTG
gi|294101431|ref|YP_003553289.1|  ..................-----------------...-------------TKVIVIAGPSGSG
gi|294102167|ref|YP_003554025.1|  ..................-----------------...----------------LGVTGDVGAG
gi|294101458|ref|YP_003553316.1|  ..................-----------------...-----RATMEQGDRRVGVIWHTQGSG
gi|294102320|ref|YP_003554178.1|  ..................-----------------...--------------------------
gi|294101940|ref|YP_003553798.1|  ..................-----------------...---------GVYPGEMLNLAGAQGSL
gi|294102120|ref|YP_003553978.1|  ..................-----------------...----------VEDGSSLILGGGTGVG
gi|294101791|ref|YP_003553649.1|  ..................-----------------...----------VYSGLTILLYGDLGAG
gi|294102136|ref|YP_003553994.1|  ..................-----------------...--------------------------
gi|294101830|ref|YP_003553688.1|  ..................-----------------...----------------LIITGMSGAG
gi|294102042|ref|YP_003553900.1|  ..................-----------------...--------------------------
gi|294102015|ref|YP_003553873.1|  ..................-----------------...----------------LAIIGPTAVG
gi|294102787|ref|YP_003554645.1|  ..................-----------------...----------------SLILGDNESG
gi|294102032|ref|YP_003553890.1|  ..................-----------------...-----------SKGYNIFVLGNPGSG
gi|294102010|ref|YP_003553868.1|  ..................-----------------...--------------KAVAVTGALGSG
gi|294101586|ref|YP_003553444.1|  ..................-----------------...-----------------AVSGMKNSG
gi|294101458|ref|YP_003553316.1|  ..................-----------------...--------------------------
gi|294102625|ref|YP_003554483.1|  ..................-----------------...--------------------------
gi|294102478|ref|YP_003554336.1|  ..................-----------------...--------------------------
gi|294101874|ref|YP_003553732.1|  ..................-----------------...---------------VIAFVGPAGTG
gi|294102071|ref|YP_003553929.1|  ..................-----------------...--------------------------


                                           50                       60                        70    
                                            |                        |                         |    
d3dhwc1                             KSTLI..RCVNLLE.....R..PT........EGSVLVDGQ........EL........TT..L
gi|294102520|ref|YP_003554378.1|  -----..-------.....-..--........---------........--........--..-
gi|294102529|ref|YP_003554387.1|  -----..-------.....-..--........---------........--........--..-
gi|294102437|ref|YP_003554295.1|  -----..-------.....-..--........---------........--........--..-
gi|294102168|ref|YP_003554026.1|  KTRVL..AHKIAY-.....L..IE........KGYASP---........--........--..-
gi|294101779|ref|YP_003553637.1|  KTFTVa.NVLAQF-.....-..--........---------........--........--..-
gi|294102457|ref|YP_003554315.1|  -----..-------.....-..--........---------........--........--..-
gi|294101625|ref|YP_003553483.1|  KTTTT..ERILFYT.....-..--........---------........--........--..-
gi|294101185|ref|YP_003553043.1|  KTAIV..EGLAQ--.....-..--........---------........--........--..-
gi|294102626|ref|YP_003554484.1|  -----..-------.....-..--........---------........--........--..-
gi|294101765|ref|YP_003553623.1|  KSTTL..HALIKQ-.....-..--........---------........--........--..-
gi|294102479|ref|YP_003554337.1|  KSTLM..DLIPRFY.....D..PS........RGKVSVDGC........DV........RT..L
gi|294101904|ref|YP_003553762.1|  KTTIL..RMIAGFE.....K..PT........EGQVLIGGR........DI........TH..L
gi|294102557|ref|YP_003554415.1|  KTTLL..RMIAGFE.....D..PT........EGDVFFGDR........RV........ND..V
gi|294101807|ref|YP_003553665.1|  -----..-------.....-..--........---I-----........--........--..-
gi|294101806|ref|YP_003553664.1|  KTVIQ..HQLAKWA.....-..--........---------........--........--..-
gi|294102649|ref|YP_003554507.1|  KSTLL..RTLNRLE.....E..PS........SGSICIGDT........DI........TR..L
gi|294101185|ref|YP_003553043.1|  KTELA..KTLAEAL.....F..--........---------........--........--..-
gi|294102868|ref|YP_003554726.1|  KTTTL..RMIGGFL.....Q..PD........EGSIILEGE........DI........TH..L
gi|294102500|ref|YP_003554358.1|  KTEIA..RRLADLV.....L..--........---------........--........--..-
gi|294102409|ref|YP_003554267.1|  -----..-------.....-..--........---------........--........--..-
gi|294102354|ref|YP_003554212.1|  KTSLV..EAILF--.....-..-S........NGDI-----........--........--..-
gi|294101565|ref|YP_003553423.1|  KTELA..RRLADFL.....F..--........---------........--........--..-
gi|294101424|ref|YP_003553282.1|  KSTLA..RCICRLE.....D..IN........DGEIYLYGQ........RV........DN..-
gi|294101976|ref|YP_003553834.1|  -----..-------.....-..--........---------........R-........--..-
gi|294101061|ref|YP_003552919.1|  KSTLL..RCINQLT.....I..PD........SGQIWLHGE........EV........TH..-
gi|294101048|ref|YP_003552906.1|  KSTLI..RCVIRLI.....E..PT........SGEIWVNGQ........EV........SS..L
gi|294101977|ref|YP_003553835.1|  KTVTQ..QSLAKW-.....-..--........---------........--........--..-
gi|294101084|ref|YP_003552942.1|  KSTFL..RCLNCLE.....Y..ID........SGTITIAGV........TV........SR..T
gi|294101565|ref|YP_003553423.1|  KTAIV..EGLAQKI.....Q..DG........NIAEILRGK........KI........VQ..L
gi|294101786|ref|YP_003553644.1|  KSTLG..RAVLRLC.....E..PT........SGTVFFDGE........DV........LK..F
gi|294101493|ref|YP_003553351.1|  KSTLM..NIIGCLD.....T..PT........EGHYYLDGT........DV........ST..I
gi|294101884|ref|YP_003553742.1|  KSTLV..DKLILEF.....R..K-........---------........--........--..-
gi|294101894|ref|YP_003553752.1|  KTLLA..QSLAK--.....-..--........---------........--........--..-
gi|294101778|ref|YP_003553636.1|  KTLLA..RAAAG--.....-..--........---------........--........--..-
gi|294102313|ref|YP_003554171.1|  KTTLL..NIIGALD.....A..PS........EGSVVVIDR........NV........EN..L
gi|294102640|ref|YP_003554498.1|  KSTLG..RVVIGLI.....E..AT........GGEVLFKGQ........DA........LK..F
gi|294101376|ref|YP_003553234.1|  KTVIA..RAVANE-.....-..--........---------........--........--..-
gi|294102641|ref|YP_003554499.1|  KTTTA..LAVLQLIqsppgE..IT........NGEIFFDGQ........DV........MK..M
gi|294101359|ref|YP_003553217.1|  -----..-------.....-..--........---------........--........--..-
gi|294102459|ref|YP_003554317.1|  KTTVL..KKIANAV.....T..VN........HPDIIL---........--........--..-
gi|294101785|ref|YP_003553643.1|  KTTLA..KSIMRII.....P..TPpghie...SGTILYKNK........DI........LG..M
gi|294101376|ref|YP_003553234.1|  KTLLV..RALAHE-.....-..--........---------........--........--..-
gi|294102074|ref|YP_003553932.1|  KGTVR..KALFE--.....-..--........---------........--........--..-
gi|294102442|ref|YP_003554300.1|  KTTLM..RLITREL.....I..QT........RGQVTVGDQ........NL........RK..L
gi|294101577|ref|YP_003553435.1|  KTTTF..YMIVGLI.....K..PD........SGRVMIDSK........DI........TP..F
gi|294101171|ref|YP_003553029.1|  KTTIF..NVVTGVY.....D..PD........GGRILFDGE........DI........TP..L
gi|294102413|ref|YP_003554271.1|  KTTVF..NMITGFY.....K..PT........EGNIFFNED........NI........TG..F
gi|294102187|ref|YP_003554045.1|  KTTTL..NVLSSFI.....P..NR........ERIVTIEDA........AE........LS..M
gi|294102332|ref|YP_003554190.1|  KSTLL..KCLGAVI.....E..PT........AGQMMLGDD........VI........YHdgW
gi|294102831|ref|YP_003554689.1|  -----..-------.....-..--........------V--........--........--..-
gi|294101321|ref|YP_003553179.1|  KTTLT..AAITKCL.....S..-T........KGWSNFEAY........DM........I-..-
gi|294101626|ref|YP_003553484.1|  KTTLT..AAITKCL.....S..-T........KGWSNFEAY........DM........I-..-
gi|294101069|ref|YP_003552927.1|  KTTLL..RCLNGIN.....R..PQ........KGTITLEDK........NM........RR..M
gi|294102759|ref|YP_003554617.1|  KSSLL..MAIPGLL.....P..SNtev.....SGAVIFDNL........NL........IS..L
gi|294101055|ref|YP_003552913.1|  KSTFL..KSLNRLV.....E..DErgvtl...SGQIRLDGE........DT........FT..L
gi|294101254|ref|YP_003553112.1|  KSTLM..NILYGLY.....N..PD........RGHILIDGK........KV........SF..S
gi|294102760|ref|YP_003554618.1|  KTSLL..RVLLGLI.....S..PT........EGNVELFGE........NI........DK..C
gi|294101659|ref|YP_003553517.1|  KSTLA..KHLNALL.....L..PS........QGACFVYGM........DT........RE..-
gi|294101172|ref|YP_003553030.1|  KSTLM..NALMSEV.....R..RE........KGLINFSGA........PL........AQ..-
gi|294102017|ref|YP_003553875.1|  KSTYL..RMAALLV.....I..M-........---------........--........--..-
gi|294101748|ref|YP_003553606.1|  KTEIA..MR-----.....-..--........---------........--........--..-
gi|294102409|ref|YP_003554267.1|  -----..-------.....-..--........---------........--........--..-
gi|294102070|ref|YP_003553928.1|  KSSLV..NALAGSD.....R..--........---VLVSDI........PG........TT..R
gi|294102390|ref|YP_003554248.1|  KTAVA..VLA----.....-..--........---------........--........--..-
gi|294101403|ref|YP_003553261.1|  KTTVA..LHGI---.....-..--........---------........--........--..-
gi|294101730|ref|YP_003553588.1|  KTTLA..RLLAKSL.....N..CT........---------........--........--..-
gi|294102602|ref|YP_003554460.1|  KTTLI..DSIFKAA.....Q..IF........RKGAHIEERvm......DS........NE..L
gi|294102663|ref|YP_003554521.1|  KSSFI..RCLNRMN.....D..FIpnvkv...EGDIYLEGK........NI........YS..-
gi|294101436|ref|YP_003553294.1|  KSTVF..NVITR--.....-..--........---------........--........--..-
gi|294102150|ref|YP_003554008.1|  KSTLA..DRLIEY-.....-..--........TGTVEIRKM........KA........QL..L
gi|294101607|ref|YP_003553465.1|  KTTTT..ANVSFAL.....A..KA........GYKVV----........--........--..-
gi|294102035|ref|YP_003553893.1|  -----..-------.....-..--........---------........--........--..-
gi|294102412|ref|YP_003554270.1|  KSSTI..RSIAGLV.....R..SA........KGKILYTSNegv.....EE........NI..L
gi|294101660|ref|YP_003553518.1|  KSTLA..QHLNALI.....V..PE........KGEVIVEGF........VS........R-..P
gi|294102549|ref|YP_003554407.1|  KSTVV..KCVYGLY.....S..PT........AGKFKIDNK........IL........TI..K
gi|294102841|ref|YP_003554699.1|  KTTLL..RLILGLE.....K..PA........RGKIEVLGT........TP........DR..-
gi|294101272|ref|YP_003553130.1|  KSTLF..DLLTGTI.....E..RE........YGTMEWIGE........AV........PH..L
gi|294101433|ref|YP_003553291.1|  KSSIS..CLLAVAL.....A..KK........GFSVGILDA........DI........TG..P
gi|294101963|ref|YP_003553821.1|  KTTLL..DYIRQTN.....-..--........---------........--........--..-
gi|294101356|ref|YP_003553214.1|  KSTLS..RLISQSE.....V..PT........EGNISYG--........--........--..-
gi|294102542|ref|YP_003554400.1|  KSTLL..RILAFLE.....T..PT........EGTVYFKKE........RV........ET..V
gi|294101861|ref|YP_003553719.1|  KTTLA..GIIAHE-.....-..--........---------........--........--..-
gi|294102400|ref|YP_003554258.1|  -----..-------.....-..--........--KVNIHDI........RN........GS..F
gi|294102043|ref|YP_003553901.1|  KSTQA..AFLKEQL.....Q..--........---------........--........--..-
gi|294101077|ref|YP_003552935.1|  KTTLF..SLIMGLL.....R..PQ........KGDIIVKGK........VI........KN..-
gi|294102348|ref|YP_003554206.1|  KSSLA..YALMGLP.....DyiPV........KGSISFLGE........DI........TS..W
gi|294102040|ref|YP_003553898.1|  KTTTA..AKLAEQF.....H..RQ........GKKVILGAA........DT........FR..A
gi|294101613|ref|YP_003553471.1|  -----..-------.....-..--........---------........--........--..-
gi|294101367|ref|YP_003553225.1|  KSTLM..NILFGMP.....V..IQetggy...EGKFFINGQ........EA........QF..K
gi|294101893|ref|YP_003553751.1|  KTSLA..QSIARAL.....G..RR........FVNF-----........--........--..-
gi|294101841|ref|YP_003553699.1|  KSSLL..AAISNAR.....P..K-........---------........--........--..-
gi|294102070|ref|YP_003553928.1|  KSSLF..NRILGRR.....-..--........---------........--........--..-
gi|294102221|ref|YP_003554079.1|  KTTCA..AAY----.....-..--........---------........--........--..-
gi|294101356|ref|YP_003553214.1|  KTTLF..KIIMGLV.....E..PR........EGNVYFPKGirigylsqDL........VE..I
gi|294101345|ref|YP_003553203.1|  KTTLL..KTLAGTQ.....N..PL........GGEIRVLES........SL........AE..L
gi|294102145|ref|YP_003554003.1|  KTTLV..KALTGV-.....-..--........---------........--........--..-
gi|294101756|ref|YP_003553614.1|  KSSLL..NNILAYK.....V..S-........----IVSE-........--........--..-
gi|294102549|ref|YP_003554407.1|  QSELE..EAISGLR.....F..VK........EGQLLMGKR........DI........TH..L
gi|294101372|ref|YP_003553230.1|  KSSLL..NALLK--.....-..--........---------........--........--..-
gi|294101016|ref|YP_003552874.1|  KTHLM..HAIGHYV.....L..NK........NNSLKVT--........--........--..-
gi|294101780|ref|YP_003553638.1|  -----..-------.....-..--........---------........--........--..-
gi|294101686|ref|YP_003553544.1|  KSTLL..LQVCGAM.....A..AR........GERV-----........--........--..-
gi|294102507|ref|YP_003554365.1|  KTMLA..RAIRGIV.....P..PL........SHEELLESL........QI........HS..S
gi|294101471|ref|YP_003553329.1|  KTTLG..DILLGLI.....V..PD........RGKVLWKGQ........DI........RT..L
gi|294101845|ref|YP_003553703.1|  KSSIV..RALE---.....-..--........---------........--........--..-
gi|294101553|ref|YP_003553411.1|  KTTSA..VKIAKRI.....-..--........---------........--........--..-
gi|294101853|ref|YP_003553711.1|  KSVFV..NSC----.....-..--........---------........--........--..-
gi|294101780|ref|YP_003553638.1|  -----..-------.....-..--........---------........--........--..-
gi|294102079|ref|YP_003553937.1|  KSSVA..KKVAELL.....G..L-........---------........--........--..-
gi|294101472|ref|YP_003553330.1|  KTPIA..QAIAGTL.....A..KRlsv.....CGKVFLKKQ........NL........LS..V
gi|294102235|ref|YP_003554093.1|  KTSLF..NLLTGSR.....Q..H-........---------........--........--..-
gi|294102390|ref|YP_003554248.1|  -----..-------.....-..--........---------........--........--..-
gi|294101443|ref|YP_003553301.1|  KTTLV..RLMAMVT.....E..R-........---------........--........--..-
gi|294101748|ref|YP_003553606.1|  -----..-------.....-..--........---------........--........--..-
gi|294101649|ref|YP_003553507.1|  KGTQA..AEIKTKYkva..H..IS........TGDILRQNV........--........--..-
gi|294101715|ref|YP_003553573.1|  -----..-------.....-..--........---------........--........--..-
gi|294101925|ref|YP_003553783.1|  KSNTT..VSILRAI.....L..--........---------........--........--..-
gi|294101367|ref|YP_003553225.1|  KLGIA..NGIMGMY.....-..PS........GGTVTFDET........PIilndprspLS..V
gi|294101751|ref|YP_003553609.1|  KTYLA..VCH----.....-..--........---------........--........--..-
gi|294101046|ref|YP_003552904.1|  KTLVA..YLWAGLL.....T..TE........G--------........--........--..-
gi|294101779|ref|YP_003553637.1|  KTFTVa.NVLAQ--.....-..--........---------........--........--..-
gi|294101226|ref|YP_003553084.1|  KSVIF..SRLTGVR.....A..IS........S--------........--........--..-
gi|294101892|ref|YP_003553750.1|  KSMLL..NALMERK.....L..AH........VGST-----........--........--..-
gi|294102315|ref|YP_003554173.1|  KTGLG..IALL---.....-..--........---------........--........--..-
gi|294102188|ref|YP_003554046.1|  -----..-------.....-..--........---------........--........--..-
gi|294102320|ref|YP_003554178.1|  -----..-------.....-..--........---------........--........--..-
gi|294102169|ref|YP_003554027.1|  KTTLL..EAT----.....-..--........---------........--........--..-
gi|294101254|ref|YP_003553112.1|  QQELC..EALAGLR.....P..LK........EGRIMIDDE........EL........TH..Q
gi|294102077|ref|YP_003553935.1|  KSTLL..QQLSHG-.....-..--........---------........--........--..-
gi|294102510|ref|YP_003554368.1|  KSLFL..NLLVGKK.....R..APvggvpgitRGVSWYKGQ........DI........LA..V
gi|294101748|ref|YP_003553606.1|  -----..-------.....-..--........---------........--........--..-
gi|294101141|ref|YP_003552999.1|  KTLA-..-------.....-..--........---------........--........--..-
gi|294101018|ref|YP_003552876.1|  -----..-------.....-..--........---------........--........--..-
gi|294101692|ref|YP_003553550.1|  -----..-------.....-..--........---------........--........--..-
gi|294101032|ref|YP_003552890.1|  KTCIA..ASLALS-.....-..--........---------........--........--..-
gi|294101031|ref|YP_003552889.1|  KTCIM..AA---LC.....S..SF........SGKAVFCDV........DV........DA..P
gi|294101431|ref|YP_003553289.1|  KTTTA..KRLKIQL.....-..--........---------........--........--..-
gi|294102167|ref|YP_003554025.1|  KSTVS..QIWKSL-.....-..--........-GATIIDAD........AL........AH..E
gi|294101458|ref|YP_003553316.1|  KSLSM..VFY----.....-..--........---------........--........--..-
gi|294102320|ref|YP_003554178.1|  -----..-------.....-..--........---------........--........--..-
gi|294101940|ref|YP_003553798.1|  KTSLAlhGAVNFLQ.....G..NP........ERRVLFFSL........DM........SK..E
gi|294102120|ref|YP_003553978.1|  KTHLA..IAMIQEL.....-..--........---------........--........--..-
gi|294101791|ref|YP_003553649.1|  KTVLV..KGLG---.....-..--........---------........--........--..-
gi|294102136|ref|YP_003553994.1|  -----..-------.....-..--........---------........--........--..-
gi|294101830|ref|YP_003553688.1|  KSTVL..NILE---.....-..--........---------........--........--..-
gi|294102042|ref|YP_003553900.1|  -----..-------.....-..--........---------........--........--..-
gi|294102015|ref|YP_003553873.1|  KTKLS..LEIAETL.....K..A-........---------........--........--..-
gi|294102787|ref|YP_003554645.1|  KTTLM..SFLRY--.....-..--........---------........--........--..-
gi|294102032|ref|YP_003553890.1|  RTSY-..-------.....-..--........---------........--........--..-
gi|294102010|ref|YP_003553868.1|  KTEWV..LNMALAL.....L..EA........GEKVTIADI........DI........IN..-
gi|294101586|ref|YP_003553444.1|  KTKLC..LLLLKYL.....K..--........---------........--........--..-
gi|294101458|ref|YP_003553316.1|  -----..-------.....-..--........---------........--........--..-
gi|294102625|ref|YP_003554483.1|  -----..-------.....-..--........---------........--........--..-
gi|294102478|ref|YP_003554336.1|  -----..-------.....-..--........---------........--........--..-
gi|294101874|ref|YP_003553732.1|  KSQRA..QYVATDN.....N..VDyiid....DGLVIARGR........IM........TG..K
gi|294102071|ref|YP_003553929.1|  -----..-------.....-..--........---------........--........--..-


                                                   80          90              100                  
                                                    |           |                |                  
d3dhwc1                             SESE.........LTKARRQ..IGMIFQHF...NLLSS....RTVFGNVAL...........PL
gi|294102520|ref|YP_003554378.1|  ----.........-------..--------...-----....---------...........--
gi|294102529|ref|YP_003554387.1|  ----.........-------..--------...-----....---------...........--
gi|294102437|ref|YP_003554295.1|  ----.........-------..--------...-----....---------...........--
gi|294102168|ref|YP_003554026.1|  ----.........-------..--------...-----....---------...........--
gi|294101779|ref|YP_003553637.1|  ----.........-------..--------...-----....---------...........--
gi|294102457|ref|YP_003554315.1|  ----.........-------..--------...-----....---------...........--
gi|294101625|ref|YP_003553483.1|  ----.........-------..--------...-----....---------...........--
gi|294101185|ref|YP_003553043.1|  ----.........-------..--------...-----....---------...........--
gi|294102626|ref|YP_003554484.1|  ----.........-------..--------...-----....---------...........--
gi|294101765|ref|YP_003553623.1|  ----.........-------..--------...-----....---------...........--
gi|294102479|ref|YP_003554337.1|  ---D.........LTELRKQ..IGIVPQDP...VLMKG....SLAFNISYG...........FP
gi|294101904|ref|YP_003553762.1|  ----.........-AVNKRD..IGFVFQNY...ALFPH....MSIFDNVAY...........GL
gi|294102557|ref|YP_003554415.1|  APNH.........-----RN..ATMVFQSY...AIFPH....LNVYENIAF...........GL
gi|294101807|ref|YP_003553665.1|  ----.........-------..--------...-----....---------...........--
gi|294101806|ref|YP_003553664.1|  ----.........-------..--------...-----....---------...........--
gi|294102649|ref|YP_003554507.1|  STPE.........LRKLRRR..VGMIFQHF...NLLTS....RTVFQNVAF...........PL
gi|294101185|ref|YP_003553043.1|  ----.........-------..--------...-----....---------...........--
gi|294102868|ref|YP_003554726.1|  PPEK.........-----RP..TATVFQSY...ALFPH....MTVLQNVIY...........GL
gi|294102500|ref|YP_003554358.1|  ----.........-------..--------...-----....---------...........--
gi|294102409|ref|YP_003554267.1|  ----.........-------..--------...-L---....---------...........--
gi|294102354|ref|YP_003554212.1|  ----.........-------..--------...-----....---------...........--
gi|294101565|ref|YP_003553423.1|  ----.........-------..--------...-----....---------...........--
gi|294101424|ref|YP_003553282.1|  GKHS.........NKEVATL..VGMIFQQF...NLFPH....LSVLDNITLc..........PI
gi|294101976|ref|YP_003553834.1|  ----.........-------..--------...-----....---------...........--
gi|294101061|ref|YP_003552919.1|  SKKS.........INVLRQK..MGMVFQNF...YLFDH....LTALRNVEI...........AL
gi|294101048|ref|YP_003552906.1|  PKKD.........LTEFRRKq.IAMVFQHY...GLLPH....KTIIDNVEF...........GL
gi|294101977|ref|YP_003553835.1|  ----.........-------..--------...-----....---------...........--
gi|294101084|ref|YP_003552942.1|  GKEKeldksfleaCHHMRQE..VGMVFQSF...NLFPH....RTVLENVMLa..........PM
gi|294101565|ref|YP_003553423.1|  N---.........-------..--------...-----....---------...........--
gi|294101786|ref|YP_003553644.1|  NKAK.........MKKMRSQ..MQIIFQDPya.SLNPR....MTVSQSIAA...........PL
gi|294101493|ref|YP_003553351.1|  DENQ.........LADIRKNt.IGFVFQGF...NLLPR....MTALENVEL...........PM
gi|294101884|ref|YP_003553742.1|  ----.........-------..--------...-----....---------...........--
gi|294101894|ref|YP_003553752.1|  ----.........-------..--------...-----....---------...........--
gi|294101778|ref|YP_003553636.1|  ----.........-------..--------...-----....---------...........--
gi|294102313|ref|YP_003554171.1|  SHKE.........SAQLRNHh.IGFIFQTY...NLFPV....YNVYENIEF...........PL
gi|294102640|ref|YP_003554498.1|  NNAQ.........KREFHKQ..AQIVFQDPfs.SLNPR....MSVSQLIAE...........PL
gi|294101376|ref|YP_003553234.1|  ----.........-------..--------...-----....---------...........--
gi|294102641|ref|YP_003554499.1|  TEAE.........KRDIRGSk.IAMIFQDPmt.SLNPI....MTVEEQIME...........MI
gi|294101359|ref|YP_003553217.1|  ----.........-------..--------...-----....---------...........--
gi|294102459|ref|YP_003554317.1|  ----.........-------..--------...-----....---------...........--
gi|294101785|ref|YP_003553643.1|  TSSE.........IRKVRGEq.VSMIFQDPmt.SLNPI....MIVGDQIAE...........AI
gi|294101376|ref|YP_003553234.1|  ----.........-------..--------...-----....---------...........--
gi|294102074|ref|YP_003553932.1|  ----.........-------..--------...-----....---------...........--
gi|294102442|ref|YP_003554300.1|  RASQ.........LPYYRRY..LGVVFQDF...KLLPH....LTAWENVAF...........VL
gi|294101577|ref|YP_003553435.1|  PM--.........FRRARIG..VGYLPQEA...SIFRN....LTVKENIEI...........VL
gi|294101171|ref|YP_003553029.1|  KTYE.........--VIRKG..IARTFQNL...RLFPR....SSVLENVMT...........AA
gi|294102413|ref|YP_003554271.1|  PPNK.........VC--ESG..IARTFQNI...RLFSN....ETVLQNVMI...........GC
gi|294102187|ref|YP_003554045.1|  QQDH.........VVRMESR..--------...-----....---------...........--
gi|294102332|ref|YP_003554190.1|  KVKD.........LRALRRDh.IGFVFQAP...YLIPF....LDVTDNVAL...........LP
gi|294102831|ref|YP_003554689.1|  ----.........-------..--------...-----....---------...........--
gi|294101321|ref|YP_003553179.1|  ----.........-------..--------...-----....---------...........--
gi|294101626|ref|YP_003553484.1|  ----.........-------..--------...-----....---------...........--
gi|294101069|ref|YP_003552927.1|  SGRE.........---IARR..IGYVPQSS...EK-VR....LTAFDAILL...........GR
gi|294102759|ref|YP_003554617.1|  RPEM.........LNAIRWKd.IALIPQGAmn.SFTPV....LTIGKHIEE...........VL
gi|294101055|ref|YP_003552913.1|  SPEE.........---VRRR..IGMVFQSP...TPFP-....FSIYDNMAY...........PL
gi|294101254|ref|YP_003553112.1|  SPKD.........--AIAAG..IGMVHQHF...MLIPS....QTVWENMIL...........GL
gi|294102760|ref|YP_003554618.1|  SHSQ.........LIELRRR..CGYVPQDPyg.SLPPT....LTVLDAVAE...........PW
gi|294101659|ref|YP_003553517.1|  -EKN.........LWAIRSH..VAMVFQNPd..NQIVG....TVVEDDTAF...........GP
gi|294101172|ref|YP_003553030.1|  --RS.........YDVVKQG..ISLVPEGR...RVFAP....LTVYENLMM...........GA
gi|294102017|ref|YP_003553875.1|  ----.........-------..--------...-----....---------...........--
gi|294101748|ref|YP_003553606.1|  ----.........-------..--------...-----....---------...........--
gi|294102409|ref|YP_003554267.1|  ----.........-------..--------...-----....---------...........--
gi|294102070|ref|YP_003553928.1|  DATD.........TVIEMK-..--------...-----....---------...........--
gi|294102390|ref|YP_003554248.1|  ----.........-------..--------...-----....---------...........--
gi|294101403|ref|YP_003553261.1|  ----.........-------..--------...-----....---------...........--
gi|294101730|ref|YP_003553588.1|  ----.........-------..--------...-----....---------...........--
gi|294102602|ref|YP_003554460.1|  ERER.........GITIRAK..H-------...-----....---------...........--
gi|294102663|ref|YP_003554521.1|  GATD.........VIALRRQ..VGMVFQKP...NPFP-....MAIYDNVAY...........GP
gi|294101436|ref|YP_003553294.1|  ----.........-------..--------...-----....---------...........--
gi|294102150|ref|YP_003554008.1|  DSLD.........LE-----..--------...-----....---------...........--
gi|294101607|ref|YP_003553465.1|  ----.........-------..--------...-----....---------...........--
gi|294102035|ref|YP_003553893.1|  ----.........-------..--------...-----....---------...........--
gi|294102412|ref|YP_003554270.1|  GKTP.........EFIVKKG..IAMSPEGR...RILPH....LTVEENLLL...........GA
gi|294101660|ref|YP_003553518.1|  KSQD.........LRKIRRL..VGLVFQYPe..QQLFA....ETVFDEVAF...........AP
gi|294102549|ref|YP_003554407.1|  TPRD.........--AMKYG..IGMVHQHF...MLVPS....LPVYKNVVL...........GD
gi|294102841|ref|YP_003554699.1|  ----.........---AVTS..VGYVPQEGvr.DKIFP....VSVFDVVLM...........GR
gi|294101272|ref|YP_003553130.1|  GQIA.........-------..-AYMQQKD...LLLPW....LSLMQNAML...........PQ
gi|294101433|ref|YP_003553291.1|  S---.........-------..--------...-----....---------...........--
gi|294101963|ref|YP_003553821.1|  ----.........-------..--------...-----....---------...........--
gi|294101356|ref|YP_003553214.1|  ----.........---YNVK..MGFFSQESaq.NLNYN....RTIWEEISN...........TG
gi|294102542|ref|YP_003554400.1|  S---.........-VNYRRS..VTLLLQNT...YLLKR....-AVWENVAF...........GL
gi|294101861|ref|YP_003553719.1|  ----.........-------..--------...-----....---------...........--
gi|294102400|ref|YP_003554258.1|  AEKD.........WEKLADA..AGRLSQAP...LFIDD....SSMLSTLEF...........RA
gi|294102043|ref|YP_003553901.1|  ----.........-------..--------...-----....---------...........--
gi|294101077|ref|YP_003552935.1|  -QKD.........LRYLRQT..IGFLFQDPd..DQLFC....PTLLDDVLF...........GP
gi|294102348|ref|YP_003554206.1|  SITD.........R--AKAG..LTLAWQMP...ARYEG....ISIRDYLRI...........GP
gi|294102040|ref|YP_003553898.1|  AAID.........-------..--------...-----....---------...........--
gi|294101613|ref|YP_003553471.1|  ----.........-------..--------...-----....---------...........--
gi|294101367|ref|YP_003553225.1|  SPFD.........--ALDAG..IGMVHQEF...SLIPG....FTAAENIVL...........NR
gi|294101893|ref|YP_003553751.1|  ----.........-------..--------...-----....---------...........--
gi|294101841|ref|YP_003553699.1|  ----.........-------..--------...-----....---------...........--
gi|294102070|ref|YP_003553928.1|  ----.........-------..--------...-----....---------...........--
gi|294102221|ref|YP_003554079.1|  ----.........-------..--------...-----....---------...........--
gi|294101356|ref|YP_003553214.1|  EDTV.........LLHYLKKq.AGIALVEK...ELRATeediARAAKNEEEyhsllkrhdhlSH
gi|294101345|ref|YP_003553203.1|  SHKK.........RA----Ql.LSFVISGR...PAIQG....FSVFELVAL...........GR
gi|294102145|ref|YP_003554003.1|  ----.........-------..--------...-----....---------...........--
gi|294101756|ref|YP_003553614.1|  ---K.........PQTTRNA..IHGIYNEP...EMQIV....F--------...........--
gi|294102549|ref|YP_003554407.1|  PPLK.........----RRKlgLAYIPEDRiktGLAPL....ASLKDNALL...........GY
gi|294101372|ref|YP_003553230.1|  ----.........-------..--------...-----....---------...........--
gi|294101016|ref|YP_003552874.1|  ----.........-------..--------...-----....---------...........--
gi|294101780|ref|YP_003553638.1|  ----.........-------..--------...-----....---------...........--
gi|294101686|ref|YP_003553544.1|  ----.........-------..--------...-----....---------...........--
gi|294102507|ref|YP_003554365.1|  ARP-.........-------..--------...-----....---------...........--
gi|294101471|ref|YP_003553329.1|  SKTK.........KKNLRPY..FQKIHQDPg..SSFPQ....NRLIRTIFE...........DF
gi|294101845|ref|YP_003553703.1|  ----.........-------..--------...-----....---------...........--
gi|294101553|ref|YP_003553411.1|  ----.........-------..--------...-----....---------...........--
gi|294101853|ref|YP_003553711.1|  ----.........-------..--------...-----....---------...........--
gi|294101780|ref|YP_003553638.1|  ----.........-------..--------...-----....---------...........--
gi|294102079|ref|YP_003553937.1|  ----.........-------..--------...-----....---------...........--
gi|294101472|ref|YP_003553330.1|  KEKE.........LKKLWGRy.LFLMPQEPst.ALNPL....LSVFRQVRE...........VF
gi|294102235|ref|YP_003554093.1|  ----.........-------..--------...-----....---------...........--
gi|294102390|ref|YP_003554248.1|  ----.........-------..--------...-----....---------...........--
gi|294101443|ref|YP_003553301.1|  ----.........-------..--------...-----....---------...........--
gi|294101748|ref|YP_003553606.1|  ----.........-------..--------...-----....---------...........--
gi|294101649|ref|YP_003553507.1|  ----.........-------..--------...-----....---------...........--
gi|294101715|ref|YP_003553573.1|  ----.........-------..--------...-----....---------...........--
gi|294101925|ref|YP_003553783.1|  ----.........-------..--------...-----....---------...........--
gi|294101367|ref|YP_003553225.1|  GIAS.........VSEDRRG..VGLLLEEPi..SWNVI....FTALQMQQK...........YL
gi|294101751|ref|YP_003553609.1|  ----.........-------..--------...-----....---------...........--
gi|294101046|ref|YP_003552904.1|  ----.........-------..--------...-----....---------...........--
gi|294101779|ref|YP_003553637.1|  ----.........-------..--------...-----....---------...........--
gi|294101226|ref|YP_003553084.1|  ----.........-------..--------...-----....---------...........--
gi|294101892|ref|YP_003553750.1|  ----.........-------..--------...-----....---------...........--
gi|294102315|ref|YP_003554173.1|  ----.........-------..--------...-----....---------...........--
gi|294102188|ref|YP_003554046.1|  ----.........-------..--------...-----....---------...........--
gi|294102320|ref|YP_003554178.1|  ----.........-------..--------...-----....---------...........--
gi|294102169|ref|YP_003554027.1|  ----.........-------..--------...-----....---------...........--
gi|294101254|ref|YP_003553112.1|  PPKQ.........FIARGVRy.IPADRKGT...GLVPN....MDIKENSIL...........KK
gi|294102077|ref|YP_003553935.1|  ----.........-------..--------...-----....---------...........--
gi|294102510|ref|YP_003554368.1|  DSPG.........ILDP---..--------...-----....---------...........--
gi|294101748|ref|YP_003553606.1|  ----.........-------..--------...-----....---------...........--
gi|294101141|ref|YP_003552999.1|  ----.........-------..--------...-----....---------...........--
gi|294101018|ref|YP_003552876.1|  ----.........-------..--------...-----....----E----...........--
gi|294101692|ref|YP_003553550.1|  ----.........-------..--------...-----....---------...........--
gi|294101032|ref|YP_003552890.1|  ----.........-------..--------...-----....---------...........--
gi|294101031|ref|YP_003552889.1|  N---.........-------..--------...-----....---------...........--
gi|294101431|ref|YP_003553289.1|  ----.........-------..--------...-----....---------...........--
gi|294102167|ref|YP_003554025.1|  AWKD.........TTVLRR-..--------...-----....---------...........--
gi|294101458|ref|YP_003553316.1|  ----.........-------..--------...-----....---------...........--
gi|294102320|ref|YP_003554178.1|  ----.........-------..--N-----...-----....---------...........--
gi|294101940|ref|YP_003553798.1|  ETTQ.........RLFMRE-..--------...-----....LEVSTNALH...........GL
gi|294102120|ref|YP_003553978.1|  ----.........-------..--------...-----....---------...........--
gi|294101791|ref|YP_003553649.1|  ----.........-------..--------...-----....---------...........--
gi|294102136|ref|YP_003553994.1|  ----.........-------..--------...-----....---------...........--
gi|294101830|ref|YP_003553688.1|  ----.........-------..--------...-----....---------...........--
gi|294102042|ref|YP_003553900.1|  ----.........-------..--------...----V....---------...........--
gi|294102015|ref|YP_003553873.1|  ----.........-------..--------...-----....---------...........--
gi|294102787|ref|YP_003554645.1|  ----.........-------..--------...-----....---------...........--
gi|294102032|ref|YP_003553890.1|  ----.........-------..--------...-----....---------...........--
gi|294102010|ref|YP_003553868.1|  ----.........-------..--------...-----....---------...........--
gi|294101586|ref|YP_003553444.1|  ----.........-------..--------...-----....---------...........--
gi|294101458|ref|YP_003553316.1|  ----.........-------..--------...-----....---------...........--
gi|294102625|ref|YP_003554483.1|  ----.........-----QN..IGMVFDAP...LLPLA....EEVLQRYRI...........PY
gi|294102478|ref|YP_003554336.1|  ----.........-------..--------...-----....---------...........--
gi|294101874|ref|YP_003553732.1|  SAKS.........EKNLVRA..--------...-----....---------...........--
gi|294102071|ref|YP_003553929.1|  ----.........-------..--------...-----....---------...........--


                                                  110                                         120   
                                                    |                                           |   
d3dhwc1                             E..............LD...............NT...............PKDEVK....RRVTE
gi|294102520|ref|YP_003554378.1|  -..............--...............--...............------....-----
gi|294102529|ref|YP_003554387.1|  -..............--...............--...............------....-----
gi|294102437|ref|YP_003554295.1|  -..............--...............--...............------....-----
gi|294102168|ref|YP_003554026.1|  -..............--...............--...............------....-----
gi|294101779|ref|YP_003553637.1|  -..............--...............--...............------....-----
gi|294102457|ref|YP_003554315.1|  -..............--...............--...............------....-----
gi|294101625|ref|YP_003553483.1|  -..............--...............--...............------....-----
gi|294101185|ref|YP_003553043.1|  -..............--...............--...............------....-----
gi|294102626|ref|YP_003554484.1|  -..............--...............--...............------....-----
gi|294101765|ref|YP_003553623.1|  -..............--...............--...............------....-----
gi|294102479|ref|YP_003554337.1|  Q..............AT...............--...............-----E....EDIVK
gi|294101904|ref|YP_003553762.1|  K..............VR...............GL...............SRKEAE....LKVKE
gi|294102557|ref|YP_003554415.1|  R..............LK...............KM...............EESKIR....EKMEG
gi|294101807|ref|YP_003553665.1|  -..............--...............--...............------....-----
gi|294101806|ref|YP_003553664.1|  -..............--...............--...............------....-----
gi|294102649|ref|YP_003554507.1|  E..............IE...............KW...............ETDAIS....KRVTE
gi|294101185|ref|YP_003553043.1|  -..............--...............--...............------....-----
gi|294102868|ref|YP_003554726.1|  K..............FK...............KI...............DRKKAM....QMGDE
gi|294102500|ref|YP_003554358.1|  -..............--...............--...............------....-----
gi|294102409|ref|YP_003554267.1|  -..............--...............--...............------....-----
gi|294102354|ref|YP_003554212.1|  -..............--...............--...............------....-----
gi|294101565|ref|YP_003553423.1|  -..............--...............--...............------....-----
gi|294101424|ref|YP_003553282.1|  Q..............AK...............GM...............KKKEAE....DLAIR
gi|294101976|ref|YP_003553834.1|  -..............--...............--...............------....-----
gi|294101061|ref|YP_003552919.1|  L..............KVk..............GM...............DKKHAR....EKAML
gi|294101048|ref|YP_003552906.1|  K..............LQ...............GI...............SEKERR....ERSNV
gi|294101977|ref|YP_003553835.1|  -..............--...............--...............------....-----
gi|294101084|ref|YP_003552942.1|  V..............VK...............KA...............SEEEAH....EIALR
gi|294101565|ref|YP_003553423.1|  -..............--...............--...............------....-----
gi|294101786|ref|YP_003553644.1|  I..............IQ...............GVykss...........EKDKIQ....KKVDQ
gi|294101493|ref|YP_003553351.1|  L..............YS...............GI...............SARKRH....ERALH
gi|294101884|ref|YP_003553742.1|  -..............--...............--...............------....-----
gi|294101894|ref|YP_003553752.1|  -..............--...............--...............------....-----
gi|294101778|ref|YP_003553636.1|  -..............--...............--...............------....-----
gi|294102313|ref|YP_003554171.1|  L..............LL...............KI...............PQKERK....EKIFD
gi|294102640|ref|YP_003554498.1|  L..............IN...............KAcg.............SRKEVD....NKVKE
gi|294101376|ref|YP_003553234.1|  -..............--...............--...............------....-----
gi|294102641|ref|YP_003554499.1|  S..............LHs..............DF...............KGEAVR....KRAHE
gi|294101359|ref|YP_003553217.1|  -..............--...............--...............------....-----
gi|294102459|ref|YP_003554317.1|  -..............--...............--...............------....-----
gi|294101785|ref|YP_003553643.1|  K..............THm..............HV...............SSAKAT....KKASE
gi|294101376|ref|YP_003553234.1|  -..............--...............--...............------....-----
gi|294102074|ref|YP_003553932.1|  -..............--...............--...............------....-----
gi|294102442|ref|YP_003554300.1|  E..............SM...............GM...............PRRMVQ....KRTNE
gi|294101577|ref|YP_003553435.1|  Q..............EL...............GK...............PQKEIE....TMVSH
gi|294101171|ref|YP_003553029.1|  Q..............QHeaysfveavthfgkwRM...............KETSIR....DRSME
gi|294102413|ref|YP_003554271.1|  H..............VR...............QKskwwmapfpvpsmiqEEKEIR....EKSMK
gi|294102187|ref|YP_003554045.1|  -..............--...............--...............------....-----
gi|294102332|ref|YP_003554190.1|  M..............LA...............GK...............PNAEAR....QQAIE
gi|294102831|ref|YP_003554689.1|  -..............--...............--...............------....-----
gi|294101321|ref|YP_003553179.1|  -..............--...............--...............------....-----
gi|294101626|ref|YP_003553484.1|  -..............--...............--...............------....-----
gi|294101069|ref|YP_003552927.1|  R..............PYv..............GWr..............LAESDI....KKVDA
gi|294102759|ref|YP_003554617.1|  A..............IHl..............GL...............SGEARR....HRCRS
gi|294101055|ref|YP_003552913.1|  R..............YY...............GYgskk...........KSKNLD....VIIRN
gi|294101254|ref|YP_003553112.1|  E..............GLpq.............LL...............PKKEIH....QQIID
gi|294102760|ref|YP_003554618.1|  I..............IVng.............RK...............SRLEAY....SKARR
gi|294101659|ref|YP_003553517.1|  E..............NI...............GL...............SPLEIR....QRVDW
gi|294101172|ref|YP_003553030.1|  F..............PR...............KE...............PEKVKQ....DLQWV
gi|294102017|ref|YP_003553875.1|  -..............--...............--...............------....-----
gi|294101748|ref|YP_003553606.1|  -..............--...............--...............------....-----
gi|294102409|ref|YP_003554267.1|  -..............--...............--...............------....-----
gi|294102070|ref|YP_003553928.1|  -..............--...............--...............------....-----
gi|294102390|ref|YP_003554248.1|  -..............--...............--...............------....-----
gi|294101403|ref|YP_003553261.1|  -..............--...............--...............------....-----
gi|294101730|ref|YP_003553588.1|  -..............--...............--...............------....-----
gi|294102602|ref|YP_003554460.1|  -..............--...............--...............------....-----
gi|294102663|ref|YP_003554521.1|  R..............LQ...............GIk..............SREKLD....EIVKR
gi|294101436|ref|YP_003553294.1|  -..............--...............--...............------....-----
gi|294102150|ref|YP_003554008.1|  -..............--...............--...............------....-----
gi|294101607|ref|YP_003553465.1|  -..............--...............--...............------....-----
gi|294102035|ref|YP_003553893.1|  -..............--...............--...............------....-----
gi|294102412|ref|YP_003554270.1|  Y..............IR...............DD...............KEGIEK....DMDHV
gi|294101660|ref|YP_003553518.1|  R..............NW...............GV...............SEEDLE....KVVNE
gi|294102549|ref|YP_003554407.1|  E..............PT...............TRglif...........NHHGAI....EAVRH
gi|294102841|ref|YP_003554699.1|  L..............GIgrr............KI...............FTEEDK....KIAMD
gi|294101272|ref|YP_003553130.1|  V..............FS...............KE...............KHLRKN....KKAKG
gi|294101433|ref|YP_003553291.1|  -..............--...............--...............------....-----
gi|294101963|ref|YP_003553821.1|  -..............--...............--...............------....-----
gi|294101356|ref|YP_003553214.1|  Y..............LG...............TD...............-TE---....--KRG
gi|294102542|ref|YP_003554400.1|  K..............VR...............GV...............RGKELM....KSMEE
gi|294101861|ref|YP_003553719.1|  -..............--...............--...............------....-----
gi|294102400|ref|YP_003554258.1|  R..............ARrf.............KS...............RFENLG....LIVVD
gi|294102043|ref|YP_003553901.1|  -..............--...............--...............------....-----
gi|294101077|ref|YP_003552935.1|  L..............NG...............GI...............NKEEAY....EQAIN
gi|294102348|ref|YP_003554206.1|  -..............--...............--...............-QNSSE....RNLEE
gi|294102040|ref|YP_003553898.1|  -..............--...............--...............------....-----
gi|294101613|ref|YP_003553471.1|  -..............--...............--...............------....-----
gi|294101367|ref|YP_003553225.1|  EstqynflvesfgdrLR...............TL...............NTEEMR....QRGEN
gi|294101893|ref|YP_003553751.1|  -..............--...............--...............------....-----
gi|294101841|ref|YP_003553699.1|  -..............--...............--...............------....-----
gi|294102070|ref|YP_003553928.1|  -..............--...............--...............------....-----
gi|294102221|ref|YP_003554079.1|  -..............--...............--...............------....-----
gi|294101356|ref|YP_003553214.1|  R..............YE...............QL...............GGYEFA....AMAQK
gi|294101345|ref|YP_003553203.1|  H..............PY...............TN...............WKGELEdrdiKAVEK
gi|294102145|ref|YP_003554003.1|  -..............--...............--...............------....-----
gi|294101756|ref|YP_003553614.1|  -..............--...............--...............------....-----
gi|294102549|ref|YP_003554407.1|  Q..............YKppflkr.........NFfq.............NFRSIR....EFALH
gi|294101372|ref|YP_003553230.1|  -..............--...............--...............------....-----
gi|294101016|ref|YP_003552874.1|  -..............--...............--...............------....-----
gi|294101780|ref|YP_003553638.1|  -..............--...............--...............------....-----
gi|294101686|ref|YP_003553544.1|  -..............--...............--...............------....-----
gi|294102507|ref|YP_003554365.1|  -..............--...............--...............------....-----
gi|294101471|ref|YP_003553329.1|  F..............RW...............GYhpals..........SEKEWW....NALGE
gi|294101845|ref|YP_003553703.1|  -..............--...............--...............------....-----
gi|294101553|ref|YP_003553411.1|  -..............--...............--...............------....-----
gi|294101853|ref|YP_003553711.1|  -..............--...............--...............------....-----
gi|294101780|ref|YP_003553638.1|  -..............--...............--...............------....---LA
gi|294102079|ref|YP_003553937.1|  -..............--...............--...............------....-----
gi|294101472|ref|YP_003553330.1|  Q..............HLr..............GM...............DRHTAR....TATQN
gi|294102235|ref|YP_003554093.1|  -..............--...............--...............------....-----
gi|294102390|ref|YP_003554248.1|  -..............-V...............GV...............DVPQAT....VMVIE
gi|294101443|ref|YP_003553301.1|  -..............--...............--...............------....-----
gi|294101748|ref|YP_003553606.1|  -..............--...............--...............------....-----
gi|294101649|ref|YP_003553507.1|  -..............--...............--...............------....-----
gi|294101715|ref|YP_003553573.1|  -..............--...............--...............------....-----
gi|294101925|ref|YP_003553783.1|  -..............--...............--...............------....-----
gi|294101367|ref|YP_003553225.1|  K..............PVlg.............GLfkir...........DEEAIR....EVTKK
gi|294101751|ref|YP_003553609.1|  -..............--...............--...............------....-----
gi|294101046|ref|YP_003552904.1|  -..............--...............--...............------....-----
gi|294101779|ref|YP_003553637.1|  -..............--...............--...............------....-----
gi|294101226|ref|YP_003553084.1|  -..............--...............--...............------....-----
gi|294101892|ref|YP_003553750.1|  -..............--...............--...............------....-----
gi|294102315|ref|YP_003554173.1|  -..............--...............--...............------....-----
gi|294102188|ref|YP_003554046.1|  -..............--...............--...............------....-----
gi|294102320|ref|YP_003554178.1|  -..............--...............--...............------....-----
gi|294102169|ref|YP_003554027.1|  -..............--...............--...............------....-----
gi|294101254|ref|YP_003553112.1|  Y..............WN...............KPvargpmi........DWKAVF....SHAIN
gi|294102077|ref|YP_003553935.1|  -..............--...............--...............------....-----
gi|294102510|ref|YP_003554368.1|  -..............--...............--...............------....-----
gi|294101748|ref|YP_003553606.1|  -..............--...............--...............------....-----
gi|294101141|ref|YP_003552999.1|  -..............--...............--...............------....-----
gi|294101018|ref|YP_003552876.1|  -..............--...............--...............------....-----
gi|294101692|ref|YP_003553550.1|  -..............--...............--...............------....-----
gi|294101032|ref|YP_003552890.1|  -..............--...............--...............------....-----
gi|294101031|ref|YP_003552889.1|  -..............--...............--...............------....-----
gi|294101431|ref|YP_003553289.1|  -..............--...............--...............------....-----
gi|294102167|ref|YP_003554025.1|  -..............--...............--...............------....-----
gi|294101458|ref|YP_003553316.1|  -..............--...............--...............------....-----
gi|294102320|ref|YP_003554178.1|  -..............--...............--...............------....-----
gi|294101940|ref|YP_003553798.1|  I..............KV...............--...............------....-----
gi|294102120|ref|YP_003553978.1|  -..............--...............--...............------....-----
gi|294101791|ref|YP_003553649.1|  -..............--...............--...............------....-----
gi|294102136|ref|YP_003553994.1|  -..............--...............--...............------....-----
gi|294101830|ref|YP_003553688.1|  -..............--...............--...............------....-----
gi|294102042|ref|YP_003553900.1|  -..............--...............--...............------....-----
gi|294102015|ref|YP_003553873.1|  -..............--...............--...............------....-----
gi|294102787|ref|YP_003554645.1|  -..............--...............--...............------....-----
gi|294102032|ref|YP_003553890.1|  -..............--...............--...............------....-----
gi|294102010|ref|YP_003553868.1|  -..............--...............--...............------....-----
gi|294101586|ref|YP_003553444.1|  -..............--...............--...............------....-----
gi|294101458|ref|YP_003553316.1|  -..............--...............--...............----I-....-----
gi|294102625|ref|YP_003554483.1|  S..............I-...............--...............------....-----
gi|294102478|ref|YP_003554336.1|  -..............--...............--...............------....-----
gi|294101874|ref|YP_003553732.1|  -..............--...............--...............------....-----
gi|294102071|ref|YP_003553929.1|  -..............--...............--...............------....-----


                                        130                         140       150                160
                                          |                           |         |                  |
d3dhwc1                             LLSLVGLG....D...KHDSYPS...........NLSGGQKQRVAIARAL...AS....N..PK
gi|294102520|ref|YP_003554378.1|  ----V---....-...-------...........----------------...--....-..--
gi|294102529|ref|YP_003554387.1|  ----V---....-...-------...........----------------...--....-..--
gi|294102437|ref|YP_003554295.1|  --------....-...-------...........----------------...--....-..--
gi|294102168|ref|YP_003554026.1|  --------....-...-------...........----------------...--....-..--
gi|294101779|ref|YP_003553637.1|  --------....-...-------...........----------------...--....-..--
gi|294102457|ref|YP_003554315.1|  --------....-...-------...........----------------...--....-..--
gi|294101625|ref|YP_003553483.1|  --------....-...-------...........----------------...--....-..--
gi|294101185|ref|YP_003553043.1|  --------....-...-------...........----------------...--....-..--
gi|294102626|ref|YP_003554484.1|  --------....-...-------...........----------------...--....-..--
gi|294101765|ref|YP_003553623.1|  --------....-...-------...........----------------...--....-..--
gi|294102479|ref|YP_003554337.1|  AAQIAGIH....T...FITSLPEgydtevgergvTLSGGQRQRVAIARAI...IR....N..PR
gi|294101904|ref|YP_003553762.1|  VLNLVGLI....G...VDERFPH...........QLSGGEQQRVALARVL...VI....D..PR
gi|294102557|ref|YP_003554415.1|  VIDLVGLT....G...LESRQPS...........QLSGGQQQRVALARAI...IM....E..PA
gi|294101807|ref|YP_003553665.1|  --------....-...-------...........----------------...--....-..--
gi|294101806|ref|YP_003553664.1|  --------....-...-------...........----------------...--....-..--
gi|294102649|ref|YP_003554507.1|  VLDLVDLS....D...KAQSYPS...........QLSGGQKQRVGIARAL...AN....N..PS
gi|294101185|ref|YP_003553043.1|  --------....-...-------...........----------------...--....-..--
gi|294102868|ref|YP_003554726.1|  MLAKVGLP....D...SASKSID...........QLSGGEQQRVALARSL...VT....E..PK
gi|294102500|ref|YP_003554358.1|  --------....-...-------...........----------------...--....-..--
gi|294102409|ref|YP_003554267.1|  --------....-...-------...........----------------...--....-..--
gi|294102354|ref|YP_003554212.1|  --------....-...-------...........----------------...--....-..--
gi|294101565|ref|YP_003553423.1|  --------....-...-------...........----------------...--....-..--
gi|294101424|ref|YP_003553282.1|  LLERVGLG....D...KVYAKPS...........QLSGGQQQRVAIARAL...AM....Q..PK
gi|294101976|ref|YP_003553834.1|  --------....-...-------...........----------------...--....-..--
gi|294101061|ref|YP_003552919.1|  ELERVGMA....A...FADHYPT...........QLSGGQAQRVSIARAL...AM....D..PD
gi|294101048|ref|YP_003552906.1|  ALERVGLK....G...WENYYPS...........SLSGGMRQRVGIARAL...VM....D..TP
gi|294101977|ref|YP_003553835.1|  --------....-...-------...........----------------...--....-..--
gi|294101084|ref|YP_003552942.1|  LLEKVGLS....E...HAHKYPA...........TLSGGQTQRGAIARAL...AM....N..PK
gi|294101565|ref|YP_003553423.1|  --------....-...-------...........----------------...--....-..--
gi|294101786|ref|YP_003553644.1|  TMDLVGLAk...R...FANSYPH...........ELDGGRRQRIGIARAL...TL....N..PK
gi|294101493|ref|YP_003553351.1|  ALQIVDLE....D...RANHQPQ...........QLSGGQQQRVAIARAL...AN....D..AP
gi|294101884|ref|YP_003553742.1|  --------....-...-------...........----------------...--....-..--
gi|294101894|ref|YP_003553752.1|  --------....-...-------...........----------------...--....-..--
gi|294101778|ref|YP_003553636.1|  --------....-...-------...........----------------...--....-..--
gi|294102313|ref|YP_003554171.1|  ALEWLGLT....D...KIDSRPS...........QLSGGECQRVAVARAV...VK....R..PE
gi|294102640|ref|YP_003554498.1|  LMDTVGLA....Er..LTTSFPH...........ELDGGRRQRIGVARAL...AL....D..PE
gi|294101376|ref|YP_003553234.1|  --------....-...-------...........----------------...--....-..--
gi|294102641|ref|YP_003554499.1|  MLALVGIRp...E...RGKEYPH...........QFSGGMRQRVGIAIAL...AC....E..PT
gi|294101359|ref|YP_003553217.1|  --------....-...-------...........----------------...--....-..--
gi|294102459|ref|YP_003554317.1|  --------....-...-------...........----------------...--....-..--
gi|294101785|ref|YP_003553643.1|  MMELVGID....Pv..RMSDYPH...........QFSGGMKQRVVIAMAL...AC....N..PK
gi|294101376|ref|YP_003553234.1|  --------....-...-------...........----------------...--....-..--
gi|294102074|ref|YP_003553932.1|  --------....-...-------...........----------------...--....-..--
gi|294102442|ref|YP_003554300.1|  VVDQVGLW....R...RRFLYPP...........QLSGGEQQRVAIARAM...AN....S..PA
gi|294101577|ref|YP_003553435.1|  ILEELGLT....S...LASIPGY...........ALSGGERRRVEIARCL...SI....M..PD
gi|294101171|ref|YP_003553029.1|  LLNRVGLA....D...RALQPAG...........TLPYGYQRRLEIARAL...AL....D..PR
gi|294102413|ref|YP_003554271.1|  LLQSVSLA....Q...DANVLSS...........SLPYGAQRRLEIARAL...AT....D..PS
gi|294102187|ref|YP_003554045.1|  --------....-...-------...........----------------...--....-..--
gi|294102332|ref|YP_003554190.1|  LLKALDVE....H...RAKAMPS...........QLSGGEQQRVAIARGL...VN....R..PP
gi|294102831|ref|YP_003554689.1|  --------....-...-------...........----------------...--....-..--
gi|294101321|ref|YP_003553179.1|  --------....-...-------...........----------------...--....-..--
gi|294101626|ref|YP_003553484.1|  --------....-...-------...........----------------...--....-..--
gi|294101069|ref|YP_003552927.1|  IIHTLGLD....E...LALRYLD...........EMSGGELQKVTIARAL...VQ....E..PR
gi|294102759|ref|YP_003554617.1|  LLEEADLEw...S...LANRYPH...........ELSGGQKQRAAIATAL...AC....D..PD
gi|294101055|ref|YP_003552913.1|  KLEDVGLFeevkD...SLSMNAT...........LLSGGQQQRLCIARAL...AV....E..PE
gi|294101254|ref|YP_003553112.1|  ISRQYGLE....V...DPDAKIW...........QLSIGEQQRVAILQML...YR....K..AQ
gi|294102760|ref|YP_003554618.1|  LLKTLGIE....EeriLLSRVRS...........GLSGGQRQRVSIARSL...IL....E..PA
gi|294101659|ref|YP_003553517.1|  ALSVTGLS....H...KMQNPTY...........SLSGGEKQRLAVAGAL...AL....D..PP
gi|294101172|ref|YP_003553030.1|  FSLFPRLE....E...RRDQYAG...........TLSGGEQQMLAIGRAL...MS....R..PR
gi|294102017|ref|YP_003553875.1|  --------....-...-------...........----------------...--....-..--
gi|294101748|ref|YP_003553606.1|  --------....-...-------...........----------------...--....-..--
gi|294102409|ref|YP_003554267.1|  --------....-...-------...........----------------...--....-..--
gi|294102070|ref|YP_003553928.1|  --------....-...-------...........----------------...--....-..--
gi|294102390|ref|YP_003554248.1|  --------....-...-------...........----------------...--....-..--
gi|294101403|ref|YP_003553261.1|  --------....-...-------...........----------------...--....-..--
gi|294101730|ref|YP_003553588.1|  --------....-...-------...........----------------...--....-..--
gi|294102602|ref|YP_003554460.1|  --------....-...-------...........----------------...--....-..--
gi|294102663|ref|YP_003554521.1|  SLIGAALWsevkD...NLKSSGL...........GLSGGQQQRLCIARAI...AT....E..PE
gi|294101436|ref|YP_003553294.1|  --------....-...-------...........----------------...--....-..--
gi|294102150|ref|YP_003554008.1|  --------....-...-------...........----------------...--....-..--
gi|294101607|ref|YP_003553465.1|  --------....-...-------...........----------------...--....-..--
gi|294102035|ref|YP_003553893.1|  --------....-...-------...........----------------...--....-..-D
gi|294102412|ref|YP_003554270.1|  YSLFPRLR....E...RAWQKGG...........TLSGGEQQMLAVGRAL...MS....R..PD
gi|294101660|ref|YP_003553518.1|  TLLEVGIPl...D...FLDRNPF...........QLSGGEKRRIALASVL...AA....E..PA
gi|294102549|ref|YP_003554407.1|  LSAQYGLN....I...DPLAPVH...........SLPVGIQQRVEILKLL...YR....K..AE
gi|294102841|ref|YP_003554699.1|  VLEHMGLA....G...RRNDPMG...........DLSQGQRQRVLIARAL...AS....R..PR
gi|294101272|ref|YP_003553130.1|  LFERFGLN....G...FEDYLPG...........AVSGGMKQRCALIRTL...MF....E..RE
gi|294101433|ref|YP_003553291.1|  --------....-...-------...........----------------...--....-..--
gi|294101963|ref|YP_003553821.1|  --------....-...-------...........----------------...--....-..--
gi|294101356|ref|YP_003553214.1|  LLGAFLFSg...D...DIYKLIS...........VLSGGEKSRVALLKLL...LE....E..TN
gi|294102542|ref|YP_003554400.1|  ALYFVGLAps..Q...FARRKWY...........ELSGGEAQRVALASRL...AI....K..PE
gi|294101861|ref|YP_003553719.1|  --------....-...-------...........----------------...--....-..--
gi|294102400|ref|YP_003554258.1|  YLQLMSFA....R...RIDS---...........----------------...--....-..--
gi|294102043|ref|YP_003553901.1|  --------....-...-------...........----------------...--....-..--
gi|294101077|ref|YP_003552935.1|  VLKTLNID....N...LAHTPPY...........ALSGGQKRLGALAAVL...AM....K..PD
gi|294102348|ref|YP_003554206.1|  AMDFVQMS....Plf.LDRAIDK...........SLSGGERKRIELASIY...LM....K..PR
gi|294102040|ref|YP_003553898.1|  --------....-...-------...........----------------...--....-..--
gi|294101613|ref|YP_003553471.1|  --------....-...------A...........QLSGGEQSLTAIALLF...ATmevaE..VP
gi|294101367|ref|YP_003553225.1|  AIEKLNVV....I...SPDTLVS...........EMPVGHKQFTEIAREI...DKk...K..TQ
gi|294101893|ref|YP_003553751.1|  --------....-...-------...........----------------...--....-..--
gi|294101841|ref|YP_003553699.1|  --------....-...-------...........----------------...--....-..--
gi|294102070|ref|YP_003553928.1|  --------....-...-------...........----------------...--....-..--
gi|294102221|ref|YP_003554079.1|  --------....-...-------...........----------------...--....-..--
gi|294101356|ref|YP_003553214.1|  VMKGLGFS....Dg..DGQRYTS...........TFSGGWKMRISLAAML...LS....S..PD
gi|294101345|ref|YP_003553203.1|  ALVEVNAW....H...LSGRDFA...........KLSDGESQRVLIARAL...AQ....D..TP
gi|294102145|ref|YP_003554003.1|  --------....-...-------...........----------------...--....-..--
gi|294101756|ref|YP_003553614.1|  --------....-...-------...........----------------...--....-..--
gi|294102549|ref|YP_003554407.1|  LMERYNIMa...A...SENIQAG...........TLSGGNMQRLVMAREL...EQ....Q..PD
gi|294101372|ref|YP_003553230.1|  --------....-...-------...........----------------...--....-..--
gi|294101016|ref|YP_003552874.1|  --------....-...-------...........----------------...--....-..--
gi|294101780|ref|YP_003553638.1|  --------....-...-LMRRAD...........TLSGGESQRIRLATQI...GS....KlsGV
gi|294101686|ref|YP_003553544.1|  --------....-...-------...........----------------...--....-..--
gi|294102507|ref|YP_003554365.1|  --------....-...-------...........----------------...--....-..--
gi|294101471|ref|YP_003553329.1|  GMEKASLS....Er..LLHRYPC...........QLSGGELQRFALLRAL...LF....S..PL
gi|294101845|ref|YP_003553703.1|  --------....-...-------...........----------------...--....-..--
gi|294101553|ref|YP_003553411.1|  --------....-...-------...........----------------...--....-..--
gi|294101853|ref|YP_003553711.1|  --------....-...-------...........----------------...--....-..--
gi|294101780|ref|YP_003553638.1|  LIQEAGLG....Yi..RLGQSAL...........TLSGGEAQRVKLAKELskrFT....G..PT
gi|294102079|ref|YP_003553937.1|  --------....-...-------...........----------------...--....-..--
gi|294101472|ref|YP_003553330.1|  LFSALGITq...E...ASRERPG...........KLSGGMAQRALLAMAL...AS....P..AE
gi|294102235|ref|YP_003554093.1|  --------....-...-------...........----------------...--....-..--
gi|294102390|ref|YP_003554248.1|  DADRF---....-...-------...........----------------...--....-..--
gi|294101443|ref|YP_003553301.1|  --------....-...-------...........----------------...--....-..--
gi|294101748|ref|YP_003553606.1|  --------....-...-------...........----------------...--....-..--
gi|294101649|ref|YP_003553507.1|  --------....-...-------...........----------------...--....-..--
gi|294101715|ref|YP_003553573.1|  --------....-...-------...........----------------...AT....R..SS
gi|294101925|ref|YP_003553783.1|  --------....-...-------...........----------------...--....-..--
gi|294101367|ref|YP_003553225.1|  YIDTLEIKc...T...GDYQRVQ...........ELSGGNQQKVCLAKAF...AL....H..PK
gi|294101751|ref|YP_003553609.1|  --------....-...-------...........----------------...--....-..--
gi|294101046|ref|YP_003552904.1|  --------....-...-------...........----------------...--....-..--
gi|294101779|ref|YP_003553637.1|  --------....-...-------...........----------------...--....-..--
gi|294101226|ref|YP_003553084.1|  --------....-...-------...........----------------...--....-..--
gi|294101892|ref|YP_003553750.1|  --------....-...-------...........----------------...--....-..--
gi|294102315|ref|YP_003554173.1|  --------....-...-------...........----------------...--....-..--
gi|294102188|ref|YP_003554046.1|  --------....-...-F-----...........----------------...--....-..--
gi|294102320|ref|YP_003554178.1|  --------....-...-------...........----------------...--....-..--
gi|294102169|ref|YP_003554027.1|  --------....-...-------...........----------------...--....-..--
gi|294101254|ref|YP_003553112.1|  LVKKYSVSt...P...SIETPVK...........NLSGGNLQKLMLGREL...CD....A..PK
gi|294102077|ref|YP_003553935.1|  --------....-...-------...........----------------...--....-..--
gi|294102510|ref|YP_003554368.1|  --------....-...-------...........----------------...--....-..--
gi|294101748|ref|YP_003553606.1|  --------....-...-------...........----------------...--....-..--
gi|294101141|ref|YP_003552999.1|  --------....-...-------...........----------------...--....-..--
gi|294101018|ref|YP_003552876.1|  --------....-...-------...........----------------...--....-..--
gi|294101692|ref|YP_003553550.1|  --------....-...-------...........----------------...--....-..--
gi|294101032|ref|YP_003552890.1|  --------....-...-------...........----------------...--....-..--
gi|294101031|ref|YP_003552889.1|  --------....-...-------...........----------------...--....-..--
gi|294101431|ref|YP_003553289.1|  --------....-...-------...........----------------...--....-..--
gi|294102167|ref|YP_003554025.1|  --------....-...-------...........----------------...--....-..--
gi|294101458|ref|YP_003553316.1|  --------....-...-------...........----------------...--....-..--
gi|294102320|ref|YP_003554178.1|  --------....-...-------...........----------------...--....-..--
gi|294101940|ref|YP_003553798.1|  --------....-...-------...........----------------...--....-..--
gi|294102120|ref|YP_003553978.1|  --------....-...-------...........----------------...--....-..--
gi|294101791|ref|YP_003553649.1|  --------....-...-------...........----------------...--....-..--
gi|294102136|ref|YP_003553994.1|  --------....-...-------...........----------------...--....-..-S
gi|294101830|ref|YP_003553688.1|  --------....-...-------...........----------------...--....-..--
gi|294102042|ref|YP_003553900.1|  --------....-...-------...........----------------...--....-..--
gi|294102015|ref|YP_003553873.1|  --------....-...-------...........----------------...--....-..--
gi|294102787|ref|YP_003554645.1|  --------....-...-------...........----------------...--....-..--
gi|294102032|ref|YP_003553890.1|  --------....-...-------...........----------------...--....-..--
gi|294102010|ref|YP_003553868.1|  --------....-...-------...........----------------...--....-..--
gi|294101586|ref|YP_003553444.1|  --------....-...-------...........----------------...--....-..--
gi|294101458|ref|YP_003553316.1|  --------....-...-------...........----------------...--....-..--
gi|294102625|ref|YP_003554483.1|  --------....-...-------...........----------------...--....-..--
gi|294102478|ref|YP_003554336.1|  --------....-...-L-----...........----------------...--....-..--
gi|294101874|ref|YP_003553732.1|  --------....-...-------...........----------------...--....-..--
gi|294102071|ref|YP_003553929.1|  --------....-...-------...........----------------...LP....D..PQ


                                           170       180       190       200       210       220    
                                             |         |         |         |         |         |    
d3dhwc1                             VLLCDEATSALDPATTRSILELLKDINRRLGLTILLITHEMDVVKRICDCVAVISNGELIEQDT
gi|294102520|ref|YP_003554378.1|  ----------------------------------------------------------------
gi|294102529|ref|YP_003554387.1|  ----------------------------------------------------------------
gi|294102437|ref|YP_003554295.1|  ----------------------------------------------------------------
gi|294102168|ref|YP_003554026.1|  ----------------------------------------------------------------
gi|294101779|ref|YP_003553637.1|  ----------------------------------------------------------------
gi|294102457|ref|YP_003554315.1|  ----------------------I-----------------------------------------
gi|294101625|ref|YP_003553483.1|  ----------------------------------------------------------------
gi|294101185|ref|YP_003553043.1|  ----------------------------------------------------------------
gi|294102626|ref|YP_003554484.1|  ----------------------------Q-----------------------------------
gi|294101765|ref|YP_003553623.1|  ----------------------------------------------------------------
gi|294102479|ref|YP_003554337.1|  ILILDEATSSLDVAVESQIQEAMEKAME--GRTSFVIAHRLSTVRS-ADRILVLSKGHIVESGT
gi|294101904|ref|YP_003553762.1|  VLLMDEPLSNLDAKLRIYMRAEIRKIQKKLGITCIHVTHDQKEALTIADRIVVLNKGKIEQVAA
gi|294102557|ref|YP_003554415.1|  LLLFDEPLSNLDAKLREQMRIEIRHLQKRLGITSVYVTHDQAEAMSISDRVVVMNKGRIEQVGT
gi|294101807|ref|YP_003553665.1|  ----------------------------------------------------------------
gi|294101806|ref|YP_003553664.1|  ----------------------------------------------------------------
gi|294102649|ref|YP_003554507.1|  LLLCDEATSALDPKTTQSILALLDEINRKLGITIVLVTHEMGVIRQICHRVAVLEHGQVVELGA
gi|294101185|ref|YP_003553043.1|  ----------------------------------------------------------------
gi|294102868|ref|YP_003554726.1|  VLLLDEPLSNLDAKLRIRMRREIRQLQKGIGITAIYVTHDQEEALALSDRIVVMEKGEIIQIDT
gi|294102500|ref|YP_003554358.1|  ----------------------------------------------------------------
gi|294102409|ref|YP_003554267.1|  ----------------------------------------------------------------
gi|294102354|ref|YP_003554212.1|  ----------------------------------------------------------------
gi|294101565|ref|YP_003553423.1|  ----------------------------------------------------------------
gi|294101424|ref|YP_003553282.1|  IMLFDEPTSALDPELVGEVLEVIAQLAET-GMTMVIITHEMLFAKDVSDRIIFMADGNIVEQGS
gi|294101976|ref|YP_003553834.1|  ----------------------------------------------------------------
gi|294101061|ref|YP_003552919.1|  VMLFDEPTSALDPELIGEVLEVMRNLAKG-GMTMLVVTHEMGFACSVANEIMFMEEGRILESGS
gi|294101048|ref|YP_003552906.1|  ILLMDEPFSGLDPLIRREMQDELIRLQKELKKTIFFVTHDLDEAMRMGDRMAVMKNGTIVQMGA
gi|294101977|ref|YP_003553835.1|  ----------------------------------------------------------------
gi|294101084|ref|YP_003552942.1|  VMLYDEPTSALDPELVGEVLQVMKDLDNE-GMTQIIVTHQMRFARNASDYIVFMDGGEIVEMAD
gi|294101565|ref|YP_003553423.1|  ----------------------------------------------------------------
gi|294101786|ref|YP_003553644.1|  FIVCDEPVSALDVSIQAQILNLIQDLQVQFGLTYLFITHDLSVVKHLSTNIMVMYLGQVVELAD
gi|294101493|ref|YP_003553351.1|  LILADEPTGNLDSKTGIDVMKLFVRLNVESGKTIIQVTHERDMALF-GSRIITVKDGTIVHD--
gi|294101884|ref|YP_003553742.1|  ----------------------------------------------------------------
gi|294101894|ref|YP_003553752.1|  ----------------------------------------------------------------
gi|294101778|ref|YP_003553636.1|  ----------------------------------------------------------------
gi|294102313|ref|YP_003554171.1|  LILADEPTANLDSENSYNILEMMVRLNKELETTFIFATHDEKVM-KYLRRKIHLFDGRVAQ---
gi|294102640|ref|YP_003554498.1|  FIVLDEPVSALDVCIQAQILNLLGDLKKERGYTYLFISHNLSVVRYVSDEVAVMYLGQVVEKAG
gi|294101376|ref|YP_003553234.1|  ----------------------------------------------------------------
gi|294102641|ref|YP_003554499.1|  LLIADEPTTALDVTIQAQVLDLIKNLQKIVNTSLLLITHDLGIVAEICDEVAIMYAGRLVEYSD
gi|294101359|ref|YP_003553217.1|  I---------------------------------------------------------------
gi|294102459|ref|YP_003554317.1|  ----------------------------------------------------------------
gi|294101785|ref|YP_003553643.1|  VLIADEPTTALDVTIQAQVLEMMNELKKKFNMATILITHDLGIVAQTCEKAAVIYAGEIVEYGT
gi|294101376|ref|YP_003553234.1|  ----------------------------------------------------------------
gi|294102074|ref|YP_003553932.1|  ----------------------------------------------------------------
gi|294102442|ref|YP_003554300.1|  IFIADEPTGNLDIHTAEDVMRLLVALNAA-GATVIMATHDQYLVDAYRQRVVELQEGRIVRDE-
gi|294101577|ref|YP_003553435.1|  FLLLDEPFSGIDPIAVYDIQQIILSLRAK-GYGILLTDHNVRDTLAITDRTYLIHQGEIVIEGS
gi|294101171|ref|YP_003553029.1|  LLLLDEPAAGMNPEEVMALNELIKSIHMEFQLAILVIEHHMDLVMEICPRIICMNFGAKIAEGS
gi|294102413|ref|YP_003554271.1|  FLLLDEPAAGMNPLETVDLMSFIRRIRDEFNLTILLIEHDMKVVMGICEYIWVLDYGKLIAEGN
gi|294102187|ref|YP_003554045.1|  ----------------------------------------------------------------
gi|294102332|ref|YP_003554190.1|  VILADEPTAPLDSERALAVIRILNDMAQRFETAVIVVTHDEKIIPT-FKRIYHIRDGVTYEE--
gi|294102831|ref|YP_003554689.1|  ----------------------------------------------------------------
gi|294101321|ref|YP_003553179.1|  ----------------------------------------------------------------
gi|294101626|ref|YP_003553484.1|  ----------------------------------------------------------------
gi|294101069|ref|YP_003552927.1|  ILLLDEPISSLDVKNQIEIMETMKHIIKGHGLSAVMSLHDLTMALRYGDRFVFMKKGEIRYILA
gi|294102759|ref|YP_003554617.1|  FLLADEPTTALDVITQKEIILTLERLARGRNMGLLLVTHDLPLAVQICDAIAVMHEGEIVEEGA
gi|294101055|ref|YP_003552913.1|  ILLLDEPCSSLDVKNTQNIEMMLRALCQQ--YSIIIVTHNLFQARRISHRTFFILDGEIIEAGP
gi|294101254|ref|YP_003553112.1|  VLILDEPTAVLTPQEALRLFSTIQQMTAE-GHGIVFISHKLDEVLSLSDRISILRKGE------
gi|294102760|ref|YP_003554618.1|  LLLCDEPTSMQDASTRSEIIHVLNERVKE-GMAMVFVTHDLYLARGAAKRGIVLLEGECCEENS
gi|294101659|ref|YP_003553517.1|  CLVLDEPTAMLDPQGRRDLLDVLKTLHAQ-GRTIIYITHRLEETVH-CDRALVLKSGKVQWDGT
gi|294101172|ref|YP_003553030.1|  LLLLDEPSLGLAPIIIRDIFKELRRINSE-GVTILLVEQNARQALLLSHRGYVLQTGSIIMAGT
gi|294102017|ref|YP_003553875.1|  ----------------------------------------------------------------
gi|294101748|ref|YP_003553606.1|  ----------------------------------------------------------------
gi|294102409|ref|YP_003554267.1|  F---------------------------------------------------------------
gi|294102070|ref|YP_003553928.1|  ----------------------------------------------------------------
gi|294102390|ref|YP_003554248.1|  ----------------------------------------------------------------
gi|294101403|ref|YP_003553261.1|  ----------------------------------------------------------------
gi|294101730|ref|YP_003553588.1|  ----------------------------------------------------------------
gi|294102602|ref|YP_003554460.1|  ----------------------------------------------------------------
gi|294102663|ref|YP_003554521.1|  VLLMDEPTSALDPMATARIEELVRTLKER--YTVIIVTHNMQQAARISDYTAFFLMGELIEYGK
gi|294101436|ref|YP_003553294.1|  ----------------------------------------------------------------
gi|294102150|ref|YP_003554008.1|  ----------------------------------------------------------------
gi|294101607|ref|YP_003553465.1|  ----------------------------------------------------------------
gi|294102035|ref|YP_003553893.1|  IVILDEINVALDYELV------------------------------------------------
gi|294102412|ref|YP_003554270.1|  LVMMDEPSLGLAPMLVKEVFDIIREINAQ-GKTVLLVEQNAFAALKVAHHAYILEVGSIVLSGP
gi|294101660|ref|YP_003553518.1|  YLVLDEPTAGLDATGRKDLIKLLSKQKKK-GRGIIFVTHDLETALMSSDSILVLEGGREVVQGA
gi|294102549|ref|YP_003554407.1|  ILIFDEPTAVLSPREIEGLFSIIREFRKA-GKTIIFIAHNLNEVLAVSDVITVMRKGKHIAT--
gi|294102841|ref|YP_003554699.1|  ILLMDEPLASIDPEARGVLYEDLASFAG--NVTIILVSHDLSVIANGATAV-------------
gi|294101272|ref|YP_003553130.1|  IVLLDEPLSALDAITRRSLQSLLLSLQKDFKKTVLMITHDIDEALYLADTVLVLTQAP------
gi|294101433|ref|YP_003553291.1|  ----------------------------------------------------------------
gi|294101963|ref|YP_003553821.1|  ----------------------------------------------------------------
gi|294101356|ref|YP_003553214.1|  LLILDEPTNHLDMRTRDIFQ----QALTEYHGTIIIVSHDRYFLDKLVSRVIEIREGKILEYPG
gi|294102542|ref|YP_003554400.1|  VLLLDEPTASVDRVSAELIKQGVRMCREKWGTTLVLVSHDVLWVKSLSDRHLILTEGELS----
gi|294101861|ref|YP_003553719.1|  ----------------------------------------------------------------
gi|294102400|ref|YP_003554258.1|  ----------------------------------------------------------------
gi|294102043|ref|YP_003553901.1|  ----------------------------------------------------------------
gi|294101077|ref|YP_003552935.1|  LLLLDEPSSGLDERAWQNLVDVLNQL----DMALIIASHDIPFLEHVTRRGYELSSG-------
gi|294102348|ref|YP_003554206.1|  LAILDEPDSGVDLLALREVLGLLRLLADQ-GSGVMVITHREDVAAG-CDRSYLMCDGRIILEGS
gi|294102040|ref|YP_003553898.1|  ----------------------------------------------------------------
gi|294101613|ref|YP_003553471.1|  LAILDEVDASLDEYNLLRFIDLVSDYAM--HMQILAMTHRR-----------------------
gi|294101367|ref|YP_003553225.1|  LLVLDEPTAVLTESEAEILLASMRKLAAL-GIAIVFISHRLHEVIDVCDKIVVLRDGQVVHETT
gi|294101893|ref|YP_003553751.1|  ----------------------------------------------------------------
gi|294101841|ref|YP_003553699.1|  ----------------------------------------------------------------
gi|294102070|ref|YP_003553928.1|  ----------------------------------------------------------------
gi|294102221|ref|YP_003554079.1|  ----------------------------------------------------------------
gi|294101356|ref|YP_003553214.1|  ILLLDEPTNHLDTESMEWLEDWLLNF----NGTLIAISHDRHFLDKICTSTAELSQGAIS----
gi|294101345|ref|YP_003553203.1|  ILLLDEPTAFLDLPRKVELLSLLRQYAWKMNKGVLMSVHDIDLALRFADRIWVMSPSHSFTVGI
gi|294102145|ref|YP_003554003.1|  ----------------------------------------------------------------
gi|294101756|ref|YP_003553614.1|  ----------------------------------------------------------------
gi|294102549|ref|YP_003554407.1|  FLLVSQPTRGVDIGGISFIHDRLLSLRRA-GKAILMISADLDEILSLSDRIAVMNRGEIVAVLP
gi|294101372|ref|YP_003553230.1|  ----------------------------------------------------------------
gi|294101016|ref|YP_003552874.1|  ----------------------------------------------------------------
gi|294101780|ref|YP_003553638.1|  LYVLDEPTIGLHSRDTDRLLRTLRSIRDL-GNTVVVVEHDRETMLA-ADAIVEMGPGA------
gi|294101686|ref|YP_003553544.1|  ----------------------------------------------------------------
gi|294102507|ref|YP_003554365.1|  ----------------------------------------------------------------
gi|294101471|ref|YP_003553329.1|  FLVADEPTSRLDPSVQAKVAHMLVEEAHVKSIAVLFISHDEVLLNALCSRIIR-----------
gi|294101845|ref|YP_003553703.1|  ----------------------------------------------------------------
gi|294101553|ref|YP_003553411.1|  ----------------------------------------------------------------
gi|294101853|ref|YP_003553711.1|  ----------------------------------------------------------------
gi|294101780|ref|YP_003553638.1|  LYLLDEPTTGLFYTDVKKLLHILHRIVDQ-GNTVVTIEHNLDVLLS-SDY--------------
gi|294102079|ref|YP_003553937.1|  ----------------------------------------------------------------
gi|294101472|ref|YP_003553330.1|  FILLDEPTKGLDSSRKEDATALVKGIINA-GKTLLCITHDFSLPKQIGGQTGVLFSGLLVESGD
gi|294102235|ref|YP_003554093.1|  ----------------------------------------------------------------
gi|294102390|ref|YP_003554248.1|  ----------------------------------------------------------------
gi|294101443|ref|YP_003553301.1|  ----------------------------------------------------------------
gi|294101748|ref|YP_003553606.1|  ---L------------------------------------------------------------
gi|294101649|ref|YP_003553507.1|  ----------------------------------------------------------------
gi|294101715|ref|YP_003553573.1|  LVLLDELGAGTDPQEGAALGIALIDTLREKKSITLATTHH------------------------
gi|294101925|ref|YP_003553783.1|  ----------------------------------------------------------------
gi|294101367|ref|YP_003553225.1|  LLFVSEPTRGIDVGAKRVVLDTLREYNQKRGTTIVMISSELEELRSICDRIAIVNEGKIA----
gi|294101751|ref|YP_003553609.1|  ----------------------------------------------------------------
gi|294101046|ref|YP_003552904.1|  ----------------------------------------------------------------
gi|294101779|ref|YP_003553637.1|  ----------------------------------------------------------------
gi|294101226|ref|YP_003553084.1|  ----------------------------------------------------------------
gi|294101892|ref|YP_003553750.1|  ----------------------------------------------------------------
gi|294102315|ref|YP_003554173.1|  ----------------------------------------------------------------
gi|294102188|ref|YP_003554046.1|  ----------------------------------------------------------------
gi|294102320|ref|YP_003554178.1|  -----E----------------------------------------------------------
gi|294102169|ref|YP_003554027.1|  ----------------------------------------------------------------
gi|294101254|ref|YP_003553112.1|  ALIAVHPTWGLDVAATQFVREQLLLERDR-GAAVFLVSEDLEELLSLSDRLAVIFKGEIMGI--
gi|294102077|ref|YP_003553935.1|  ----------------------------------------------------------------
gi|294102510|ref|YP_003554368.1|  ----------------------------------------------------------------
gi|294101748|ref|YP_003553606.1|  ---------------------------------------------------------E------
gi|294101141|ref|YP_003552999.1|  ----------------------------------------------------------------
gi|294101018|ref|YP_003552876.1|  ----------------------------------------------------------------
gi|294101692|ref|YP_003553550.1|  -L--------------------------------------------------------------
gi|294101032|ref|YP_003552890.1|  ----------------------------------------------------------------
gi|294101031|ref|YP_003552889.1|  ----------------------------------------------------------------
gi|294101431|ref|YP_003553289.1|  ----------------------------------------------------------------
gi|294102167|ref|YP_003554025.1|  ----------------------------------------------------------------
gi|294101458|ref|YP_003553316.1|  ----------------------------------------------------------------
gi|294102320|ref|YP_003554178.1|  ----------------------------------------------------------------
gi|294101940|ref|YP_003553798.1|  ----------------------------------------------------------------
gi|294102120|ref|YP_003553978.1|  ----------------------------------------------------------------
gi|294101791|ref|YP_003553649.1|  ----------------------------------------------------------------
gi|294102136|ref|YP_003553994.1|  ILLVDEIDATLHPSILYKLLKLFEDYSNRYKIQIICTSHSLSLIEF------------------
gi|294101830|ref|YP_003553688.1|  ----------------------------------------------------------------
gi|294102042|ref|YP_003553900.1|  ----------------------------------------------------------------
gi|294102015|ref|YP_003553873.1|  ----------------------------------------------------------------
gi|294102787|ref|YP_003554645.1|  ----------------------------------------------------------------
gi|294102032|ref|YP_003553890.1|  ----------------------------------------------------------------
gi|294102010|ref|YP_003553868.1|  ----------------------------------------------------------------
gi|294101586|ref|YP_003553444.1|  ----------------------------EA----------------------------------
gi|294101458|ref|YP_003553316.1|  ----------------------------------------------------------------
gi|294102625|ref|YP_003554483.1|  ----------------------------------------------------------------
gi|294102478|ref|YP_003554336.1|  ----------------------------------------------------------------
gi|294101874|ref|YP_003553732.1|  ----------------------------------------------------------------
gi|294102071|ref|YP_003553929.1|  LILVDE----------------------------------------------------------


                                       230       240                                                
                                         |         |                                                
d3dhwc1                             VSEVFSHPKTPLAQKF................................................
gi|294102520|ref|YP_003554378.1|  ----------------glggktngvpresgfditvasevmailclsesikelkerlaqivvayt
gi|294102529|ref|YP_003554387.1|  ----------------glggkadgvpresgfditvasevmailclsanikelkerlskivvgyt
gi|294102437|ref|YP_003554295.1|  ----------------knllltkvynaepvafddiyaqarawgkalepyvadvslalreamleg
gi|294102168|ref|YP_003554026.1|  ----------------kgilavtftnkaaremgervqalvgakasamqvstfhsfglhflfrns
gi|294101779|ref|YP_003553637.1|  ----------------drpvlvlahnktlaaqlytefktffphnavhyfvsyydyyqpeayips
gi|294102457|ref|YP_003554315.1|  ----------------rqmatrvgrqnvlychvtlvpyleaarelktkptqhsvqelrrigilp
gi|294101625|ref|YP_003553483.1|  ----------------grnykmgethegsatmdwmeqerergitissaattciwrdcfvniidt
gi|294101185|ref|YP_003553043.1|  ----------------rivrgdvpeglkdrsifaldmgslvagakyrgefeerlkavlneikts
gi|294102626|ref|YP_003554484.1|  ----------------pskenlphfiqslieglkgasgklaneiafhlkepvsqyrnrlikeep
gi|294101765|ref|YP_003553623.1|  ----------------vnaltlnvttiedpverfheginqvevderagrtfevvlrsllrqdpd
gi|294102479|ref|YP_003554337.1|  HDELLEK---------ggiyrhlyelqf....................................
gi|294101904|ref|YP_003553762.1|  PFELYANPATLFVAD-figqanifkg......................................
gi|294102557|ref|YP_003554415.1|  PIELYARPSNSFVAAFigkvnfmpak......................................
gi|294101807|ref|YP_003553665.1|  ----------------erittprlaltaaeylafeqdmhvvviltdltnycealreisaarkev
gi|294101806|ref|YP_003553664.1|  ----------------esdivvyvgcgergnemtdvllefpeledprsgeplmkrtvliantsn
gi|294102649|ref|YP_003554507.1|  VKDVFMKPQSKTAREF................................................
gi|294101185|ref|YP_003553043.1|  ----------------dsednmiridmseymekfsvsrligappgyvgyeeggqlteavrrrpy
gi|294102868|ref|YP_003554726.1|  PRNIYFHAQNSFVADFigrsniit........................................
gi|294102500|ref|YP_003554358.1|  ----------------apfvkveatkftevgyvgrdvdsmirdlvetavamvkrvkieevqgpa
gi|294102409|ref|YP_003554267.1|  ----------------svkciyaymdqkerkeaylsdvtygtnsefgfdylrdnmavakdqlvq
gi|294102354|ref|YP_003554212.1|  ----------------nrmgnvvdgntvadfgaeeqkrqisintalvtlerngkrlylldtpgf
gi|294101565|ref|YP_003553423.1|  ----------------gsedamirldmsefmerhevgkligappgyvgydeggklteairrrpy
gi|294101424|ref|YP_003553282.1|  PQDIMVKPAHPRTQAF................................................
gi|294101976|ref|YP_003553834.1|  ----------------eisaareevpgrrgypgymysdlaeiyeragcvencqgsitqipiitm
gi|294101061|ref|YP_003552919.1|  PDKLLNTPQYERTRQF................................................
gi|294101048|ref|YP_003552906.1|  PAQILANPADEYVARFvqdk............................................
gi|294101977|ref|YP_003553835.1|  ----------------cnaeiiiyigcgergnemtevleefpelsdpfhnaplmermvliants
gi|294101084|ref|YP_003552942.1|  GDVLFETPQNKRTKAF................................................
gi|294101565|ref|YP_003553423.1|  ----------------ignlvagtkyrgefeermrkllkelretgdviifideihsiigaggae
gi|294101786|ref|YP_003553644.1|  SKKLFKNPVHPYTKTL................................................
gi|294101493|ref|YP_003553351.1|  ----------------erv.............................................
gi|294101884|ref|YP_003553742.1|  ----------------kkktvgiiavdpsspfsggailadrirmqrhandpdvyirsmgtrgsl
gi|294101894|ref|YP_003553752.1|  ----------------klnvpfamadattlteagyvgedvenilvrllqaadydiqaaergiiy
gi|294101778|ref|YP_003553636.1|  ----------------eadvpffsvsgsdfvemfvgvgaarvrdlfeqarkyqpciifidemda
gi|294102313|ref|YP_003554171.1|  ----------------de..............................................
gi|294102640|ref|YP_003554498.1|  NTILFKDPLHPYTQAL................................................
gi|294101376|ref|YP_003553234.1|  ----------------tdvyfthisgpeiigkfygeseerlrnvfdeaqahapaiifideidai
gi|294102641|ref|YP_003554499.1|  IRQLYSKPMHPYTQ--g...............................................
gi|294101359|ref|YP_003553217.1|  ----------------vvldegdhmldlgfkeeleaildslpncqrvwlfsatmpaeiknlakr
gi|294102459|ref|YP_003554317.1|  ----------------mvlliderpeevtdmarsvdgeiiastfdrpaeehlrvanlalekakr
gi|294101785|ref|YP_003553643.1|  VHEIFKNMRHPYT---i...............................................
gi|294101376|ref|YP_003553234.1|  ----------------sgvnfipvkgpalmskyvgeserairevfkkakqaspsilyfdeiesl
gi|294102074|ref|YP_003553932.1|  ----------------qmpdlvysiscttrqprdgerdgvdyrflseeefkklveekkflewav
gi|294102442|ref|YP_003554300.1|  ----------------ekg.............................................
gi|294101577|ref|YP_003553435.1|  PDEVAQS---------evarkfy.........................................
gi|294101171|ref|YP_003553029.1|  PEEIQAN---------sevlkaylge......................................
gi|294102413|ref|YP_003554271.1|  PDEIQSNPR-------vieaylge........................................
gi|294102187|ref|YP_003554045.1|  ----------------pvniegtgaitirmlvrnslrmrpdriivgecrgeeafdmlqamntgh
gi|294102332|ref|YP_003554190.1|  ----------------egq.............................................
gi|294102831|ref|YP_003554689.1|  ----------------dmdpqgnctsglgiearaievslydvllggasaqdalmatswqgvsll
gi|294101321|ref|YP_003553179.1|  ----------------dkapeerergitinishveyqtenrhyahidcpghadyiknmitgaaq
gi|294101626|ref|YP_003553484.1|  ----------------dkapeerergitinishveyqtenrhyahidcpghadyiknmitgaaq
gi|294101069|ref|YP_003552927.1|  R---------------deis............................................
gi|294102759|ref|YP_003554617.1|  PADIVTKPRHRHT---tq..............................................
gi|294101055|ref|YP_003552913.1|  TKDLFENP--------................................................
gi|294101254|ref|YP_003553112.1|  ----------------kt..............................................
gi|294102760|ref|YP_003554618.1|  TEALLSAPKHAYTRALv...............................................
gi|294101659|ref|YP_003553517.1|  ISELFRH---------te..............................................
gi|294101172|ref|YP_003553030.1|  SEDLLNS---------adirnaylg.......................................
gi|294102017|ref|YP_003553875.1|  ----------------aqmgafipaaeasmglmdrvftrigardelsrgnstfmvemietanil
gi|294101748|ref|YP_003553606.1|  ----------------aafkaseagkqvvvlvpttilaqqhyhtfrsrmagfpirvevlsrfvs
gi|294102409|ref|YP_003554267.1|  ----------------laketlrkegnvedldpskyqqlleeyrqicakerdevldkgglkiig
gi|294102070|ref|YP_003553928.1|  ----------------egkfrfidtaglrkksridsdieyysfvrtlqavdrsdvallvmdase
gi|294102390|ref|YP_003554248.1|  ----------------llqaveggyqgafmapteilaqqhyyrlhsfleplgvsvvlligslkn
gi|294101403|ref|YP_003553261.1|  ----------------aeaqkaggiaafidaehaldprlaaslgvdvqslyvaqpdsgeqalyv
gi|294101730|ref|YP_003553588.1|  ----------------gqkqsvepcndcpnclainggesldvieidgasnnsvdevrelkahvs
gi|294102602|ref|YP_003554460.1|  ----------------ctvewngyliniidtpghadfsgevervlstvdsvlllvdanegpmpq
gi|294102663|ref|YP_003554521.1|  TPKLFTSP--------g...............................................
gi|294101436|ref|YP_003553294.1|  ----------------agaevkpyasgktdpnramvsvpdprfehlvtifepkkqtpatvefvd
gi|294102150|ref|YP_003554008.1|  ----------------rergitiklvpvrmsykskdgneyilnlidtpghvdftyevsrsiasc
gi|294101607|ref|YP_003553465.1|  ----------------aidadiglrnldvvmglenrvvynfidviegtcrlpqalirdkrvdnl
gi|294102035|ref|YP_003553893.1|  ----------------eldqvidilkkrppfvevvltgrnppvalleyadlitemkeirhpfqk
gi|294102412|ref|YP_003554270.1|  GEDLLKNPR-------vkeayl..........................................
gi|294101660|ref|YP_003553518.1|  PGKIIE----------els.............................................
gi|294102549|ref|YP_003554407.1|  ----------------lprseat.........................................
gi|294102841|ref|YP_003554699.1|  ----------------acv.............................................
gi|294101272|ref|YP_003553130.1|  ----------------mkirdritlpsekprnldsseyiaik......................
gi|294101433|ref|YP_003553291.1|  ----------------vpklmgvtdspygspqgiippassifdikvmsvnlllddptkpvvwrg
gi|294101963|ref|YP_003553821.1|  ----------------itareaggitqhigastvtyegknivfldtpgheaftamrargaqatd
gi|294101356|ref|YP_003553214.1|  NY--------------syfiq...........................................
gi|294102542|ref|YP_003554400.1|  ----------------tss.............................................
gi|294101861|ref|YP_003553719.1|  ----------------mggqlrvttgpalekagdiaailsnlepfdvlfideihrlpanveeil
gi|294102400|ref|YP_003554258.1|  ----------------kqqevaeisralkgvareldvpvialsqlsraveqrnekmpqlsdlrd
gi|294102043|ref|YP_003553901.1|  ----------------qkkkepvlwtrepggwvhgdfvrtlllekdlrhelselflfvidrceh
gi|294101077|ref|YP_003552935.1|  ----------------................................................
gi|294102348|ref|YP_003554206.1|  AA--------------avkry...........................................
gi|294102040|ref|YP_003553898.1|  ----------------qlkiwgertgsrviaqqqgsdsaavaydalqaarasgadvliidtagr
gi|294101613|ref|YP_003553471.1|  ----------------stmeradvlygvtmdepgls............................
gi|294101367|ref|YP_003553225.1|  P---------------ak..............................................
gi|294101893|ref|YP_003553751.1|  ----------------slggvrdeaeirghrrtyvgaqpgriiqkmrqagtknpimlmdeidki
gi|294101841|ref|YP_003553699.1|  ----------------iagypfttlspnlgilavdddrivvadvpgliegahenkglgiyflrh
gi|294102070|ref|YP_003553928.1|  ----------------eaivddmpgvtrdriygetewkgrqfyivdtggllvrdehplvegirk
gi|294102221|ref|YP_003554079.1|  ----------------ayalsrlgiktlvvstdpahsladafnrpigldvipvaenlwgieida
gi|294101356|ref|YP_003553214.1|  ----------------lykg............................................
gi|294101345|ref|YP_003553203.1|  ----------------pedl............................................
gi|294102145|ref|YP_003554003.1|  ----------------scdrlneekkrgitielgfaplklhdgrvvsivdvpghekfirqmvag
gi|294101756|ref|YP_003553614.1|  ----------------tdtpgihrprhklgealvkaavrslenadlilyvvevddisispeddr
gi|294102549|ref|YP_003554407.1|  R---------------keasr...........................................
gi|294101372|ref|YP_003553230.1|  ----------------esraivtaipgttrdlieevltyrgipirlvdtagigapgdeieamgi
gi|294101016|ref|YP_003552874.1|  ----------------yvssekfinefiqsiknnrtqefkskyrsvdilliddiqflgnkgssq
gi|294101780|ref|YP_003553638.1|  ----------------geqgg...........................................
gi|294101686|ref|YP_003553544.1|  ----------------lyisgeesasqvalrarrllalhnnldlfcdtdldgalshveghgfvv
gi|294102507|ref|YP_003554365.1|  ----------------dykpsleppfhivhptastvaicgggaslrpgeislahrgilfldeft
gi|294101471|ref|YP_003553329.1|  ----------------l...............................................
gi|294101845|ref|YP_003553703.1|  ----------------fasgkraqselirageeeaevialffcprtlqlpeeisseegnlflkr
gi|294101553|ref|YP_003553411.1|  ----------------qnahnplvvacdlrrpaaieqlkvlaqqskvafygpsggtqdvikvak
gi|294101853|ref|YP_003553711.1|  ----------------iaglcycrkpeelrllmidpkrvelsiyehlphmlakpvtspkkaiqa
gi|294101780|ref|YP_003553638.1|  ----------------iidlgpeggmeggs..................................
gi|294102079|ref|YP_003553937.1|  ----------------dyldtgaiyralafylnamgfepvespylteilskikvslsdgcvyin
gi|294101472|ref|YP_003553330.1|  SQIVLQHPSHPYTQG-l...............................................
gi|294102235|ref|YP_003554093.1|  ----------------vgnwpgvtverkeghfsyegmnftlvdlpgiyslgaasideqvasefl
gi|294102390|ref|YP_003554248.1|  ----------------glsqlhqlrgrvgrggnqsycvllsnpttregverlkvmcattdgfki
gi|294101443|ref|YP_003553301.1|  ----------------slleinavsakvselrdlveeaknlkilsgsaaiafvdeiyhfnksqq
gi|294101748|ref|YP_003553606.1|  ----------------dfyngnldilvcttivesgldiprantlivddaqelglaqmyqlrgrv
gi|294101649|ref|YP_003553507.1|  ----------------kektklgcqaqefmnggklvpdeiivgmmgerlkekdcekgflldgfp
gi|294101715|ref|YP_003553573.1|  ----------------npiksyalttphvetasmefnvetlaptyhllmgipgrsnaiyiaery
gi|294101925|ref|YP_003553783.1|  ----------------ndydgsrvilidphgeyasafpsakvfrinapsnplyipfwlmnfdel
gi|294101367|ref|YP_003553225.1|  ----------------gt..............................................
gi|294101751|ref|YP_003553609.1|  ----------------gvamlkagaisrivlvrpaveageslgylpgdlrekvepyvrplydaf
gi|294101046|ref|YP_003552904.1|  ----------------kaqmpegisriiftapikalsnerymdlrrmgfdvgietgdfkrneea
gi|294101779|ref|YP_003553637.1|  ----------------fdrpvlvlahnktlaaqlytefktffphnavhyfvsyydyyqpeayip
gi|294101226|ref|YP_003553084.1|  ----------------nypgttvgflegwlrynsevyriidvpgaytldptneaeqvarrmvde
gi|294101892|ref|YP_003553750.1|  ----------------pgktrsvnfykieaevdfflvdlpgygyaargfkekekwaklieqyit
gi|294102315|ref|YP_003554173.1|  ----------------eealmdnipviaidpkgditnlllsfpeqrsedflpwinienataegf
gi|294102188|ref|YP_003554046.1|  ----------------gditielaegcqriwlvtdcsctgvknlhlvtglldqlriswiergvi
gi|294102320|ref|YP_003554178.1|  ----------------lrtdlehdrailmeikrlweqidrdpkllkfkkelstnatlqknhlii
gi|294102169|ref|YP_003554027.1|  ----------------kkaasfrfaviegdiatsrdaerlsklgvpaiqinthggchleanlvs
gi|294101254|ref|YP_003553112.1|  ----------------ldhpe...........................................
gi|294102077|ref|YP_003553935.1|  ----------------rnlyvadqlfstldtyvrkvelsdghdvlvsdtvgfirdlppaliaaf
gi|294102510|ref|YP_003554368.1|  ----------------rshnevhrrl......................................
gi|294101748|ref|YP_003553606.1|  ----------------tlskwkqekgilatspggllspfltgegvfplrremgeergrllrwle
gi|294101141|ref|YP_003552999.1|  ----------------awkwgsgvasrhpisrfiflyptratategfrdyvswapetdgtllhg
gi|294101018|ref|YP_003552876.1|  ----------------kniiqcdgkrithgnvrslipalaflpgdlaivdgapsvrrqfldrlc
gi|294101692|ref|YP_003553550.1|  ----------------icdeahrmvdaarsissvrvswedlvrllrskgaataesflsnreeeq
gi|294101032|ref|YP_003552890.1|  ----------------lskgtaidldvdepdlglvlqiknpkkenvykvvpqieaarckgcgvc
gi|294101031|ref|YP_003552889.1|  ----------------lqlllnpqdeqafsftgrkipeidterctvcggcvgfcrfnalekann
gi|294101431|ref|YP_003553289.1|  ----------------qvcglnptvisldnyfvdrektpldeqgnydfevleaidldllesqla
gi|294102167|ref|YP_003554025.1|  ----------------aserwgtqvllgnghinpsvvasivfsdmteyewvcdmihpfvrieme
gi|294101458|ref|YP_003553316.1|  ----------------agklvideelenptivvitdrndlddqlfstflkseellrntpvqaqd
gi|294102320|ref|YP_003554178.1|  ----------------vfsdfrvpadyesigrldnliergtekytniiideahrfrtettitye
gi|294101940|ref|YP_003553798.1|  ----------------nsprirearegmkkhlnrlevvgeesgqrwtidrlekhvalripslvv
gi|294102120|ref|YP_003553978.1|  ----------------takgksavfvpvveildeiragfdegtaykiqqavkdadcvaiddlga
gi|294101791|ref|YP_003553649.1|  ----------------dglgargvrspsftlineyegrlplahvdlyrlergdeyelglceyad
gi|294102136|ref|YP_003553994.1|  ----------------alarkynviylldn..................................
gi|294101830|ref|YP_003553688.1|  ----------------dqglfavdnippallpqllellsqhraavqeglaavvdvrggrllndl
gi|294102042|ref|YP_003553900.1|  ----------------vascrlvviqsadtlllpaansmlkiveeppehgvilfllendkflpt
gi|294102015|ref|YP_003553873.1|  ----------------evisvdsrqvyrymnvgtdkvtfqtrqhilhhmldvvdpdevfsaadf
gi|294102787|ref|YP_003554645.1|  ----------------slfgcpdgrssrnlyapphggkqkgsliieslkgerfslvmngrnstf
gi|294102032|ref|YP_003553890.1|  ----------------slqrlhesakekpapddwiyaynfsdpsrplainlpagkgkemgsafe
gi|294102010|ref|YP_003553868.1|  ----------------pyfcirqvsdvlekkglsvitmpeqakwldmslvtpkvdwalhdestr
gi|294101586|ref|YP_003553444.1|  ----------------gihvgyikhshekvlspmdtdtgkvlsqgipalywgvdgcryekpgei
gi|294101458|ref|YP_003553316.1|  ----------------akdivehfekrdlaqeneggkgmivamsrriaidlykeivalrpdwhs
gi|294102625|ref|YP_003554483.1|  ----------------negltvgqtalwdiarriwnagehgwplgetwdilrepclagreiats
gi|294102478|ref|YP_003554336.1|  ----------------phvpvavsrdrlkdvealqkhnvelivaddafqhrrlgrdvdivlvda
gi|294101874|ref|YP_003553732.1|  ----------------irralfefpehreevvsflekqapctvmiiatstamalkivrilnlpq
gi|294102071|ref|YP_003553929.1|  ----------------esspayrmqaapllhi................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  ydgtavtagdlnaqgsmavvlkdalkpnlvqtlehvpafvhggpfaniahgcnsiqatkyglkl
gi|294102529|ref|YP_003554387.1|  yngtvvtagdlnahgsmaallkdalkpnlvqtlehvpafvhggpfaniahgcnslqatkyglkl
gi|294102437|ref|YP_003554295.1|  kgilfegaqgtlldvdhgtypfvtssspiaaggcvglgvgpsdvdrvigvvkayctrvgegpfp
gi|294102168|ref|YP_003554026.1|  dqleflglrkgfaifdrndsrslvkkimedlkldpkqidptnvldhiskaktegnhktlepvgl
gi|294101779|ref|YP_003553637.1|  sdtyiekdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavgekwd
gi|294102457|ref|YP_003554315.1|  diiicrshypicdemkekialfcnvpkeaviealdeptiyqvplslqaqefdrlvmrllsf...
gi|294101625|ref|YP_003553483.1|  pghvdftveversmrvldgavavfcavggvepqsetvwrqadkyhvpriafvnkmdrvgadfyq
gi|294101185|ref|YP_003553043.1|  egriilfidelhtivgagaaegaidagnmlkpmlargelhcigattideyrkriekdaalarrf
gi|294102626|ref|YP_003554484.1|  witvftqgfdekeqayrscllgfsailwqlwdefrrrknrlsfddmiryamealehspsyaerf
gi|294101765|ref|YP_003553623.1|  iilvgeirdsetahlvmraaltghlvlstlhtddaanaplrliemgvppflivsslkavvsqrl
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  pgrrgypgylytdlatmyeragrlkgkkgsitqipiltmpeddkthpipdltgyitegqiilsr
gi|294101806|ref|YP_003553664.1|  mpvaareasiytaitmaeyyrdmgysvalmadstsrwaealremsgrleempgeegypaylgtr
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  svilfdeiekahhdvfnvllqilddgrvtdsqghvvdfkntviimtsnigaplllegitgdgqi
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  eeraewrlvdallprperktsmpdfmkifsgkeaeetppqeedtirestrnkvyallkagklde
gi|294102409|ref|YP_003554267.1|  rghhfcivdevdsilideartpliisgpsednvemyttadqiarqlkegrdfekdekernvaft
gi|294102354|ref|YP_003554212.1|  adfigemrsamrvsdsalavvsglhgvevqtgkayeyaedfsipvafvvskldrensdyartld
gi|294101565|ref|YP_003553423.1|  svvlfdeiekahedvfnillqiledgrltdgqghtvdfrnaviimtsnigakdwvkgtslgfsi
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  pdddmthpvvdlsgyitegqivldrgihdrgayppinvlpslsrlmnk................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  nmpvaareasvylgmtlaeyfrdmgyntaimadstsrwaealreiggrleempgeegypaylgt
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  gavdaanilkpslsrgefqvigattldeyrkyiekdaalerrfqpvmveepsvddtisileglr
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ggvsrstreavkildacgkdvviietvgvgqseidivkladtvclvlvpgmgddiqimkagime
gi|294101894|ref|YP_003553752.1|  ideldkitrksesasitrdvsgegvqqallkilegtlsnvppkggrkhpyqdfiqmdtsnilfi
gi|294101778|ref|YP_003553636.1|  vgrhrgaglggghdereqtlnqllveldgfdestgiiliaatnrpdildpallrpgrfdrhivv
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  apkreemggekqverrvvaqllalmdglesrgqvivigatnipntldpalrrpgrfdreisipi
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ylktpvfislteegeahedithevylvptrhkeeglinvllwekpsraivfchtraetveltrr
gi|294102459|ref|YP_003554317.1|  lvetgkdvvllldsitrlarasnlvvppsgrtlsggmdpaalyfpkrffgaarnieeggsltvi
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  vpirgrdsgagasftervisqflaemsgieelkgvtvlattnridlidpallssgrfdvvlelp
gi|294102074|ref|YP_003553932.1|  vhehlygtlksdvekvleagvdvvleidvqgalqvknafddsvlifimppskeelerrlrnrgt
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  dgslttlhansprdvlsrlesmvlmagmelpvraireqissgidlivhqerlkdgtrr......
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  patidlagaevelasvisretclrrhmanlnqfdvaiidcppslglltinalvaahklvvpiqc
gi|294101321|ref|YP_003553179.1|  mdgailvvsaadgpmpqtrehvllarqvnvpavvvfmnktdqvdddelldlvemeirellskyd
gi|294101626|ref|YP_003553484.1|  mdgailvvsaadgpmpqtrehvllarqvnvpavvvfmnktdqvdddelldlvemeirellskyd
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  hnvtdrsivvldeigrgtstydgmsiawavleyldhgcgskpkvlfathyhelvaledhlnglk
gi|294101748|ref|YP_003553606.1|  tsrqkriledtkkglvdiligtqrllqkdiefkdlglliideehrfgvmhkeklkdtregldvl
gi|294102409|ref|YP_003554267.1|  terhesrridnqlrgrsgrqgdpgssrfylsleddllrlfgseriqgimeklgmeegeai....
gi|294102070|ref|YP_003553928.1|  pttdqdkkmaaqviekgkglillinkwdtleaadklgdemrkrvrdempflshapllfvsaltk
gi|294102390|ref|YP_003554248.1|  rareltlqkistgeahvvvgthalfsdpvtfsnlgfavideqhrfgvlqknalrakganegqap
gi|294101403|ref|YP_003553261.1|  ldtlvrsgavdlvvvdsvaaltpqaeidgkigdsqlglqarlmsyalrrltsaisrsncvvvfi
gi|294101730|ref|YP_003553588.1|  lsafsslykvyiidevhmlslsafnallktleeppshvvfilattephkvpvtirsrcqhipfr
gi|294102602|ref|YP_003554460.1|  tryvlmralamglrpivfinkvdrphanpmsalnqtfdlfielgaaeeqldfpvlygsgldgwa
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  laglsrdaskgaglgnaflsfvaesdalvhvvrtfdnpevphpednidpardwnivemeliyrd
gi|294102150|ref|YP_003554008.1|  egallvvdasqgveaqtvanaymavdqgleiipvinkidlpsahpesvqkeieevvgidadgai
gi|294101607|ref|YP_003553465.1|  fllpaaqtrtkdavspdqmvelcemlkkegfdfilldspagieggfknaaagatealvvttpei
gi|294102035|ref|YP_003553893.1|  gitgrrgiey......................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  piiasvikqfwedvawdktdfiivdlppgtadapltvmqtidldgflvvtspqelsvmvvekal
gi|294101963|ref|YP_003553821.1|  iailvvaaddglmpqtkeainharaagvpivvavnkidkpaarpdrvrqqlsdvglvpeewggd
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ypsmedfslhiivgkgplannicltlppftlvgattrlglltsplrarfgiveqlalynvdets
gi|294102400|ref|YP_003554258.1|  sgaieqdadlvmllyrpgyydtaaspeeednratiriakhrngptgdvnlvfl...........
gi|294102043|ref|YP_003553901.1|  vsqvispalscgqivlcerytdstrayqiwgrglpeekvedlfawcsfpepdltlwidtplpva
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  lhskhnlmeeltkivrvierevgrdsmenllvldavmgqngfaqaesfhkalslngvilskydn
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  gqdfrgdpasallevldpaqnsnftdhyiesafdlsnvifittanvthtipaplldrmevirlp
gi|294101841|ref|YP_003553699.1|  iertrvlihvldlsvgtpedvlyqwevicsefkaykesllerpymvvgnkidierghenapaie
gi|294102070|ref|YP_003553928.1|  qatlaieeshvilfvidgfngpnwmdedvahilrrsgkpvivvanklddgihedrvydayslgf
gi|294102221|ref|YP_003554079.1|  eeeakkymkaiqdkmlhivsaviveeikrqieiaymspgaeeaaifdkfielmesignpydviv
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  asgidavmlvvaadegvmpqtrehlailnllgvhdgviviskadlvdeellelaiadvtdfvqg
gi|294101756|ref|YP_003553614.1|  iieilqevstpiflvvnkidqvqqserrlmavaslfkeklpivgalgvsakkgynidklvqilk
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  araekammeadvriwvidgsepltpadlalvqkisatnhivtinkadlplviseemingllpqs
gi|294101016|ref|YP_003552874.1|  eeffhtfnqlhvskkqivicsdrppkeiqniedrlvsrfewglvtdiqmpdletriailqkkaq
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ldsvqamrssledgwpgtpsqvravaqqcidsakktgipfvvvghitkegriagpmllehmvda
gi|294102507|ref|YP_003554365.1|  efrrdllealrqpledgsivvsraagrvefpcrvlllaacnpcpcgwagdpvescscsayeker
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  vftrngrgktfiqgklfplslfnevaapllriqsqfaqlelldsdrqrdildsyggeeiiclkn
gi|294101553|ref|YP_003553411.1|  ealayaedhlndviifdtagrlhvdedlmeelsrlkdlvnpheillvvdamtgqeavkvatsfh
gi|294101853|ref|YP_003553711.1|  lawavremeqrydifakarvrnlagynekaipkdrlphiviivdeladlmftaqkdvedyicrl
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  gadvtehirsprvdsivssyaalptvrrcllsiqreqaeegglvadgrdmgtvvfpdatikiyl
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ikekpelaitvvdasnlerslylvvqmleagqpliialnmadvaenkgirihreklekalgvpv
gi|294102390|ref|YP_003554248.1|  aeadlrlrgpgevcgvrqhgitdfrvadllkd................................
gi|294101443|ref|YP_003553301.1|  nallpsvekgdiilvgtttenpwfeinktllsrlvvfqlkplaeedlvqilykalkdeekglga
gi|294101748|ref|YP_003553606.1|  grreegayayflypetmplqketmerfeaisafsdigsgyslalqdlqirgsgdiigvsqhgqd
gi|294101649|ref|YP_003553507.1|  rtvpqaealdqllatmnlsldavilldvddevvvkrlcgrrmcrqcgeiyhvtfkpssqgmrce
gi|294101715|ref|YP_003553573.1|  gmpsevlqkaratlkeq...............................................
gi|294101925|ref|YP_003553783.1|  afflvgakptddqrveyrllrelittfkkencklksgdvtqefitadspipfsarklwyemnww
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ydlfsperflryidknvieiaplaymrgrtlndsfiildeaqnttpeqmkmfltrlgfgskavv
gi|294101046|ref|YP_003552904.1|  piicctqeiytlkytkephqkliidefhyifedpdrartyidgirgtapttsilvmsatfsqpg
gi|294101779|ref|YP_003553637.1|  ssdtyiekdasindrieklrlaatkalverrdvivvasvsciyglgkkemyeevifpfavgekw
gi|294101226|ref|YP_003553084.1|  gadlaiivldatalernlylafqamergihtivalnmvdearhrgisidveklekllgvpvvpt
gi|294101892|ref|YP_003553750.1|  qretlqllvhlvdfrhgllkndqelqewisqigipslvvftkadkiskgrhkgmlhsyirkglk
gi|294102315|ref|YP_003554173.1|  ppseyaareaekwkkglagwgidgdrikkmresvsfsiytpgsnsgikvnvlgsfrcpsekiin
gi|294102188|ref|YP_003554046.1|  vnkaeredrsivekiqreygvkgllpfdeklekgwlkgeplilsqprspyskvireiaselvgk
gi|294102320|ref|YP_003554178.1|  ftesketanylfeeinkeypkkvllftgdskeavrdkvianfdararskkgdyrilistevlse
gi|294102169|ref|YP_003554027.1|  kafkelpledldvifienvgnlvcpaefdigedmkvavssvpegadkplkyphlfseakavllt
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  rttleeisvsslillvldgsmpdvmetldvveetlsdigagaiprlivlnkidkidlslipflq
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  vagyervdlvwtpgqyvvrgfivdiydpayalpirieffdeivesirsfhpqsqmsaatldeie
gi|294101141|ref|YP_003552999.1|  tsnyelqgmfdnpdprsekefltndrlfavglwqkrlfsatvdqflgfmrhdyrsscllpllad
gi|294101018|ref|YP_003552876.1|  allfplyvrkmsdcrralrhrvillrerkdpsltskvlaplvswiwstraaavdllkigiqefr
gi|294101692|ref|YP_003553550.1|  gvlrdelssvqeegrklfellevsiadgvlipvrneelyrcgllvsshietalkmlrsieelcn
gi|294101032|ref|YP_003552890.1|  adncafgalnqfgthapvvnmqlchgcgvcelvcpqkaikdskasigimniknqesfwflegil
gi|294101031|ref|YP_003552889.1|  gitllpwkcegcggcalvcphqaismhsyeqgqywrgtttygplwharlhageensgmlvarlk
gi|294101431|ref|YP_003553289.1|  kllkgeevrvpefdfikgkkfpgatlrlnkhdvliiegihglnekvtavvpeemkfgifvsplt
gi|294102167|ref|YP_003554025.1|  rkvaslqgwviaeipllfenripwwvdlsvyvtapldlrlarnevrgwnkeeierrerflrnae
gi|294101458|ref|YP_003553316.1|  rvhlrellnnrtsggiifttiqkfapftnetngevidfnrwgrvaensspytantmltdrrnvv
gi|294102320|ref|YP_003554178.1|  klaeicrgkrvilvtatpynnspkdilsllklfqkgqkstipnlpnlesffnsldkklkqldrk
gi|294101940|ref|YP_003553798.1|  idyltllkrpgqsdleaveevmprlktltqrlkirtlilsqlgraskldqrkgatgghakgggi
gi|294102120|ref|YP_003553978.1|  qrkdkswvderlfslidaryrsgkqtiittnacsmsqlkemlgehgtrivsrltema.......
gi|294101791|ref|YP_003553649.1|  dgfvlviewpdrlaeqpt..............................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  fsvvdslkgtiplvqvlfldssdeslvrrfettrrrhplgdhipvlegiqkerallapvreyad
gi|294102042|ref|YP_003553900.1|  lksrcwnlal......................................................
gi|294102015|ref|YP_003553873.1|  vdksmaaierimnrgkiplfvggtpfyyhalfegvltkdlprdrkltdelekfaskhgnqalhd
gi|294102787|ref|YP_003554645.1|  sgarngtsledllgyvdremyerifsvgledmqkirplndrgiqsrffsagaglgtaslptfla
gi|294102032|ref|YP_003553890.1|  ellselkiaiskafeksqyedakaqlvknfqeqvnglmeevrawagekgfalkrtpqgfvnipm
gi|294102010|ref|YP_003553868.1|  llmdiggdaegalalkqfepiikkvgyrlilvvnafrpqtasvtriqkmmkkmesicglevgal
gi|294101586|ref|YP_003553444.1|  siydiqnrigsnfdillleggksfpchkiw..................................
gi|294101458|ref|YP_003553316.1|  ddlmsgkikvvitgsssdpsdwqafigskadretlakrmkdrndelklvivrdmwltgfdvpsm
gi|294102625|ref|YP_003554483.1|  ppadiftlnekgwigflehaapergldsfkkmclfvktikkggtpveilsalyslaaenpswgk
gi|294102478|ref|YP_003554336.1|  ccpfgngrlvpagilreppkaiqrahivvitkadqvs...........................
gi|294101874|ref|YP_003553732.1|  perfi...........................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  sdyfiteagfgadlgaekffdikcregnlhpsavvivatvralkmhggvakseltgenlealsk
gi|294102529|ref|YP_003554387.1|  adyfiteagfgadlgaekffdikcrignltpsavvivatvralkmhggvakneltgenlealsk
gi|294102437|ref|YP_003554295.1|  tedlgdhgqtlrdrggeygattgrprrcgwldmvalkyavrvngmssialtkldvltgfekiki
gi|294102168|ref|YP_003554026.1|  egiehevyrkyhdelrrqnavdfddllilplhllmvdeklreqeqsrldwilvdeyqdvnkpqy
gi|294101779|ref|YP_003553637.1|  rrgfmerlidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidpvsgh
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  vvngirtrlgarsvplqlpigsedrfsgivdliqmkavffqddlgtapvvgeipgelmadvkka
gi|294101185|ref|YP_003553043.1|  qpvlveqpdvedtisilrglkerlevhhgvrirdnalvgaavlsnryitdrflpdkaidlvdea
gi|294102626|ref|YP_003554484.1|  keilvdefqdtnplqdrliqavrshsqrlfivgdlkqsiyrfrhadlslfgsyikkakyghgdy
gi|294101765|ref|YP_003553623.1|  irllcplckkpdsnspvgcsycggrgfhgrvgvfeylpitervqelllhkapvqkirtqarkeg
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  glhrkgiyppvdvmpslsrlkdk.........................................
gi|294101806|ref|YP_003553664.1|  lasfyeragraiclgsdgregsvtaigavsppggdlsepvsqntlrvtkvfwgldaslayqrhf
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  kedareavmkelrqafrpeflnrvddvvlfkplqrheirqivkllaqelqkrlkdhridlelse
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  revelevaesasmgipilggagmdsmgmninemlsgllpkktkkrrmkvsdgkkllqaeeaekl
gi|294102409|ref|YP_003554267.1|  edgiarcenllkmpglfsdaansdlahrivqavkahvlfqkdvhyvvkdgeiiivdeftgrlmf
gi|294102354|ref|YP_003554212.1|  dikkqlsdkavpfflpigkeasfkgvvdilnqkayeyvtdgsgsfkeisipaemvdevsaares
gi|294101565|ref|YP_003553423.1|  sgeadgyfdwdktksdildavqktfrpefinrvdemvvfrplskkemlvivdimlsdvrerlry
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  rlaqyyeragrakllglperegsvtvinavspaggdfsepvtqaslrlsgafwaldkrlaqqrh
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  dryeshhrvkisddalvaaarlssryiterflpdkaidlideaaararlktmeipanlkdiehd
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  iadifvvnkadrpgaekietevklmldligktdwfppihmtvaekgdgvaelvegiekhgaflk
gi|294101894|ref|YP_003553752.1|  cggafagieevigrrvnkkmigfggdilsvkehrnyelmrqvqpedlmafgfipeligrlpvvv
gi|294101778|ref|YP_003553636.1|  drpdvkgreeilavhvrnkkiaddvdlgvvarrtpgfvgadlanlvneaallaaragkslitma
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  pdrngrfeilqihtrgmplaedvdlmrlsdithgfvgadlealakeaamsslrellpcidyeqa
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  lhdenfqamclhgemsqrernmalsqfrsgrtpllvatnvaargldvegvshviqmglpdnret
gi|294102459|ref|YP_003554317.1|  gtalvdtgsrmddviyeefkgtgnmelhlsrklaeqrifpavditksgtrreell.........
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  mpdakarleifqihlqkkplaedvhleelvrsteghsggdihficrkasalairdflkigekga
gi|294102074|ref|YP_003553932.1|  eeedtvqlrlsnalkemekmhmydyvvvndsvlraaleikriiasynl................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  eyyalegvgqlahtiglvrdclnpdlavdgvlltmydsrtrlandvveevrrqfgeivfstivp
gi|294101321|ref|YP_003553179.1|  fpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapqretdkpflmpiedvfti
gi|294101626|ref|YP_003553484.1|  fpgddvpiirgsalkvleegtgeendpvskciwelmaacdsyipapqretdkpflmpiedvfti
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  nlsmavhegergisflykvvdgpadrsygievarlagippavlkrafhlletfe..........
gi|294101748|ref|YP_003553606.1|  tlsatpiprtlslslrglrsfsiistpp....................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  rglnkltqtiknvqenrsrrigttelnrlirdvlafqtlptsrkgrvlkiyyctqtsiepptfv
gi|294102390|ref|YP_003554248.1|  hilvmtatpiprtltlsvygdlsvsvidempp................................
gi|294101403|ref|YP_003553261.1|  nqlrakistgyssgpqetttggralkfyssvrvevkrgksinkgedaighelwmkvvknkqapp
gi|294101730|ref|YP_003553588.1|  kidvqnivkslsmvahnenrnaeeealweiarqadgamrdalslleqvma..............
gi|294102602|ref|YP_003554460.1|  vrdlnkyahegmkhlfetiaeyvpapkvnlhap...............................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  lgvidnrlsrlaakkrllpeeeeekkllercqaflmeekplrelglsedeqrklsgfafltlkp
gi|294102150|ref|YP_003554008.1|  lasakegigiqdilerivaqvpapegdteaplqalifdsvynnyrg..................
gi|294101607|ref|YP_003553465.1|  psvrdadriigllesmekkpirlvinrvkpsmvkegemldvqdvldvlaieligivpdddsvvk
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  nmtkmmevpllgavenmsyvtcpdcgkaievfgpshvkeieekfslpvlgkfpldlelshlgdq
gi|294101963|ref|YP_003553821.1|  simvdvsaktgegiphllemvllvaemeelradp..............................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  eivqrgakvlgieieeeaayeiarrsrgtprvairllkrvrdvaevrqspsintavasvalnm.
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  inrikttrghfdriesetdgflnrvcegykelskrfphrivridgsqpteevsaqiwkvvevhl
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  takggvilaiahrlalpiryiglgesvddlrlfepqefvralle....................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  gyvaeekihiakkhllpklfkehgltdkmisitsktvektirdytreagvrnlqrslatlcrkv
gi|294101841|ref|YP_003553699.1|  sfmkarnipyyntsaitgegiaefmgnivalcrehtrphsei......................
gi|294102070|ref|YP_003553928.1|  ehvvgisalhkryiddlmdmavsllpsdeee.................................
gi|294102221|ref|YP_003554079.1|  fdtaptghtlrlitlpeilgiwiehliekranamelmkvaakydkdlqekikedpiidtlqarr
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  tflegkvvvpvssvtnknipllmeelaklidrvqprtrrgpffmpidrafpisgfgt.......
gi|294101756|ref|YP_003553614.1|  dklpagfpwydeeiltdrperflageiirekvlllth...........................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  pvfvisaekregiealkdai............................................
gi|294101016|ref|YP_003552874.1|  irnyevpedvisflaqnvpsnirelegalnri................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  vllfsgedtsayrmirgtknrygntdelgifemtekgl..........................
gi|294102507|ref|YP_003554365.1|  yskrlsgpildridlhvsvprllpkelisfedqsgedsetvrqrvcearekqrlrwrkygfhcn
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  elrsvfsnallkekelrsvekkqkevidryenansilqsfksispesnseaiwegrlerisksi
gi|294101553|ref|YP_003553411.1|  eklsltgvvlskldgdarggaalairattqvpikfagvgegidaielfdakrmaqriigmgdvm
gi|294101853|ref|YP_003553711.1|  aqmaratgihlllatqrpsvnvvtglikaniparvaftlpsqadsrtiidvsgaekllgkgdml
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  tasdsvrakrrhlqllergekvsfdevlrqiqnrdqfdsnreiaplcqasdaifvdtssmtede
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  vptvarerkgledlvkrvkdrfengvsl....................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  lklavsedvitvlakmaggdarqaltrlellassvaasgaaeltmah.................
gi|294101748|ref|YP_003553606.1|  ervgyrfyykmleeeiar..............................................
gi|294101649|ref|YP_003553507.1|  kcggelfqrdddketvirsrlkvyhdqtaplisyydekgllrkvnagtssssvmaeiealv...
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  lnasfestkkdeqkretkyeinkgdyenligaeftshlttannqpphvsqhkdfysyekkllar
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  tgditqidlpsgkksgliqvreilegikg...................................
gi|294101046|ref|YP_003552904.1|  vigryletitersftvyesqervtdlvyvpkkpaqlfsvhdalvfvfsqrgtmdlaytiartrr
gi|294101779|ref|YP_003553637.1|  drrgfmerlidnyyarndmlleagkfrargdvleiypsysetalrvaffddeierideidpvsg
gi|294101226|ref|YP_003553084.1|  valsgqginriiqripearkghippl......................................
gi|294101892|ref|YP_003553750.1|  sievpfivsaqdksgvgefrqfltqyl.....................................
gi|294102315|ref|YP_003554173.1|  dhdlflekvqnttstllsllniesdplsgrehlliskifeqswrngkdvdlpmiingiqtppfa
gi|294102188|ref|YP_003554046.1|  e...............................................................
gi|294102320|ref|YP_003554178.1|  gvnlhrsnvvvnydipwnptrmmqrvgrinrvdtpfdvihtfnffpttqsndqiklkeaaegki
gi|294102169|ref|YP_003554027.1|  kmdlapyvpfdmdlykndlqhlnprvecieiealngkgidrwvslvetwlke............
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  trlqgrskakvlpicalsgvgvtellqevey.................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ihsitaarekkleemipdschtvlfepsqienkaesy...........................
gi|294101141|ref|YP_003552999.1|  savvfdeihsfdqtlfsallgflrefnvpalcmtaslpinrldqlreaglkifpesiasfpdlk
gi|294101018|ref|YP_003552876.1|  illpsdivltferggaldlqdpmqdywesvrkwrekehitgvpqvgpqrddmiittkgqsvsiv
gi|294101692|ref|YP_003553550.1|  ekpydvddgplalalawieevrlfshslqwclavghfpewaywregdalvseptlcsdkvsegi
gi|294101032|ref|YP_003552890.1|  digepnpvplihavlkkadslpfpqivdgppgnacpmvaaveqsnfvilvteptpfglsdlala
gi|294101031|ref|YP_003552889.1|  kesrkealkegvpfividgppgiscpaisaltgatlavavtepslsglhdllrlsklcasldvp
gi|294101431|ref|YP_003553289.1|  ginldehnrtsttdnrllrrmirdyrtrghsaertldlwpsvikgareyifpyqssavamfnss
gi|294102167|ref|YP_003554025.1|  ekraeadlvirndssidtleqslsr.......................................
gi|294101458|ref|YP_003553316.1|  viadeahrsqygfgaeivmgkteadvkygyakymrdslpnasyigftgtpveltdkntrvvfgd
gi|294102320|ref|YP_003554178.1|  kdydkyietvkenareirnkvlkylmvrrtraeie.............................
gi|294101940|ref|YP_003553798.1|  veelvhseieiqkdgldkngqprliatitkarhgtkgsfeleyig...................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  vvldtsglsirglkdrliae............................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  qlsaidpkrasqlhvndvr.............................................
gi|294102787|ref|YP_003554645.1|  slsnqekalyriqggarssaeinvflkkiqetkeqikllqqqkdeylqkkeelektghqiesar
gi|294102032|ref|YP_003553890.1|  ieettesgdvskrelqqeefeslseekqkelqgkseeisqrtldtlrkirdlekalkeeigkle
gi|294102010|ref|YP_003553868.1|  isnshlmh........................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  hsmyvdkpmsghnlmqaiarvnrvfkekqgglvvdyi...........................
gi|294102625|ref|YP_003554483.1|  elslwamdhpefdesirrlqaalretehkveslgelqdrigpagqvrfsgseavsflhhwtsma
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  gipnlekhienmqgfgvpvvvainrfptdteaelklvhercaafgvpvalseiwakggeggiel
gi|294102529|ref|YP_003554387.1|  gipnlekhienmkrfgipvvvainrfptdteaelelvkehcvalgvqqvlsevwakggeggiel
gi|294102437|ref|YP_003554295.1|  cthyevngekhenyltntsllakaspvyttldgwkedisgcrdfeklpeaarryveyieketgv
gi|294102168|ref|YP_003554026.1|  fllrrligtkgnimvvgdpdqsiygwrgadmtmilnfekdfpaakvvvldqnyrstgnilkaan
gi|294101779|ref|YP_003553637.1|  tlkqlpkasifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtrydmeml
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  rdllienladfdesvmesylegqdvpeetlrrairentiqqrivpvlcgsafknkgiqllldav
gi|294101185|ref|YP_003553043.1|  camirteidslpaeldaasrkvmqleieeaalkkekdaaslerlsvlqkelqeareeadalraq
gi|294102626|ref|YP_003554484.1|  illdtsfrskeilvhevndlfssvwkdglgqelplpfeslevphylsthelrqqctvdpfltyl
gi|294101765|ref|YP_003553623.1|  mrtlvengmlkverglttyeeil.........................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  painwllsyslytdt.................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  eavdyiadagydpvfgarplkrfivkqletrmarslvagevregskvyvtvkdkalaf......
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  idmesvarealdkaqeegiifideidkvvargtssgpdvsregvqrdllpivegstvqtkygtv
gi|294102409|ref|YP_003554267.1|  grrysdglhqaieakekvrvgresqtlatitlqnyfrmyrklagmtgtavteseefkeiygldv
gi|294102354|ref|YP_003554212.1|  liesvveaddevmmmylegdeisheeivkvarkairerqifpvlpasgtanigvhqvldflgdm
gi|294101565|ref|YP_003553423.1|  qdidikvseeakafilekgynprygarplrrkiqqliedrmadmllegkikkgslvsidedk..
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  fpainwqqsytlyegs................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  leevrkekeaavtsqefekaarlrdterkiseeleekkkdwqsrryqekplvsfddiativsew
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  qsihgikkqkrklaeeikdilsrdiaknv...................................
gi|294101894|ref|YP_003553752.1|  pleeldddalarilvepknalirqyqktfeiegvklffeqdaikaiakearkkntgarglrsim
gi|294101778|ref|YP_003553636.1|  efeegidr........................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  vipyekllsmnvtmenfldalkevepsa....................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  fvhrsgrtgraghegrnllvlspkea......................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  pciekhhfeials...................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  rnvklseapshampiayyeptctgakaymnfsmevaerwl........................
gi|294101321|ref|YP_003553179.1|  tgrgt...........................................................
gi|294101626|ref|YP_003553484.1|  tgrgt...........................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ffvndpeivsqsfnkhienkiremdtfdgtplrlywr...........................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  frtahasliygkgv..................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  emivlnldetqteghvpgldaimsiakerglglvqvfgrmememadlsedeqrefmadlgikea
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  sanrgepltsgdtslasmafsniadrllgkev................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  gr..............................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  s...............................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  dkfalarkiltdkkntafyfvlnaeklpiietkraieilqkhdigiggvivnkvipeeagpffe
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  aelperiikrelnlgtdvrpflirmadnlrlsgrgisrvlkvartiadldnssrvrvphiseal
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  dehtkleqilarltggktgegiadsienlcleltqiispdtekgskyqelgnnalvflqklsqs
gi|294101553|ref|YP_003553411.1|  glaekvqqvtsqedvakitkslkkdkltmedlllqfeqieklgpldkvidml............
gi|294101853|ref|YP_003553711.1|  fvsprfpkpvrlqspyiedgksle........................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  vvdylvrlvke.....................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  lkdsrfnfmfhpgdykdassskdlhnllnewigsenklaildlsgvpfevldiaiglitrfvyd
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  rlpreqrsrlyelatildvpkvqmpllcgigiyhgsmlpkekllvesafrerildvvvgtnala
gi|294101779|ref|YP_003553637.1|  htlkqlpkasifpaqhyvtsrdaidkamgqiqqeldeqlhllkkqgklleaqrlemrtrydmem
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  qigvmptdtfyppserfklalalnqilaspafnqwmtgvpleigsflhspegkprasiftvshl
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  nafltllggdaellt.................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  ekasamryrvkqckkeealeealkaykngekvlwvvntvkrcqeiamelqesfaenllcyhsrf
gi|294101018|ref|YP_003552876.1|  msrgqrrrtavalmlaagwaverklrrkpllildeiaaelddrgrnilidalvesswqvfaata
gi|294101692|ref|YP_003553550.1|  lsqkaekiiaisatmtvegsfdfwkretgiiptdtyvlespfdlekqmkilvvdlglkviekgy
gi|294101032|ref|YP_003552890.1|  tetvrelhipagvvinrsdlgnieeaeifcknlalpilarlpfskevarayakgiapilidkqw
gi|294101031|ref|YP_003552889.1|  laivlnksdlseakgeeikneakkenwhflgsipfrpnvveaiskkeiplea............
gi|294101431|ref|YP_003553289.1|  lpyelavlrgyaqpllqtvpesssmhgearrllsmlkfvpplpsenvpsnsilrefigggc...
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  yidiydmtravedgttvkifyesriakldlpeemkp............................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  knleairydlslmewvekarspwvemteaqrkleeigevlffpdegllrfkkiheeegarerel
gi|294102032|ref|YP_003553890.1|  aeicrsaitpylqdvkekygtteilckwidalaediisnfnifvaaakdesteidfsrytinvf
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  tiwlppaikgalslfigtppvleknslwimpnitasiwpgkmsessllpdrhklalhdltgter
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  aerileavekpnsfhplydvaqspkekiekiakeiygakgvtytaqaekdleeihrlgkdnlvi
gi|294102529|ref|YP_003554387.1|  aervleavekpntfhklydaslspkekiekiakeiygaksvaymaqaekdleeihrlgkdnllv
gi|294102437|ref|YP_003554295.1|  pvqligvgpgrsqtilr...............................................
gi|294102168|ref|YP_003554026.1|  aviisnerrrkknlwtardmgekiyvllapneyqeadfilsemhrlhnfcgyrygdmavlyrin
gi|294101779|ref|YP_003553637.1|  aevgycsgienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdrarkttl
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  vdylps..........................................................
gi|294101185|ref|YP_003553043.1|  yesekeviskvrkmreeidavkreiekaereydlnkaaelkhgrlpelqqqlkkeegahaagqe
gi|294102626|ref|YP_003554484.1|  eggkegekirearlrqirrlallfsqyyeekrtvwdkqkeclrpvqwkdmailvpsrtswfpll
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  ktdhilfiaagafssvkpsdlvpelqgrfpirvelqplgreelarilvepenslikqyqallst
gi|294102409|ref|YP_003554267.1|  ivvptn..........................................................
gi|294102354|ref|YP_003554212.1|  fps.............................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  tnipvtqlteeetqrllrm.............................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  eylmldlmyeipsrsnevekiiitkevvek..................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  grerliqeaysllglisffttgkdevkawtlkkdata...........................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  krrvdqeqylkqidemfggfgvariplldsdikgieql..........................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ay..............................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  ltvllseqslsdlyaeqeeienklgtlrklkrlagvrtleeltnyckeaemnltwlnesyrrse
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................
gi|294101715|ref|YP_003553573.1|  ................................................................
gi|294101925|ref|YP_003553783.1|  smywgkyesytgknrplllayeeahtylnkndnnsysknaverifkegrkfgvgalvisqrpse
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101751|ref|YP_003553609.1|  ................................................................
gi|294101046|ref|YP_003552904.1|  lgvnlpaesvifaqlvqfhdnapiskneflqmagragrkglfdtgyvtwl..............
gi|294101779|ref|YP_003553637.1|  laevgycsgienysryldgrnpgeppgtlldffpddfimvideshitlpqvrgmyngdrarktt
gi|294101226|ref|YP_003553084.1|  ................................................................
gi|294101892|ref|YP_003553750.1|  ................................................................
gi|294102315|ref|YP_003554173.1|  sdnermffismvlneivgwmrtqtgtpslrailyidevfgymppvkeppskkplitllkqaraf
gi|294102188|ref|YP_003554046.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294102169|ref|YP_003554027.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102077|ref|YP_003553935.1|  ................................................................
gi|294102510|ref|YP_003554368.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101141|ref|YP_003552999.1|  rlkdrqkwhkkliekfrdpepmiaittqvcemsldlsasllisefapvtsliqrmgrcnrylei
gi|294101018|ref|YP_003552876.1|  ................................................................
gi|294101692|ref|YP_003553550.1|  dervcrvverlcndnggsslvllssmrlvkkvgnwlkgsqhpytvyvqnelprtellerfrsdl
gi|294101032|ref|YP_003552890.1|  qeaasdilnhvkevl.................................................
gi|294101031|ref|YP_003552889.1|  ................................................................
gi|294101431|ref|YP_003553289.1|  ................................................................
gi|294102167|ref|YP_003554025.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102320|ref|YP_003554178.1|  ................................................................
gi|294101940|ref|YP_003553798.1|  ................................................................
gi|294102120|ref|YP_003553978.1|  ................................................................
gi|294101791|ref|YP_003553649.1|  ................................................................
gi|294102136|ref|YP_003553994.1|  ................................................................
gi|294101830|ref|YP_003553688.1|  ................................................................
gi|294102042|ref|YP_003553900.1|  ................................................................
gi|294102015|ref|YP_003553873.1|  ................................................................
gi|294102787|ref|YP_003554645.1|  eelvfqcrnldkqlqafhipsiqkvleqkgairalaqnrnriekeeeiiqnlsldilsmkqrld
gi|294102032|ref|YP_003553890.1|  vandpengvpviwetnptyynltgkveyesrqgylytdfhkivsgafqkanggylvldaekvll
gi|294102010|ref|YP_003553868.1|  ................................................................
gi|294101586|ref|YP_003553444.1|  ................................................................
gi|294101458|ref|YP_003553316.1|  ................................................................
gi|294102625|ref|YP_003554483.1|  ghlpllkekrdqrealfrrlvacgedllilsspstdalgkplppspflg...............
gi|294102478|ref|YP_003554336.1|  ................................................................
gi|294101874|ref|YP_003553732.1|  ................................................................
gi|294102071|ref|YP_003553929.1|  ................................................................


                                                                                                    
                                                                                                    
d3dhwc1                             ................................................................
gi|294102520|ref|YP_003554378.1|  cmaktqasisdnpaligrpegfeltvrevrlsagagfiiaitgsimtmpglpkvpaamkidvdn
gi|294102529|ref|YP_003554387.1|  cmgktqasisdnpaligrpegfeltvrevrlsagagfivpitgsimtmpglpkvpaamkidvdd
gi|294102437|ref|YP_003554295.1|  ................................................................
gi|294102168|ref|YP_003554026.1|  amsriyeqkciekgvpyrvvrgtafydrkeikdvlsfmrlavnpldgaslgrianvptrgigkk
gi|294101779|ref|YP_003553637.1|  vengfrlpscldnrplnwrefkkylrqvifisatpgdwerevstcvaeqiirp...........
gi|294102457|ref|YP_003554315.1|  ................................................................
gi|294101625|ref|YP_003553483.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  gdqllreevtedeiaeivsrwtg.........................................
gi|294102626|ref|YP_003554484.1|  ekiffeefqlpiyfegstsyfsrseiqdliallnflddpgkelylmsflssplsslsleevrdl
gi|294101765|ref|YP_003553623.1|  ................................................................
gi|294102479|ref|YP_003554337.1|  ................................................................
gi|294101904|ref|YP_003553762.1|  ................................................................
gi|294102557|ref|YP_003554415.1|  ................................................................
gi|294101807|ref|YP_003553665.1|  ................................................................
gi|294101806|ref|YP_003553664.1|  ................................................................
gi|294102649|ref|YP_003554507.1|  ................................................................
gi|294101185|ref|YP_003553043.1|  ................................................................
gi|294102868|ref|YP_003554726.1|  ................................................................
gi|294102500|ref|YP_003554358.1|  erievrfsedaieeiaamaekmnaemenigarrlhtmveqlleeisftaperqgevvdinaqfv
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102354|ref|YP_003554212.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101424|ref|YP_003553282.1|  ................................................................
gi|294101976|ref|YP_003553834.1|  ................................................................
gi|294101061|ref|YP_003552919.1|  ................................................................
gi|294101048|ref|YP_003552906.1|  ................................................................
gi|294101977|ref|YP_003553835.1|  ................................................................
gi|294101084|ref|YP_003552942.1|  ................................................................
gi|294101565|ref|YP_003553423.1|  ................................................................
gi|294101786|ref|YP_003553644.1|  ................................................................
gi|294101493|ref|YP_003553351.1|  ................................................................
gi|294101884|ref|YP_003553742.1|  ................................................................
gi|294101894|ref|YP_003553752.1|  ................................................................
gi|294101778|ref|YP_003553636.1|  ................................................................
gi|294102313|ref|YP_003554171.1|  ................................................................
gi|294102640|ref|YP_003554498.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102641|ref|YP_003554499.1|  ................................................................
gi|294101359|ref|YP_003553217.1|  ................................................................
gi|294102459|ref|YP_003554317.1|  ................................................................
gi|294101785|ref|YP_003553643.1|  ................................................................
gi|294101376|ref|YP_003553234.1|  ................................................................
gi|294102074|ref|YP_003553932.1|  ................................................................
gi|294102442|ref|YP_003554300.1|  ................................................................
gi|294101577|ref|YP_003553435.1|  ................................................................
gi|294101171|ref|YP_003553029.1|  ................................................................
gi|294102413|ref|YP_003554271.1|  ................................................................
gi|294102187|ref|YP_003554045.1|  ................................................................
gi|294102332|ref|YP_003554190.1|  ................................................................
gi|294102831|ref|YP_003554689.1|  ................................................................
gi|294101321|ref|YP_003553179.1|  ................................................................
gi|294101626|ref|YP_003553484.1|  ................................................................
gi|294101069|ref|YP_003552927.1|  ................................................................
gi|294102759|ref|YP_003554617.1|  ................................................................
gi|294101055|ref|YP_003552913.1|  ................................................................
gi|294101254|ref|YP_003553112.1|  ................................................................
gi|294102760|ref|YP_003554618.1|  ................................................................
gi|294101659|ref|YP_003553517.1|  ................................................................
gi|294101172|ref|YP_003553030.1|  ................................................................
gi|294102017|ref|YP_003553875.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294102409|ref|YP_003554267.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101403|ref|YP_003553261.1|  ................................................................
gi|294101730|ref|YP_003553588.1|  ................................................................
gi|294102602|ref|YP_003554460.1|  ................................................................
gi|294102663|ref|YP_003554521.1|  ................................................................
gi|294101436|ref|YP_003553294.1|  ................................................................
gi|294102150|ref|YP_003554008.1|  ................................................................
gi|294101607|ref|YP_003553465.1|  ................................................................
gi|294102035|ref|YP_003553893.1|  ................................................................
gi|294102412|ref|YP_003554270.1|  ................................................................
gi|294101660|ref|YP_003553518.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294102841|ref|YP_003554699.1|  ................................................................
gi|294101272|ref|YP_003553130.1|  ................................................................
gi|294101433|ref|YP_003553291.1|  ................................................................
gi|294101963|ref|YP_003553821.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294102542|ref|YP_003554400.1|  ................................................................
gi|294101861|ref|YP_003553719.1|  ................................................................
gi|294102400|ref|YP_003554258.1|  ................................................................
gi|294102043|ref|YP_003553901.1|  ................................................................
gi|294101077|ref|YP_003552935.1|  ................................................................
gi|294102348|ref|YP_003554206.1|  ................................................................
gi|294102040|ref|YP_003553898.1|  ................................................................
gi|294101613|ref|YP_003553471.1|  ................................................................
gi|294101367|ref|YP_003553225.1|  ................................................................
gi|294101893|ref|YP_003553751.1|  ................................................................
gi|294101841|ref|YP_003553699.1|  ................................................................
gi|294102070|ref|YP_003553928.1|  ................................................................
gi|294102221|ref|YP_003554079.1|  ................................................................
gi|294101356|ref|YP_003553214.1|  ................................................................
gi|294101345|ref|YP_003553203.1|  ................................................................
gi|294102145|ref|YP_003554003.1|  ................................................................
gi|294101756|ref|YP_003553614.1|  ................................................................
gi|294102549|ref|YP_003554407.1|  ................................................................
gi|294101372|ref|YP_003553230.1|  ................................................................
gi|294101016|ref|YP_003552874.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294101686|ref|YP_003553544.1|  ................................................................
gi|294102507|ref|YP_003554365.1|  ................................................................
gi|294101471|ref|YP_003553329.1|  ................................................................
gi|294101845|ref|YP_003553703.1|  qsgaeakklrreasrlalelrkkrertarsleeavnhslrdmameditfsitlsdlgkikstga
gi|294101553|ref|YP_003553411.1|  ................................................................
gi|294101853|ref|YP_003553711.1|  ................................................................
gi|294101780|ref|YP_003553638.1|  ................................................................
gi|294102079|ref|YP_003553937.1|  ................................................................
gi|294101472|ref|YP_003553330.1|  ................................................................
gi|294102235|ref|YP_003554093.1|  ................................................................
gi|294102390|ref|YP_003554248.1|  ................................................................
gi|294101443|ref|YP_003553301.1|  ................................................................
gi|294101748|ref|YP_003553606.1|  ................................................................
gi|294101649|ref|YP_003553507.1|  ................................................................