SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

P-loop containing nucleoside triphosphate hydrolases alignments in Geobacillus kaustophilus HTA426

These alignments are sequences aligned to the 0036748 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  mnflsekllahlnkeqqeavkttegpllimagagsgktrvlthriaylmaekqvapwnilaitftnka
gi|56422010|ref|YP_149328.1|  mssvvvvgtqwgdegkgkitdflsenaeviaryqggnnaghtivfngekyklhlipsgifykdkicvi
gi|56421621|ref|YP_148939.1|  fqlvapyepqgdqpqaiaklvdglrrgvkhqtllga................................
gi|56421924|ref|YP_149242.1|  mtkyifvtggvvsslgkgitaaslgrllknrglnvtiqkfdpyinvdpgtmspyqhgevfvtddgaet
gi|56419217|ref|YP_146535.1|  kpagsrwtdeqwkaiaaggrdilvaaaagsgktavlveriiqkvtaeegavdidrllvvtftnaaaae
gi|56418638|ref|YP_145956.1|  slektrnigimahid.....................................................
gi|56421164|ref|YP_148482.1|  edgrtaeddspivrlvnqilqlaveqrasdihidpqetkvliryridgllrteralpkhmqsmltari
gi|56419334|ref|YP_146652.1|  tyealtkygrdlvaeakagkidpvigrdseir....................................
gi|56421895|ref|YP_149213.1|  mevpvgealigrvvnplgqpvdglgpvettetrpiespapgvmdrrsvheplqtgikaidalvp....
gi|56419757|ref|YP_147075.1|  evhvgdaligmvldplgqpldgsplppglkpvsverdppnplvrppiveplevgirvidsl.......
gi|56421893|ref|YP_149211.1|  svpvgevtlgrvfnvlgepidlegdipadarrdpihrpapkfeelateveiletgikvvdllap....
gi|56420166|ref|YP_147484.1|  aaldrld.............................................................
gi|56420904|ref|YP_148222.1|  rsveeyvqgvlagdrtilaqaitlvesnasrhmdla................................
gi|56418583|ref|YP_145901.1|  rtiieglhvrlkeqlvaglsgsarsv..........................................
gi|56419749|ref|YP_147067.1|  tltprqivekldqfivgqkeakkavaialrnryrrslldeklrdevm.....................
gi|56419871|ref|YP_147189.1|  nrs.................................................................
gi|56422018|ref|YP_149336.1|  lta.................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  v...................................................................
gi|56418613|ref|YP_145931.1|  ipvsklaeteterllkleeilhsrvvgqdeavkavakavrraraglkdpkrpigs.............
gi|56419870|ref|YP_147188.1|  lhiapqgdieydvrqf....................................................
gi|56419166|ref|YP_146484.1|  li..................................................................
gi|56419258|ref|YP_146576.1|  i...................................................................
gi|56421642|ref|YP_148960.1|  kkvfdpnkrqlarlekiadqvdalgpemarlsdeqlrqkteefkaryqqgeslddllveafavvrega
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ipltrlvegerekllrlhellhrrvigqdeavelvadailraragmkdpnrpigs.............
gi|56420165|ref|YP_147483.1|  piv.................................................................
gi|56421187|ref|YP_148505.1|  kdvpkpleireildeyvigqdeakkslavavynhykrinsgski........................
gi|56419918|ref|YP_147236.1|  safnkgqyelehaysrghyivkagagtgktttminrimflkhmqgdldlrsvvmitftneaasnmrsk
gi|56418613|ref|YP_145931.1|  tptldslardltaiaregrldpvigrsk........................................
gi|56421705|ref|YP_149023.1|  qlfdesarevqrlaklaaqineweptisslsdeqlrqktvvfkerlergetlddikieafavvreaar
gi|56418761|ref|YP_146079.1|  vqalvvaptrelaiqvseelykigavkrvrvlpiyggqdierqiralkkhphvivgtpgriidhinrg
gi|56418597|ref|YP_145915.1|  ytddkrkvrfrdvagadeekeelveiveflkdprkfaelga...........................
gi|56419350|ref|YP_146668.1|  llevknlkqyfpagrgql..................................................
gi|56419349|ref|YP_146667.1|  ilqvnd..............................................................
gi|56420488|ref|YP_147806.1|  iigrhpaiaavkqmirraarv...............................................
gi|56422025|ref|YP_149343.1|  mgkviaianqkggvgktttavnlsaclahlgkkvllvdadpqgnatsgigiergdvdeciynviigdm
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  dmigqhpcfiekmnearla.................................................
gi|56420756|ref|YP_148074.1|  fgepypisgahgtglgdlldavvrhfpkgggqeyeedvikf...........................
gi|56420970|ref|YP_148288.1|  eieqtanrllaeavqrrasdlhlvprrrdaavrlrldgmlvdvgvlsketaerliahfkflagmdige
gi|56421163|ref|YP_148481.1|  kleallraafeyrasdvhltvgappifrvngelkaygqerlnpedteqmakaiippplwqqfqetgel
gi|56419702|ref|YP_147020.1|  nergl...............................................................
gi|56419503|ref|YP_146821.1|  gfldqfgrnltqmakaglidpvigrdkeiarvmeilnrrn............................
gi|56420918|ref|YP_148236.1|  divgeseemkvaieqaklaaktpatillrgesgtgkelfahaihnasdrkynkfirvncaaipetlle
gi|56420877|ref|YP_148195.1|  i...................................................................
gi|56419264|ref|YP_146582.1|  ivgtnkemndllklaykiakknvnvliegetgtgkevlahfihnasmrydqpfigvncgavsetlles
gi|56418731|ref|YP_146049.1|  liyrapamahvvniarqaaavdvtl...........................................
gi|56421917|ref|YP_149235.1|  dlrngdkvsgkvrppkeneryfgllhveavngedpevakervhfpaltplypnrqmklettpdklstr
gi|56418838|ref|YP_146156.1|  en..................................................................
gi|56419503|ref|YP_146821.1|  ipvgklqadekekmkhleenlakkvigqaeavkkvakairrsraglkakhrpigs.............
gi|56418670|ref|YP_145988.1|  p...................................................................
gi|56421797|ref|YP_149115.1|  tdeavalnlpdkleqkeycpltaeqaalyeqlvndtlerakeaspfarrglilqmlngvkqicdhpal
gi|56421512|ref|YP_148830.1|  p...................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  l...................................................................
gi|56421558|ref|YP_148876.1|  l...................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  mlae................................................................
gi|56421010|ref|YP_148328.1|  vqavitaptrelatqiyhetlkitkfcpkdrmivarcliggtdkqkaleklnvqphivigtpgrindf
gi|56419920|ref|YP_147238.1|  itlspeqisvvqqdedqmlingsagtgksltliykllkvmeqenepkrilycsfntmlvedarkrieq
gi|56418639|ref|YP_145957.1|  fertkphvnigtighvdh..................................................
gi|56418583|ref|YP_145901.1|  yvpvdqidqvqkyvgsegkepkiyklggsewkkvkrkvessvqdiaedliklyaereaskgyafspdt
gi|56419445|ref|YP_146763.1|  spahqe..............................................................
gi|56421511|ref|YP_148829.1|  l...................................................................
gi|56419731|ref|YP_147049.1|  dvnfkvvkdfirqvseravgqevmksltpgqqvikivkeeltalmggeqsqiavak............
gi|56419721|ref|YP_147039.1|  dplppalrrayrlvdkqealralhfprtreelhqarrrliyeefllyqlkmqalrrlmrderrgvvhs
gi|56421391|ref|YP_148709.1|  lsidrlshtyltkt......................................................
gi|56419996|ref|YP_147314.1|  l...................................................................
gi|56421148|ref|YP_148466.1|  eaivit..............................................................
gi|56418847|ref|YP_146165.1|  y...................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ly..................................................................
gi|56420178|ref|YP_147496.1|  qvt.................................................................
gi|56419819|ref|YP_147137.1|  y...................................................................
gi|56419216|ref|YP_146534.1|  eaqfhrrpllpygaktdavhlyeasnrraeieavareiirlvrdegaryrdialiirqteayrdlvkt
gi|56420469|ref|YP_147787.1|  p...................................................................
gi|56419007|ref|YP_146325.1|  rrytlv..............................................................
gi|56421926|ref|YP_149244.1|  tvvtdelerlpsgdvqaiarlitlceyraegenkeaaaaaeaaieqvkalekrvp.............
gi|56418552|ref|YP_145870.1|  allqhki.............................................................
gi|56421006|ref|YP_148324.1|  lv..................................................................
gi|56419712|ref|YP_147030.1|  nelvrppianveqailvfsavspdfsaklldrflvlveskritpiiviskidlldgeskeeiaryvhd
gi|56421096|ref|YP_148414.1|  erlgmqyapqqreaiqqalss...............................................
gi|56421557|ref|YP_148875.1|  l...................................................................
gi|56420989|ref|YP_148307.1|  vkk.................................................................
gi|56421797|ref|YP_149115.1|  reeaadesipihidvhdqfrafirqlqqldglpkanvppsfhgtlrpyqqrgvdwlvflrrfgfgacl
gi|56419179|ref|YP_146497.1|  l...................................................................
gi|56420468|ref|YP_147786.1|  c...................................................................
gi|56421763|ref|YP_149081.1|  id..................................................................
gi|56418671|ref|YP_145989.1|  fekvehv.............................................................
gi|56419272|ref|YP_146590.1|  i...................................................................
gi|56421043|ref|YP_148361.1|  rlkrqerirnfsiiahidhgkstladrilektgalserelreqtldtme...................
gi|56420022|ref|YP_147340.1|  ie..................................................................
gi|56420415|ref|YP_147733.1|  y...................................................................
gi|56420326|ref|YP_147644.1|  rrsgrvivytgdgkgkttaalglalravgrgmnvavlqflkspertygeqlalerlgvdvrqlgagft
gi|56419193|ref|YP_146511.1|  l...................................................................
gi|56418559|ref|YP_145877.1|  mngcffs.............................................................
gi|56422011|ref|YP_149329.1|  itgiptgfteldrmtsgfqrsdliivaarpsvgktafalniaqnvatktnenvaifslemsaqqlvmr
gi|56419728|ref|YP_147046.1|  mflkrldvigfksfa.....................................................
gi|56421642|ref|YP_148960.1|  rpviredrpdliyrtmegkfravvediaarhakgqpvlvgtvaietsemlsemlkkrgiphnvlnakn
gi|56420899|ref|YP_148217.1|  v...................................................................
gi|56419677|ref|YP_146995.1|  v...................................................................
gi|56421126|ref|YP_148444.1|  lrpqylheyigqdkikenlkvfieaaklreetl...................................
gi|56421185|ref|YP_148503.1|  dikraeailneehygldkvkervlef..........................................
gi|56420429|ref|YP_147747.1|  y...................................................................
gi|56420896|ref|YP_148214.1|  i...................................................................
gi|56420444|ref|YP_147762.1|  f...................................................................
gi|56420563|ref|YP_147881.1|  m...................................................................
gi|56421620|ref|YP_148938.1|  vgar................................................................
gi|56420212|ref|YP_147530.1|  v...................................................................
gi|56419206|ref|YP_146524.1|  lelkritkvfneg.......................................................
gi|56420341|ref|YP_147659.1|  ll..................................................................
gi|56419798|ref|YP_147116.1|  dapedlver...........................................................
gi|56420778|ref|YP_148096.1|  gsvlivsplvslmedqveqlrrrgekrviafhslldaeekwqalaslaefrfiyaspemlqsakflta
gi|56419605|ref|YP_146923.1|  dlrniaiiahvdh.......................................................
gi|56419482|ref|YP_146800.1|  l...................................................................
gi|56420961|ref|YP_148279.1|  sydmiiideahklknnktknyefvqnlkkkfcllltatpiqnrieeifnlvsllkpghlgsseqfakt
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  imfqgthsdagksviatafcrmfaqdgwktapfksqnmslnsyvtpdgneigraqgiqaeaagvaara
gi|56421141|ref|YP_148459.1|  d...................................................................
gi|56419729|ref|YP_147047.1|  t...................................................................
gi|56418720|ref|YP_146038.1|  diigq...............................................................
gi|56420762|ref|YP_148080.1|  s...................................................................
gi|56418614|ref|YP_145932.1|  prmktnsaeldrvlgggiv.................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  kkpv................................................................
gi|56419816|ref|YP_147134.1|  dirieapipgksaigievpneeiatvslrevleaiehtrdkaklliplgrdisgevvaaelnkmp...
gi|56420429|ref|YP_147747.1|  svqgltkkgk..........................................................
gi|56421186|ref|YP_148504.1|  lteplaekvrpksfddivgqed..............................................
gi|56418583|ref|YP_145901.1|  ppenrfpvqtyvmeytpelvkeaierelardgqvfflynhiedidlkaeeiaqlvpearvtyvhgrms
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  iaidrlrlkfpgs.......................................................
gi|56419739|ref|YP_147057.1|  hmakakrevqeklklidvafelldarvpmssrnpmideilgqkprlillnkadmadeavteqwiryfh
gi|56419819|ref|YP_147137.1|  grevqfttak..........................................................
gi|56421620|ref|YP_148938.1|  ara.................................................................
gi|56418775|ref|YP_146093.1|  l...................................................................
gi|56418536|ref|YP_145854.1|  lnpkytfdtfvigsgnrfahaaslavaeapakaynp................................
gi|56418775|ref|YP_146093.1|  fsfsidrpsgy.........................................................
gi|56422029|ref|YP_149347.1|  ftredvveinchggfvsvnrvlqlvlangarlaepgeftkraflngridlsqaeavidliraktdram
gi|56421705|ref|YP_149023.1|  psrrtdwddlvyqtyeakvrkiidevkkmnaigrpvligttsvaqseqlsaafskagiphhllnakte
gi|56421351|ref|YP_148669.1|  dirieapipgkrtigievpnrtsrpvrlreileseafrkspspltvalgldisgapvvtdirkmphg.
gi|56421763|ref|YP_149081.1|  geerlrverlt.........................................................
gi|56421102|ref|YP_148420.1|  ktteplawrmrprtideivgqqhiigpstplykmvkkghvps..........................
gi|56420331|ref|YP_147649.1|  mrrlviaapg..........................................................
gi|56418678|ref|YP_145996.1|  kysenkqkttyiaias....................................................
gi|56420415|ref|YP_147733.1|  lnelypye............................................................
gi|56420756|ref|YP_148074.1|  p...................................................................
gi|56421228|ref|YP_148546.1|  k...................................................................
gi|56419775|ref|YP_147093.1|  prtiavtsgkggvgksnlslnfslslsklgfrvllldmdigmgnidillgqsspltlsdwfsarlpls
gi|56421552|ref|YP_148870.1|  mgqaifmtgtgteigktvvtsivalalerlgmsvsvlkpvqtglaedgvsfaeqywyervaklsaseg
gi|56420444|ref|YP_147762.1|  nrypsrtpkigei.......................................................
gi|56418786|ref|YP_146104.1|  eqvvrnieqvivgkrnvivlsltallakghvlledvpgvgktmlvralaksfsaelkriqftpdllps
gi|56418662|ref|YP_145980.1|  mnl.................................................................
gi|56421262|ref|YP_148580.1|  mtlt................................................................
gi|56420961|ref|YP_148279.1|  eeflarvekdgpwaswemyelaleaahhlsvpefnglqapkhlphltil...................
gi|56418539|ref|YP_145857.1|  mfltnltltnyrnye.....................................................
gi|56419950|ref|YP_147268.1|  sgltksqrqaflqflr....................................................
gi|56420072|ref|YP_147390.1|  dpnvvhwheiepkeanfvpfpdeldprlgaalkargiaslythqaaaydavqsgrnivavtptasgkt
gi|56419155|ref|YP_146473.1|  t...................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  slivtstgpg..........................................................
gi|56419849|ref|YP_147167.1|  rniqkeldqligldhvkkiikeiyawlyinrlrkenglkanrqalh......................
gi|56419705|ref|YP_147023.1|  pseppaltqaqeaalakiaasv..............................................
gi|56421915|ref|YP_149233.1|  gwlelicgcmfsgkseelirrvrraqfakqevkvfkptidnrysedavvshngnsviaipvatpaemf
gi|56418560|ref|YP_145878.1|  qpvvakmlqsglekgrishaylfegqrgtgkkaaslllakrlfclspigvspclecrncrridsgnhp
gi|56419721|ref|YP_147039.1|  pagrkkvetywvkhhqfsrvldfiekelrrghqayvicplieesdkldvqnaidvhsqlvhyyrgkye
gi|56420639|ref|YP_147957.1|  rvlfiahreeilrqakqsfervipdrtaglydgnqkegnadmvfasiftlsmkk..............
gi|56420018|ref|YP_147336.1|  yt..................................................................
gi|56418949|ref|YP_146267.1|  ghhs................................................................
gi|56410473|ref|YP_145847.1|  maititmgiqkg........................................................
gi|56421823|ref|YP_149141.1|  hhrdfqsii...........................................................
gi|56419482|ref|YP_146800.1|  v...................................................................
gi|56421184|ref|YP_148502.1|  mnvkkaelvtsavkpeqypdggrpe...........................................
gi|56419257|ref|YP_146575.1|  pl..................................................................
gi|56421028|ref|YP_148346.1|  pirvktlgqryyvaaieqydltfg............................................
gi|56418714|ref|YP_146032.1|  ktagrl..............................................................
gi|56419859|ref|YP_147177.1|  fq..................................................................
gi|56420462|ref|YP_147780.1|  pvr.................................................................
gi|56421621|ref|YP_148939.1|  tllgatgtgktftisnviaqv...............................................
gi|56420269|ref|YP_147587.1|  gykaa...............................................................
gi|56419774|ref|YP_147092.1|  taeq................................................................
gi|56420796|ref|YP_148114.1|  mvfvsgaarsgkseaaeicairlsrggrlhyiataqamdeemterirrhqerraaqaahwtvweapfs
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  rmkchycgheeplvprcpscgsehirffgtgtqkveeeltrllpkarvirmdvdttgrkgaheellsr
gi|56421682|ref|YP_149000.1|  kqavldrsellvwavcgagkteilfpaiaaalekgwrvglatprtdvvrelaprfrqafprvplavwh
gi|56420072|ref|YP_147390.1|  grnivavtptasgktlcynlpvldaiakepssralyifptkalaqdqknelneiiaemgvsiyshtyd
gi|56418881|ref|YP_146199.1|  ngfetymwddlnyparrvsgfynkeelsllidrrtmkkplknvqindnianryyqkeavlavcdalen
gi|56420088|ref|YP_147406.1|  qehadkvkqliekaasgel.................................................
gi|56421060|ref|YP_148378.1|  nmlhrigeskalvvnivdifdfngswipglprfaaenpillvgnkadllprsvkypkllrwmrrmaee
gi|56420924|ref|YP_148242.1|  el..................................................................
gi|56420088|ref|YP_147406.1|  gplrdkarrlrersf.....................................................
gi|56421048|ref|YP_148366.1|  rrfsllyllygnepflltetyerlvnaalgpeerewnlavydceetpveaaleeaetvpffgerrvil
gi|56419610|ref|YP_146928.1|  afednevvipavvleevdskkrymdeigrnarqvsklidrlrengklhekiplenggalrielnhrsf
gi|56419219|ref|YP_146537.1|  idftalc.............................................................
gi|56418583|ref|YP_145901.1|  nvvnitckqmqnfhgqmallqseverwtkanyavvflapnaervkkl.....................
gi|56419416|ref|YP_146734.1|  qealraleyvkrt.......................................................
gi|56419316|ref|YP_146634.1|  qealraleyvkrt.......................................................
gi|56420452|ref|YP_147770.1|  qealraleyvkrt.......................................................
gi|56418692|ref|YP_146010.1|  qealaaldyvk.........................................................
gi|56418885|ref|YP_146203.1|  qealaaldyvk.........................................................
gi|56420238|ref|YP_147556.1|  qealaaldyvk.........................................................
gi|56419917|ref|YP_147235.1|  nrantmrtlieglfpkdrllnyirnfivfleegskitkigakyhqffgvnfavneairatrpdgdrki
gi|56420711|ref|YP_148029.1|  alstsqhalieagtglgkslaylipaaffaceq...................................
gi|56419088|ref|YP_146406.1|  kphleglalpiicgmdrygkyiaydaiqe.......................................
gi|56419319|ref|YP_146637.1|  rfler...............................................................
gi|56418771|ref|YP_146089.1|  arrlaeh.............................................................
gi|56419830|ref|YP_147148.1|  aaleqalkqierqfgkgaimklgeqvdrkvsvvpsgslaldialgvgg....................
gi|56420943|ref|YP_148261.1|  rvsrplevivdgtarllpyevtkedgvhllnklshysiyaveeelkrgfmtiegghrvglagkviteg
gi|56420079|ref|YP_147397.1|  rafrekkvifaeagvgtgktivyllyavcyarytgkpaiiacadetlieqlvkkegdiaklsnvlgle
gi|56419847|ref|YP_147165.1|  a...................................................................
gi|56420591|ref|YP_147909.1|  r...................................................................
gi|56421256|ref|YP_148574.1|  lraslsdvdlnddgrikairfaerfvaeyepgkkmkgl..............................
gi|56421803|ref|YP_149121.1|  ririehfgpvklfd......................................................
gi|56419913|ref|YP_147231.1|  dyersvaayiaysfddlpsneqlardletmigyyrqyvertepmappeqalsyreavehihsyisakg
gi|56419308|ref|YP_146626.1|  n...................................................................
gi|56418881|ref|YP_146199.1|  ftvghfdliiideshrsiykkyraifdyfdaillgltatpkdeidrntyevfdlengvptyayeldqa
gi|56420752|ref|YP_148070.1|  y...................................................................
gi|56419021|ref|YP_146339.1|  hlfgleealerlve......................................................
gi|56419420|ref|YP_146738.1|  dl..................................................................
gi|56421601|ref|YP_148919.1|  l...................................................................
gi|56418742|ref|YP_146060.1|  kk..................................................................
gi|56420793|ref|YP_148111.1|  pdewesyfrawqrweaaapnrtvvwigtdvtqgvv.................................
gi|56418854|ref|YP_146172.1|  yydeqy..............................................................
gi|56419917|ref|YP_147235.1|  vviadeahrtqagfaggfaaqlryalpnasyigftgtpvdfvdnnteeifghiihrydmaqavedkat
gi|56419847|ref|YP_147165.1|  v...................................................................
gi|56419216|ref|YP_146534.1|  f...................................................................
gi|56419674|ref|YP_146992.1|  a...................................................................
gi|56421780|ref|YP_149098.1|  iyigaapgvgktfhmlrdahdvrekgidivigivethgraeteaeikdleiipr..............


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  aremkervqallggaaedvwistfhsmcvrmlrrdidriginrnfsildptdqlsvikailkdknidp
gi|56422010|ref|YP_149328.1|  gngmvvdpkalvaelsylhergistdnlrisnrahvilpyhlkldeleeerkgankigttkkgigpay
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  dldlghyerfidinlnkysnvttgkiysavirkerrgdylggtvqviphitnei..............
gi|56419217|ref|YP_146535.1|  mkarigealerelakrphslhlrrqlsllpraaistlhsfcldvirkyyylldldpsfriadeteiel
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  kilanmditehrvpqdgrikmnidfhpvdlrvstlptvygekivmrvldlgaalndihklgfnpvnld
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  krvlglypykvqimggvvlhegdiaemktgegktltatmpvylnaltgrgvhvvtvneylatrdatem
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  llekiknyydltkdkkylewmeeagrmfigtihsfareflvtegqtlgfsrsmevrsykherrrliek
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  rvlglrhydvqlmgglamhegniaemqtgegktlaatlpsylhallgkgvhiitaneylarrdceqmg
gi|56418761|ref|YP_146079.1|  tlrlehvh............................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  kakdvirptdienlyvipatiqlagaeielvsvisreirlrnaieplkdkydfiiidcppslgl....
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  rrrpqsgamevaefgetvylrlstlptlydeslvirllpqrfslplrelslffrstarlfsfmq....
gi|56421163|ref|YP_148481.1|  dfsygiagvsrfrinvfkqrscvslavrlippriptleelglpsvlkriae.................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  selfgyeegafsgarrggkrglfee...........................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  elfghekgaftgavkekkgifei.............................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  iidlia..............................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ylkerrprqlvershkleklielieqirandescliftqyvrmgemiqellsdlfderv.........
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ireqaldvhtahilvvdeadlmldmgfitdvdqiaarmpkdlqmlvfsatipeklkpflkkymenptf
gi|56419920|ref|YP_147238.1|  sskfheikdkhtlhmetfhymaarilreigfpnaeflr..............................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  emqrefeaafpyqetedqlrsieeikrdmesdkpmdrllcgdvgygktevalraafkaimdgkqvafl
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  fseerlssflsglpfvltnaqrrvigeiladmrsprqmn.............................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  vffdfgipyfmdekepmhhhplielvraaletvvtrwryeavfravktdllfptdgdlhmwreaa...
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  yrrigydvietsavtkgg..................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  addmglgktvqllaylahvkeierpdtpallicptsvignwqkecarftpdlrvyvhhgpnrakndaf
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  wtktpdihrealkrawav..................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  mlcaegninaqnlrtgkltpedwgkltmamgslsnagiyi............................
gi|56419728|ref|YP_147046.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  hakeaeiiaqagqkgavtiatnm.............................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  lrrvcislfvvdeahcisqwgydfrpdflklgeirralgappclaltatappevq.............
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ygktravqtndhlkalvnkvmirnrradtpiewakrhvepvlieftneerelyeavkalrresfagsf
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  emnpilikpsrehesqivvlgkpygnmqafayrneffhqglav.........................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  etelestilaflegqy....................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  dqgrlalpidaqsgtgvrqiaaaakemvkdkfekmrakgiknprpvr.....................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  nvalqqmegrlsklirelrqtiletlahvevnidypeyddveemtprllrekaeyvrgqiekllstaa
gi|56421705|ref|YP_149023.1|  eeeariiat...........................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  elvksgpehl..........................................................
gi|56421552|ref|YP_148870.1|  myymepamsphlaakltgtsieper...........................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  dvigvsvynpkeqqfeykpgpivah...........................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  lcynlpvldaiakepssralyifptkalaqdqknelneiiaemgvsiyshtydgdtapalrqkirqag
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ry..................................................................
gi|56418560|ref|YP_145878.1|  dvrvispdggsikkeqiewlqqefsktavesdkkmyivehadqmttsaa...................
gi|56419721|ref|YP_147039.1|  iglmhgrlsadekervmrafsenrihvlv.......................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  sqe.................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  faakeadillgtqmiakgldfpnvtlvgvlaadtmlhlpd............................
gi|56421682|ref|YP_149000.1|  ggseergriaslvlstthqllrayrvfdvmivdevdafpysaepmleyav..................
gi|56420072|ref|YP_147390.1|  gdtapalrqkirqaghivitnpdmlhtailphhtkwislfeqlry.......................
gi|56418881|ref|YP_146199.1|  krrkallvmatgsgktrtaisivdvltrhnwvknilfladrktlvtqaknsfshllpnltlcnlldnk
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  lglrpvdvclvsaakgigmakvm.............................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ikhpyfftsekekeiehdl.................................................
gi|56419610|ref|YP_146928.1|  hqlqeifvektndnrilavaknlsleeqakedgrsvilvskdalvrvkadaiglqaedflsdrvvdvd
gi|56419219|ref|YP_146537.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  gvmyhtt.............................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  gkvkairdvssfniriakeqigiaep..........................................
gi|56420079|ref|YP_147397.1|  idvrlakspdqylclnkleevttyddddielyeqiydelpafvhdnkplqsfyrygdrkeyahltdeq
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  fy..................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  vqd.................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  ....................................................................
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  lpiyyesrlipldlsagdidekykkiieeaggddeesetykrkwaalekvvgtpkrlrrlakd.....
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  kkfeprtilatisgakndlltpeqfakrastyyekivgdvyqeyqqrllrnhsldf............
gi|56422010|ref|YP_149328.1|  mdkaarigirivdlldrdvfaeklernlrekntllekvygvegfrledifeeyyeygqhiakyvcdts
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  lkedvleelleeeygkpdnerffavvdaytgdrsdaelqemivalyefsrshpepdewlagltsmydv
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  rfirli..............................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  gklyeflgmtvglnlsgmsreekqaaynaditygtnnefgfdylrdnmvlykehivqrplyyaiidev
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  yidqfsvecpevyerfrhiphyqiirsfivmieqlhnkslsveaigqldfgtdscgfhefadyvmkrv
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  rvfrflgltvglnvsqmtasekkeayaaditygtgtefgfdylrdn......................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  vhvdpkrtanqniehvliplrgre............................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  vpttilaqqhyetvrerfqgf...............................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  vqtagea.............................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  slitllreacssrealfltiknmidkcsgavpeplervlekinavttnskaekal.............
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  qgkilreg............................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  hivitnpdmlhtailphhtkwislfeql........................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  dnpeesrmvfstyptm....................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  hiysgflelyigkdhlqrfydkgelvladiadhpfypnqfiimkdafgssasaigivdqngkkvkkli
gi|56419219|ref|YP_146537.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  wkkiawdpfqdcftcekrhrcgqtlwrdyyrkaadlivcshdfymehvwtyearkregqlpllpeasc
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  ....................................................................
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  vvlnnaldegrrvlfegaqgvmldidqgtypfvtssnpvaggvtigagvgptki..............
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  dertdiktlpaaryiaqhaamelaaarrlirralelaeepggprpyaerlredrdmitdletrlsgpw
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  dsil................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ireldeqkkteetleisdlisrlaslknlssdqld.................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  fhhehiwgirprnvqqtmafellmrddip.......................................
gi|56419219|ref|YP_146537.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  vvfdeghllefaaqkaltyrmkettletlltrllendireelaylieetletstrffdelkacakdvp
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  ....................................................................
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  aelhralkalsfgrlpacrgkdyderlideakslrdqakkkvealrdnvfsldpsvwlrhmremkpiv
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  gsnrkeilpsprleqwakrlrgqmveignelvfesetytidhyq........................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  ....................................................................
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  etianlvrrfavmfqaakrekgivdfsdlehyclhilrrrdpetgewqpspaaleyqaqfdevlvdey
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  ....................................................................
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                   10        20                30        40         
                                                    |         |                 |         |         
d1e3ma2                         ...........YTCPTFIDKPGIRITEGRHPVVEQVL....N....EPFIANPLNLSPQ.RRMLIITG
gi|56418810|ref|YP_146128.1|  ...........--------------------------....-....-------------.--------
gi|56422010|ref|YP_149328.1|  ...........--------------------------....-....-------------.--------
gi|56421621|ref|YP_148939.1|  ...........--------------------------....-....-------------.--------
gi|56421924|ref|YP_149242.1|  ...........--------------------------....-....-------------.--------
gi|56419217|ref|YP_146535.1|  qdtnlvqeail--------------------------....-....-------------.--------
gi|56418638|ref|YP_145956.1|  ...........--------------------------....-....-------------.--------
gi|56421164|ref|YP_148482.1|  ...........--------------------------....-....----------ERP.NGIILITG
gi|56419334|ref|YP_146652.1|  ...........--------------------------....-....-------------.--------
gi|56421895|ref|YP_149213.1|  ...........--------------------------....-....-----------IGrGQRELIIG
gi|56419757|ref|YP_147075.1|  ...........--------------------------....-....---------LAVGkGQRVGIFA
gi|56421893|ref|YP_149211.1|  ...........--------------------------....-....----------YIK.GGKIGLFG
gi|56420166|ref|YP_147484.1|  ...........---------GRIEFRQ-----VVFSY....Dk...QRPALDGVTFSIApGETVALVG
gi|56420904|ref|YP_148222.1|  ...........--------------------------....-....-QQVLNELLPHVGrSIRIGVTG
gi|56418583|ref|YP_145901.1|  ...........--------------------------....-....-------------.--------
gi|56419749|ref|YP_147067.1|  ...........--------------------------....-....-------------.PKNILMIG
gi|56419871|ref|YP_147189.1|  ...........---PHVIERGEIEFRD-----VSFSY....Dg...KRDVLKRLSFVIRpGQTVAFVG
gi|56422018|ref|YP_149336.1|  ...........--------------------------....-....-------------.----GIVG
gi|56421534|ref|YP_148852.1|  ...........----------MITLEQ-----VTKIYqaanG....SVTAVDNVSLEIReGEIFGIIG
gi|56420545|ref|YP_147863.1|  ...........------------ELKG-----VYKQI....G....RNVILNGINLQVKqGELLTLLG
gi|56418613|ref|YP_145931.1|  ...........--------------------------....-....-------------.---FIFLG
gi|56419870|ref|YP_147188.1|  ...........------------------------AY....Pge..AKPALRGIRFQLKrGATLGVVG
gi|56419166|ref|YP_146484.1|  ...........-------------LDH-----IYKIY....Dn...NVVAVKDFNLHIQdKEFIVFVG
gi|56419258|ref|YP_146576.1|  ...........-----------IRFER-----VTKEY....D....GTVVLDDVSFAMErGKFYTLLG
gi|56421642|ref|YP_148960.1|  ...........--------------------------....-....-------------.--------
gi|56420511|ref|YP_147829.1|  ...........----------MIYFHQ-----VNKYY....G....DFHVLKDINLTINqGEVVVIIG
gi|56421990|ref|YP_149308.1|  ...........----------MIDVRQ-----LKKSF....G....SLQVLKGIDVHIReGEVVVVIG
gi|56418849|ref|YP_146167.1|  ...........----------MIRFEN-----VTKQY....Ed...GFVALKNINLEIRkGELVALIG
gi|56419334|ref|YP_146652.1|  ...........--------------------------....-....-------------.---FLFLG
gi|56420165|ref|YP_147483.1|  ...........-------RRGEIRFEH-----VSFRY....Pds..ELDALSDVSFVIHaQETAAILG
gi|56421187|ref|YP_148505.1|  ...........--------------------------....-....-----DDVELS--.KSNILMIG
gi|56419918|ref|YP_147236.1|  ...........--------------------------....-....-------------.--------
gi|56418613|ref|YP_145931.1|  ...........--------------------------....-....-------------.--------
gi|56421705|ref|YP_149023.1|  ...........--------------------------....-....-------------.--------
gi|56418761|ref|YP_146079.1|  ...........--------------------------....-....-------------.--------
gi|56418597|ref|YP_145915.1|  ...........--------------------------....-....------------RiPKGVLLVG
gi|56419350|ref|YP_146668.1|  ...........--------------------------....-....-VKAVDGVTFDIYkGETFGLVG
gi|56419349|ref|YP_146667.1|  ...........-----------------LHISFDIHA....G....EVQAVRGVTFDLYkGETLAIVG
gi|56420488|ref|YP_147806.1|  ...........--------------------------....-....-------------.PSTVLITG
gi|56422025|ref|YP_149343.1|  ...........--------------------------....-....-------------.--------
gi|56421636|ref|YP_148954.1|  ...........----------MIEMQD-----VYKTY....Pn...GVVALNGINVRIKqGEFVYVVG
gi|56419244|ref|YP_146562.1|  ...........--------------------------....-....-------------.--------
gi|56420756|ref|YP_148074.1|  ...........--------------------------....-....-------------.----CLIG
gi|56420970|ref|YP_148288.1|  ...........--------------------------....-....-----------HP.QGLVLLTG
gi|56421163|ref|YP_148481.1|  ...........--------------------------....-....-----------KP.HGLVLVTG
gi|56419702|ref|YP_147020.1|  ...........--------------------------....-....-------------.--LIVMSG
gi|56419503|ref|YP_146821.1|  ...........--------------------------....-....-------------.KNNPVLIG
gi|56420918|ref|YP_148236.1|  ...........--------------------------....-....-------------.--------
gi|56420877|ref|YP_148195.1|  ...........-----------LEATN-----IHKTY....GtkknLQEVLKGIDLRVEkGEFLAIMG
gi|56419264|ref|YP_146582.1|  ...........--------------------------....-....-------------.--------
gi|56418731|ref|YP_146049.1|  ...........--------------------------....-....-------------.----LLTG
gi|56421917|ref|YP_149235.1|  ...........--------------------------....-....----------PVGfGQRGLIVA
gi|56418838|ref|YP_146156.1|  ...........-----------IKIRN-----LTFRY....Ptk..PKVVLKNINLDINkGERIAIVG
gi|56419503|ref|YP_146821.1|  ...........--------------------------....-....-------------.---FLFVG
gi|56418670|ref|YP_145988.1|  ...........----------ILSIEG-----VSFRY....Pnq..SDYAVQNVSFTAErGEWLAIVG
gi|56421797|ref|YP_149115.1|  ...........--------------------------....-....-------------.--------
gi|56421512|ref|YP_148830.1|  ...........----------LLKAEN-----VGIQF....G....GLKALSGVTMELYqGELVGLIG
gi|56419841|ref|YP_147159.1|  ...........YVRPQFSTERVLVIQGGRHPVVEKVL....Ga...QMYVPNDCYMNRE.REMLLITG
gi|56420197|ref|YP_147515.1|  ...........-----------LHVER-----LTKRF....G....GLLAVNDVTFSVEqGKINAIIG
gi|56421558|ref|YP_148876.1|  ...........-----------LEVEQ-----LSKSF....G....GVQAVQNVSFHVKkEEIVAVIG
gi|56420799|ref|YP_148117.1|  ...........----------MLEVRA-----VSHRY....G....PKQVLDRVTFSVEkGELFGIVG
gi|56420924|ref|YP_148242.1|  ...........-----------------------LSI....K....NFAIIESLSLSFD.KGLTVLTG
gi|56421010|ref|YP_148328.1|  ...........--------------------------....-....-------------.--------
gi|56419920|ref|YP_147238.1|  ...........--------------------------....-....-------------.--------
gi|56418639|ref|YP_145957.1|  ...........--------------------------....-....-------------.--------
gi|56418583|ref|YP_145901.1|  ...........--------------------------....-....-------------.--------
gi|56419445|ref|YP_146763.1|  ...........---------WAVETHE-----LVKTF....G....DHRAVDGLNLRVRaGTIYGVLG
gi|56421511|ref|YP_148829.1|  ...........------------KVDG-----IDVFY....G....NIHALKGVSLEVNkGEIVTLIG
gi|56419731|ref|YP_147049.1|  ...........--------------------------....-....------------KpPTVVMMVG
gi|56419721|ref|YP_147039.1|  ...........--------------------------....-....-------------.---RLLQG
gi|56421391|ref|YP_148709.1|  ...........--------------------------....T....AVTALDDVSLSVEkGEFVSFLG
gi|56419996|ref|YP_147314.1|  ...........------------QAKE-----LTLSY....G....EAIVIDRLDLTIPkGKITVFIG
gi|56421148|ref|YP_148466.1|  ...........--------------------------....-....-------------.------SG
gi|56418847|ref|YP_146165.1|  ...........----------MLETHH-----VSKAF....G....KQLVVDDVSIKVKkQTVYGLLG
gi|56420198|ref|YP_147516.1|  ...........----------MLEVAN-----VSVRY....G....SFTAIRDVTFSVKrGEIAVLLG
gi|56418729|ref|YP_146047.1|  ...........-------------AEE-----LTVRY....D....DRTIFERLSVRIPdRQITAIIG
gi|56420178|ref|YP_147496.1|  ...........-----------LAVKE-----LRKTI....R....GKEIIKGISFELHeGEVFGFLG
gi|56419819|ref|YP_147137.1|  ...........----------VIEMLN-----IRKVF....G....TFVANDNITLQVKkGEIHALLG
gi|56419216|ref|YP_146534.1|  ...........--------------------------....-....-------------.--------
gi|56420469|ref|YP_147787.1|  ...........----------VLMCRD-----VVVDF....D....GFRALQGVDLAVYpHEVRFLIG
gi|56419007|ref|YP_146325.1|  ...........--------------------------....-....--RAVDDISFAVKqGEIVGYIG
gi|56421926|ref|YP_149244.1|  ...........--------------------------....-....-------------.--VLGITG
gi|56418552|ref|YP_145870.1|  ...........--------------------------....-....-------------.SHAYLFSG
gi|56421006|ref|YP_148324.1|  ...........-----------VQIED-----VSFRY....E....NENVLEHVSLTVPkGAFLGLVG
gi|56419712|ref|YP_147030.1|  ...........--------------------------....-....----LDELALRLR.GRVSVVAG
gi|56421096|ref|YP_148414.1|  ...........--------------------------....-....-------------.-PLFILTG
gi|56421557|ref|YP_148875.1|  ...........------------VLRN-----VHVYH....G....HLHVLKGVSLQVDeGKIVTVVG
gi|56420989|ref|YP_148307.1|  ...........--------EVVYETNG-----LNVWY....G....EHHALKHIHLSFYeREITAIIG
gi|56421797|ref|YP_149115.1|  ...........--------------------------....-....-------------.--------
gi|56419179|ref|YP_146497.1|  ...........------------EIIE-----VTKRF....G....QATAVDHLTLTVPeGEMFGLLG
gi|56420468|ref|YP_147786.1|  ...........-------------LRN-----VTAGY....D....ESVVLDQVRMDIPlSRVTAVLG
gi|56421763|ref|YP_149081.1|  ...........-------------MRS-----IQKSF....G....ANIVLNGVDFEVLpGEVHALMG
gi|56418671|ref|YP_145989.1|  ...........--------------YNARSPLA----....-....-RRALYDVNVAIRsGAYVAVVG
gi|56419272|ref|YP_146590.1|  ...........------------AVQD-----VNKIY....Pp...NRQVLHNVSLELVeGDRLILLG
gi|56421043|ref|YP_148361.1|  ...........--------------------------....-....-------------.--------
gi|56420022|ref|YP_147340.1|  ...........--------------------------....-....---AVKDVSFTIEkGEIVGFLG
gi|56420415|ref|YP_147733.1|  ...........----------VLEMKG-----ITKEF....P....GVRALDNVTFSVRkGEIHALCG
gi|56420326|ref|YP_147644.1|  ...........--------------------------....-....-------------.--------
gi|56419193|ref|YP_146511.1|  ...........-----------LEVKD-----LSGGY....T....AQNVLEDVTFVVDrGEMVALIG
gi|56418559|ref|YP_145877.1|  ...........--------------------------....-....-------------.-----FEG
gi|56422011|ref|YP_149329.1|  ...........--------------------------....-....-------------.--------
gi|56419728|ref|YP_147046.1|  ...........--------------------------....-....-----DRVSIEFV.PGVTAVVG
gi|56421642|ref|YP_148960.1|  ...........--------------------------....-....-------------.--------
gi|56420899|ref|YP_148217.1|  ...........------------VIEG-----LTKIV....K....KKPILSDVSLTLS.-GVYGLLG
gi|56419677|ref|YP_146995.1|  ...........------------VIEG-----LTKIV....K....KKPILSDVSLTLS.-GVYGLLG
gi|56421126|ref|YP_148444.1|  ...........--------------------------....-....-------------.-DHVLLYG
gi|56421185|ref|YP_148503.1|  ...........--------------------------....-....--LSVKQLTKSLK.GPILCLAG
gi|56420429|ref|YP_147747.1|  ...........----------VLEMID-----ITKEF....P....GVKALDGVQLKVKrGTVHALMG
gi|56420896|ref|YP_148214.1|  ...........------------HVSS-----VTKRI....K....KQLILSNVSLCME.-GIYGLVG
gi|56420444|ref|YP_147762.1|  ...........----------ILEMRG-----ITKQF....P....GVKALDNVNLKIReGEIHALCG
gi|56420563|ref|YP_147881.1|  ...........-----------LQLKGIYKVFHEGTP....D....EKIALQNIHLTLRkGDFVTVIG
gi|56421620|ref|YP_148938.1|  ...........--------------------------....-....-EHNLKNVSVKIPlGTFVAVTG
gi|56420212|ref|YP_147530.1|  ...........----------IIRMRD-----VSWAR....G....GRMILRDINWEVKeGEQWAILG
gi|56419206|ref|YP_146524.1|  ...........------------------------TA....D....EKIALRGIDLTLApGDFVTVIG
gi|56420341|ref|YP_147659.1|  ...........------------RMER-----VKYAY....Qa...ERYVLNGIDWEIPeRKKCALIG
gi|56419798|ref|YP_147116.1|  ...........--------------------------....-....-------------.PPVVTIMG
gi|56420778|ref|YP_148096.1|  ...........--------------------------....-....-------------.--------
gi|56419605|ref|YP_146923.1|  ...........--------------------------....-....-------------.--------
gi|56419482|ref|YP_146800.1|  ...........------------SMRG-----MEKSF....G....AVRVLDGVDFDVRpGEVHALLG
gi|56420961|ref|YP_148279.1|  ...........--------------------------....-....-------------.--------
gi|56421023|ref|YP_148341.1|  ...........--------------------------....-....-------------.---VAIIG
gi|56420330|ref|YP_147648.1|  ...........--------------------------....-....-------------.--------
gi|56421141|ref|YP_148459.1|  ...........--------------------------....-....-------------.---VGLVG
gi|56419729|ref|YP_147047.1|  ...........--------------------------....-....-------------.--VILFVG
gi|56418720|ref|YP_146038.1|  ...........--------------------------....-....-------------.--------
gi|56420762|ref|YP_148080.1|  ...........--------------------------....-....-------------.---IAIDG
gi|56418614|ref|YP_145932.1|  ...........--------------------------....-....------------K.GSLVLIGG
gi|56418826|ref|YP_146144.1|  ...........-----------IVLSN-----VSKTI....K....AREVLRNINLELErGKIYGFVG
gi|56421083|ref|YP_148401.1|  ...........--------------------------....-....-------------.--VIGVAG
gi|56419816|ref|YP_147134.1|  ...........--------------------------....-....-------------.--HLLIAG
gi|56420429|ref|YP_147747.1|  ...........--------------------------....-....----FHDVSFEVRkGEIVGFAG
gi|56421186|ref|YP_148504.1|  ...........--------------------------....-....GIKALKAALCGPN.PQHVIIYG
gi|56418583|ref|YP_145901.1|  ...........--------------------------....-....-------------.--------
gi|56420156|ref|YP_147474.1|  ...........-----------IQLVD-----VTKTF....D....RFAAVKGANMMVPkGAIYGLLG
gi|56419155|ref|YP_146473.1|  ...........--------------------------....-....DGLLFRDLSLSIAeGEKVLLLG
gi|56419739|ref|YP_147057.1|  ...........--------------------------....-....-------------.---ALIVG
gi|56419819|ref|YP_147137.1|  ...........--KPAEPGKPVLEIKD-----LVVKD....Ar...GIKAVNGLNLTVHaGEIVGIAG
gi|56421620|ref|YP_148938.1|  ...........--------------------------....-....--HNLKNIDVEIPrGKLVVLTG
gi|56418775|ref|YP_146093.1|  ...........------------QVHG-----LTKYF....G....ADLILSNIKLEIQsHDRIALVG
gi|56418536|ref|YP_145854.1|  ...........--------------------------....-....-------------.---LFIYG
gi|56418775|ref|YP_146093.1|  ...........---------EVLTAED-----IAVGY....Gd...GAPIIRQISFRITrGESVALVG
gi|56422029|ref|YP_149347.1|  ...........--------------------------....-....-------------.-LATVIIG
gi|56421705|ref|YP_149023.1|  ...........--------------------------....-....-------------.--------
gi|56421351|ref|YP_148669.1|  ...........--------------------------....-....-------------.----LIAG
gi|56421763|ref|YP_149081.1|  ...........--------------------------....-....KKGLFENVSFSVRaGEVLGVAG
gi|56421102|ref|YP_148420.1|  ...........--------------------------....-....-------------.---LLLYG
gi|56420331|ref|YP_147649.1|  ...........--------------------------....-....-------------.--------
gi|56418678|ref|YP_145996.1|  ...........--------------------------....-....-------------.-------G
gi|56420415|ref|YP_147733.1|  ...........---PRNVGKEILKVDH-----YSVID....Eqt..GREVIHDVSFSLKaGEILGISG
gi|56420756|ref|YP_148074.1|  ...........--------------------------....-....-------------.--VVAIVG
gi|56421228|ref|YP_148546.1|  ...........---PAVNSRGYLRFLQARHPLLD---....Q....EKAVPNDIELGGD.YTTIVITG
gi|56419775|ref|YP_147093.1|  ...........--------------------------....-....-------------.--------
gi|56421552|ref|YP_148870.1|  ...........--------------------------....-....-------------.--------
gi|56420444|ref|YP_147762.1|  ...........----------IFEVRN-----WTVYH....Pvys.ERKVLDNINLSIRrGEIVGIAG
gi|56418786|ref|YP_146104.1|  ...........--------------------------....-....-------------.--------
gi|56418662|ref|YP_145980.1|  ...........--------------------------....-....-------------.----VLMG
gi|56421262|ref|YP_148580.1|  ...........--------------------------....-....-------------.---IGLTG
gi|56420961|ref|YP_148279.1|  ...........--------------------------....-....-------------.--------
gi|56418539|ref|YP_145857.1|  ...........--------------------------....-....------YETLNFG.EGVNVILG
gi|56419950|ref|YP_147268.1|  ...........--------------------------....-....-------------.HTLTLVWG
gi|56420072|ref|YP_147390.1|  ...........--------------------------....-....-------------.--------
gi|56419155|ref|YP_146473.1|  ...........--------------------------....-....-----------VHaGEWIAVTG
gi|56421530|ref|YP_148848.1|  ...........-----------LTIRN-----LHVAV....E....GKEILKGVDLEVKgGEIHAIMG
gi|56421861|ref|YP_149179.1|  ...........--------------------------....-....-------------.--------
gi|56419849|ref|YP_147167.1|  ...........--------------------------....-....-------------.---MIFKG
gi|56419705|ref|YP_147023.1|  ...........--------------------------....-....----------RAGeHRTFLLYG
gi|56421915|ref|YP_149233.1|  ...........--------------------------....-....-------------.--------
gi|56418560|ref|YP_145878.1|  ...........--------------------------....-....-------------.--------
gi|56419721|ref|YP_147039.1|  ...........--------------------------....-....-------------.--------
gi|56420639|ref|YP_147957.1|  ...........--------------------------....-....-------------.--------
gi|56420018|ref|YP_147336.1|  ...........--------------------------....-....-------------.---IALMG
gi|56418949|ref|YP_146267.1|  ...........--------------------------....-....-------------.-AILWFTG
gi|56410473|ref|YP_145847.1|  ...........--------------------------....-....-------------.--------
gi|56421823|ref|YP_149141.1|  ...........--------------------------....G....HHQAKRALEIAAAgGHHVLMVG
gi|56419482|ref|YP_146800.1|  ...........--------------------------....-....--------DLYAHrGEIVGIAG
gi|56421184|ref|YP_148502.1|  ...........--------------------------....-....-------------.---VALAG
gi|56419257|ref|YP_146575.1|  ...........-----------FSLQN-----LTYRY....Dg...GATIFQQFSFSIFsGETVLLTG
gi|56421028|ref|YP_148346.1|  ...........--------------------------....-....-------------.------IG
gi|56418714|ref|YP_146032.1|  ...........--------------------------....-....-------------.--VLGIDG
gi|56419859|ref|YP_147177.1|  ...........--------------------------....-....-------------.---VALVG
gi|56420462|ref|YP_147780.1|  ...........--------------------------....-....-------------.---IGIGG
gi|56421621|ref|YP_148939.1|  ...........--------------------------....-....-------------.--------
gi|56420269|ref|YP_147587.1|  ...........--------------------------....-....DEAIVHDAAIALAlGKNVLLKG
gi|56419774|ref|YP_147092.1|  ...........--------------------------....-....-------------.KKYMILLG
gi|56420796|ref|YP_148114.1|  ...........--------------------------....-....-------------.--------
gi|56420383|ref|YP_147701.1|  ...........--------------------------....-....-------------.---VALFG
gi|56419705|ref|YP_147023.1|  ...........--------------------------....-....-------------.--------
gi|56421682|ref|YP_149000.1|  ...........--------------------------....-....-------------.--------
gi|56420072|ref|YP_147390.1|  ...........--------------------------....-....-------------.--------
gi|56418881|ref|YP_146199.1|  ...........--------------------------....-....-------------.--------
gi|56420088|ref|YP_147406.1|  ...........--------------------------....-....-------------.--IVAFCG
gi|56421060|ref|YP_148378.1|  ...........--------------------------....-....-----EAINRYRE.GGDVYVVG
gi|56420924|ref|YP_148242.1|  ...........------------------------SI....K....NFAIIESLSLSFD.KGLTVLTG
gi|56420088|ref|YP_147406.1|  ...........--------------------------....-....-------------.--TVALFG
gi|56421048|ref|YP_148366.1|  ...........--------------------------....-....-------------.--------
gi|56419610|ref|YP_146928.1|  ...........--------------------------....-....-------------.--LVTLIG
gi|56419219|ref|YP_146537.1|  ...........--------------------------....-....------------E.GGVFGIFG
gi|56418583|ref|YP_145901.1|  ...........--------------------------....-....-------------.--------
gi|56419416|ref|YP_146734.1|  ...........--------------------------....-....-------------.RGIGLLIG
gi|56419316|ref|YP_146634.1|  ...........--------------------------....-....-------------.RGIGLLIG
gi|56420452|ref|YP_147770.1|  ...........--------------------------....-....-------------.RGIGLLIG
gi|56418692|ref|YP_146010.1|  ...........--------------------------....-....------------RtRGIGLLIG
gi|56418885|ref|YP_146203.1|  ...........--------------------------....-....------------RtRGIGLLIG
gi|56420238|ref|YP_147556.1|  ...........--------------------------....-....------------RtRGIGLLIG
gi|56419917|ref|YP_147235.1|  ...........--------------------------....-....-------------.--------
gi|56420711|ref|YP_148029.1|  ...........--------------------------....-....-------------.--------
gi|56419088|ref|YP_146406.1|  ...........--------------------------....-....-------------.-PHLLIAG
gi|56419319|ref|YP_146637.1|  ...........--------------------------....-....-------------.KQNVLLLG
gi|56418771|ref|YP_146089.1|  ...........--------------------------....-....-----------LErGMVIALEG
gi|56419830|ref|YP_147148.1|  ...........--------------------------....-....-----------YPrGRIVEIYG
gi|56420943|ref|YP_148261.1|  ...........--------------------LIPYVY....D....GR-----------.WRHTMIIG
gi|56420079|ref|YP_147397.1|  ...........--------------------------....-....-------------.--------
gi|56419847|ref|YP_147165.1|  ...........--------------------------....-....-------------.----VIVG
gi|56420591|ref|YP_147909.1|  ...........--------------------------....-....-------------.--NIILIG
gi|56421256|ref|YP_148574.1|  ...........--------------------------....-....-------------.----YLHG
gi|56421803|ref|YP_149121.1|  ...........--------------------------....-....-----------EEiTDVTVLIG
gi|56419913|ref|YP_147231.1|  ...........--------------------------....Y....TKEEVTNLFLSLKtKPFVILSG
gi|56419308|ref|YP_146626.1|  ...........--------------------------....-....-------------.--VWQVVG
gi|56418881|ref|YP_146199.1|  ...........--------------------------....-....-------------.--------
gi|56420752|ref|YP_148070.1|  ...........--------------------------....-....-------------.---LGVVG
gi|56419021|ref|YP_146339.1|  ...........---------------E----------....-....-YFHPAAKRLDVR.KRILLLMG
gi|56419420|ref|YP_146738.1|  ...........--------------------------....-....----------DEGfGCRNIIYG
gi|56421601|ref|YP_148919.1|  ...........--------------------------....-....-------------.---VIITG
gi|56418742|ref|YP_146060.1|  ...........--------------------------....-....-------------.--------
gi|56420793|ref|YP_148111.1|  ...........--------------------------....-....-------------.--------
gi|56418854|ref|YP_146172.1|  ...........--------------------------....-....---------FHFA.DGKLLLRG
gi|56419917|ref|YP_147235.1|  ...........--------------------------....-....-------------.--------
gi|56419847|ref|YP_147165.1|  ...........--------------------------....-....-------------.---AVIVG
gi|56419216|ref|YP_146534.1|  ...........--------------------------....-....-------------.-----LLG
gi|56419674|ref|YP_146992.1|  ...........--------------------------....-....-------------.--------
gi|56421780|ref|YP_149098.1|  ...........--------------------------....-....-------------.--------


                                50        60               70                    80                 
                                 |         |                |                     |                 
d1e3ma2                         PNMGGKSTYMRQTALIA..LMA.....YIGS...........YVPAQK.VEIG...............
gi|56418810|ref|YP_146128.1|  -----------------..---.....----...........------.----...............
gi|56422010|ref|YP_149328.1|  ----------K------..---.....----...........------.----...............
gi|56421621|ref|YP_148939.1|  -TGTGKTFTI-------..---.....----...........------.----...............
gi|56421924|ref|YP_149242.1|  -----------------..---.....----...........------.----...............
gi|56419217|ref|YP_146535.1|  -----------------..---.....----...........------.----...............
gi|56418638|ref|YP_145956.1|  ---AGKTTTTERILFYT..---.....----...........---GRV.HKIG...............
gi|56421164|ref|YP_148482.1|  PTGSGKSSTLYAALNHL..NSE.....HVNI...........ITIEDP.VEYQiegvnqiqvn.....
gi|56419334|ref|YP_146652.1|  -----------------..---.....----...........------.----...............
gi|56421895|ref|YP_149213.1|  DRQTGKTSV----AID-..---.....----...........------.----...............
gi|56419757|ref|YP_147075.1|  GSGVGKSTLMGMIARHT..SAD.....VNVI...........ALIGER.GREVreflerdlgpdglar
gi|56421893|ref|YP_149211.1|  GAGVGKTVLIQELIHNI..AQE.....HGGI...........SVFAGV.GERT...............
gi|56420166|ref|YP_147484.1|  PTGAGKTTVLQLLTRFY..DPD.....RGVI...........LIDGRD.SRTIkraslrrhmafvlqd
gi|56420904|ref|YP_148222.1|  VPGAGKSTFIEAFGTFL..CEQ.....GHRV...........AVLAVD.PTSSltggsilgdktrmea
gi|56418583|ref|YP_145901.1|  -----------------..---.....----...........------.----...............
gi|56419749|ref|YP_147067.1|  PTGVGKTEIARRLAKLV..GAP.....FIKVeatkftev...G-----.---Yvgrdvesmvrdlvet
gi|56419871|ref|YP_147189.1|  HTGSGKSSIINLLMRFY..EFD.....RGDI...........LLDGRS.IRDYsraelrrrlglvlqd
gi|56422018|ref|YP_149336.1|  LPNVGKSTLFNAIT---..---.....----...........------.----...............
gi|56421534|ref|YP_148852.1|  YSGAGKSTLIRLLNGLE..KPT.....SGRV...........VVAGRD.MTRVkgrelrkarqeigmi
gi|56420545|ref|YP_147863.1|  PSGCGKTSTLNTIAGFL..DID.....KGEV...........FIKGKN.VTNIppykrglgmvfqtys
gi|56418613|ref|YP_145931.1|  PTGVGKTELARALAEAM..F--.....----...........-GDEDA.LIRI...............
gi|56419870|ref|YP_147188.1|  KTGAGKTTLLRLLLREF..DGY.....DGEI...........RFGGRD.IRDYtlfalrsaigyvpqd
gi|56419166|ref|YP_146484.1|  PSGCGKSTTLRMIAGLE..EIS.....KGDL...........YIDGKR.MNDVppkdrdiamvfqnya
gi|56419258|ref|YP_146576.1|  PSGCGKTTILRLIAGFI..EPT.....EGTI...........YFHGKP.IQNVppnkrqvntvfqdya
gi|56421642|ref|YP_148960.1|  -----------------..---.....----...........------.----...............
gi|56420511|ref|YP_147829.1|  PSGSGKSTLVRCINRLE..TIS.....SGEL...........IVDGVK.VNDKhininelrrnigmvf
gi|56421990|ref|YP_149308.1|  PSGSGKSTFLRCLNLLE..DFD.....EGEI...........IIDGIN.LKAKdtnlnkvreevgmvf
gi|56418849|ref|YP_146167.1|  PSGCGKTTTMRMINRLI..EPT.....SGKV...........YIDGQD.ISQLdpvelrrnigyviqq
gi|56419334|ref|YP_146652.1|  PTGVGKTELAKALAEAL..FDS.....EEQ-...........------.LIRL...............
gi|56420165|ref|YP_147483.1|  ATGSGKSTLLQLIPRLY..EPG.....AGRV...........LIDGID.VREFsveqlrmyvrfvpqe
gi|56421187|ref|YP_148505.1|  PTGSGKTLLAQTLARIL..N--.....----...........------.----...............
gi|56419918|ref|YP_147236.1|  -----------------..---.....----...........------.----...............
gi|56418613|ref|YP_145931.1|  -----------------..---.....----...........------.----...............
gi|56421705|ref|YP_149023.1|  -----------------..---.....----...........------.----...............
gi|56418761|ref|YP_146079.1|  -----------------..---.....----...........------.----...............
gi|56418597|ref|YP_145915.1|  PPGTGKTLLARAVAGEA..G--.....----...........-VPFFS.ISGS...............
gi|56419350|ref|YP_146668.1|  ESGCGKSTTGRTIIRLY..EAT.....EGEV...........LFNGVN.VHGKkskkelkelnrkmqm
gi|56419349|ref|YP_146667.1|  ESGSGKSVTSKALMRLL..PTPpsrikQGEI...........LFEGKD.LTKLsekdmqsirgakism
gi|56420488|ref|YP_147806.1|  ESGTGKEVVARAIHEAG..PHA.....DG--...........------.----...............
gi|56422025|ref|YP_149343.1|  -----------------..---.....----...........------.----...............
gi|56421636|ref|YP_148954.1|  PSGAGKSTFIKMMYREE..KPT.....SGTI...........MVNGVN.LAKLkdskvpllrrhigvv
gi|56419244|ref|YP_146562.1|  -----------------..---.....----...........------.----...............
gi|56420756|ref|YP_148074.1|  RPNVGKSSLVNAILGEE..RVI.....VSDIagt........TRDAVD.TSFV...............
gi|56420970|ref|YP_148288.1|  PTGSGKTTTLYTLLDLC..QAE.....RQRN...........IITLED.PIEK...............
gi|56421163|ref|YP_148481.1|  PTGSGKSTTLAAMIDYM..NKT.....MSRH...........IITLED.PIEY...............
gi|56419702|ref|YP_147020.1|  PSGVGKGTVRKALFSQP..DINl....HYSV...........SVTTRK.PREG...............
gi|56419503|ref|YP_146821.1|  EPGVGKTAIVEGLALKI..AEG.....QVPE...........KLLNKE.VYLL...............
gi|56420918|ref|YP_148236.1|  -----------------..---.....----...........------.----...............
gi|56420877|ref|YP_148195.1|  PSGSGKTTLLNVLSSID..RVS.....EGAI...........FIEGNN.VVAMkdrelaefrkrhvgf
gi|56419264|ref|YP_146582.1|  -----------------..---.....----...........------.----...............
gi|56418731|ref|YP_146049.1|  ESGTGK-----------..---.....----...........------.----...............
gi|56421917|ref|YP_149235.1|  PPKAGKTMLLKEIANSI..TTN.....HPDVelivl......L-----.----...............
gi|56418838|ref|YP_146156.1|  ANGSGKSTLIKLLLKLY..EHD.....EDSI...........FYNGVS.INDLdteqlrkniavlfqd
gi|56419503|ref|YP_146821.1|  PTGVGKTELAKTLAEEL..FGT.....----...........---KDA.MIRL...............
gi|56418670|ref|YP_145988.1|  HNGSGKSTIARMLIGLL..RPE.....RGAI...........RLFGRL.LNDAtvwevrrrvglvfqn
gi|56421797|ref|YP_149115.1|  -----------------..---.....----...........------.----...............
gi|56421512|ref|YP_148830.1|  PNGAGKTTLFNLLTGVY..VPT.....DGRI...........MLDGET.LNGLppykitrkgisrtfq
gi|56419841|ref|YP_147159.1|  PNMAGKSTYMRQVALTA..VMA.....QIGC...........FVPAER.AVLP...............
gi|56420197|ref|YP_147515.1|  PNGAGKSTFFNLISGLY..RPT.....SGTI...........TFKGRD.ITRLpaneraklgiartfq
gi|56421558|ref|YP_148876.1|  PNGAGKTTLFNMISGII..PPT.....SGLV...........RFQGAM.VSGKqphelamlgmtrtfq
gi|56420799|ref|YP_148117.1|  PNGSGKTTLLKLICKEL..PLA.....SGEI...........KIHGQP.LLALsakqwarfaavlpqt
gi|56420924|ref|YP_148242.1|  ETGAGKSIIIDAIHLLI..G--.....----...........------.----...............
gi|56421010|ref|YP_148328.1|  -----K-----------..---.....----...........------.----...............
gi|56419920|ref|YP_147238.1|  -----------------..---.....----...........------.----...............
gi|56418639|ref|YP_145957.1|  ----GKTTLTAAITTVL..---.....----...........------.----...............
gi|56418583|ref|YP_145901.1|  -----------------..---.....----...........------.----...............
gi|56419445|ref|YP_146763.1|  PNGAGKTTTIRMLATLL..RPD.....AGSA...........QIFGYD.VVKQpqvvrqligvtgqya
gi|56421511|ref|YP_148829.1|  ANGAGKTTLLKTISGLL..RPK.....NGDI...........VYEGAS.IAGKaaqtivkqgishvpe
gi|56419731|ref|YP_147049.1|  LQGAGKTTTTGKLANLL..RKR.....HNRKp..........LLVAAD.VYRP...............
gi|56419721|ref|YP_147039.1|  DVGSGKTVVAAVALYAA..ALSgf...QGAL...........MVPTEI.LAEQ...............
gi|56421391|ref|YP_148709.1|  PSGCGKTTLLSIIAGLI..EPT.....EGAV...........HIEGQP.IWPSgtaapaarravgyml
gi|56419996|ref|YP_147314.1|  ANGCGKSTLLRALARLL..KPT.....SGAV...........LLDGKE.IAKQptkeiarrlailpqs
gi|56421148|ref|YP_148466.1|  KGGVGKTTTTANLGTAL..AIL.....GKRV...........CLVDTD.IGLRnldvvlglenriiyd
gi|56418847|ref|YP_146165.1|  PNGAGKSTLLKMLTGLL..RPT.....KGEI...........MINGHP.WSRKdlkdigvliespaly
gi|56420198|ref|YP_147516.1|  ANGAGKSTLFRTISGLH..KPV.....QGEI...........RLDGER.IDSLppdrivgrgvvqcae
gi|56418729|ref|YP_146047.1|  PNGCGKSTLLKTLTRII..SPQ.....SGAV...........ILDGRA.ISQQptkelakkiailpqt
gi|56420178|ref|YP_147496.1|  PNGAGKTTTIRMLVGLI..RPT.....SGTV...........AICGYD.LHRQftdairqigcivenp
gi|56419819|ref|YP_147137.1|  ENGAGKSTLMNVLFGLY..QPD.....GGEI...........RVKGKP.VRITdpnvandlgigmvhq
gi|56419216|ref|YP_146534.1|  -----------------..---.....----...........------.----...............
gi|56420469|ref|YP_147787.1|  PNGAGKTTLLDVICGRT..RAT.....DGRV...........LFFSHD.ITKRpeyeivqmgiarkfq
gi|56419007|ref|YP_146325.1|  ENGAGKSTTIKMLTGIL..TPT.....SGRI...........VVNGMN.PHKErekfvrtigvvfgqr
gi|56421926|ref|YP_149244.1|  TGGAGKSSLTDELVR--..---.....----...........------.----...............
gi|56418552|ref|YP_145870.1|  PRGTGKTSAAKIFAKAV..NCE.....QAPA...........------.----...............
gi|56421006|ref|YP_148324.1|  PNGSGKSTLLKCVLGLL..KPN.....SGRI...........FLFGEP.IESFrewhrigfvsqkans
gi|56419712|ref|YP_147030.1|  QSGVGKSSLLNALRPDL..RLK.....TGDI...........------.----...............
gi|56421096|ref|YP_148414.1|  GPGTGKTTVIKGIVELF..AAL.....NGLS...........LDPADY.KQGEpfpvllaaptgraak
gi|56421557|ref|YP_148875.1|  ANGAGKSTLLGTIAGVY..APT.....EGEI...........LFEHKP.LPYGkveqivekgiclvpe
gi|56420989|ref|YP_148307.1|  PSGCGKSTYIKTLNRMI..ELIpnvrlEGEI...........LYRGRR.IFDTsypveqlrtqvgmvf
gi|56421797|ref|YP_149115.1|  -----------------..---.....----...........------.----...............
gi|56419179|ref|YP_146497.1|  ANGAGKTTTFRMILGLL..LPT.....EGVI...........RWQGEP.IDYSkghligylpeergly
gi|56420468|ref|YP_147786.1|  RNGVGKTTLMKTIIGLI..RPM.....SGVI...........EWEGED.ITRWpperraragigyvpq
gi|56421763|ref|YP_149081.1|  ENGAGKSTLIKVLTGIY..ERD.....GGTI...........VVNGRE.VHYRhpkeaerdgivvihq
gi|56418671|ref|YP_145989.1|  HTGSGKSTLLQHLNGLL..QPT.....SGAV...........KIGEET.ITSHkrpkqlkplrkkvgv
gi|56419272|ref|YP_146590.1|  PNGAGKTTLIRCIIGLT..APD.....SGSI...........YVNGVD.VVRHpdearesiavvfeea
gi|56421043|ref|YP_148361.1|  -----------------..---.....----...........------.----...............
gi|56420022|ref|YP_147340.1|  PNGAGKTTTMKMLAGLL..HPT.....SGEI...........TVGGFV.PFEQkpefkkmmslvmgqk
gi|56420415|ref|YP_147733.1|  ENGAGKSTLMKVLSGVY..PYGsy...DGKI...........YIEGKE.VRFRnikesqeagiaiiyq
gi|56420326|ref|YP_147644.1|  -----------------..---.....----...........------.----...............
gi|56419193|ref|YP_146511.1|  LNGAGKSTTIKHIIGLM..EPR.....RGAI...........SINGYR.LADGpetyrrqfayipetp
gi|56418559|ref|YP_145877.1|  PEGAGKTTMISKLESLL..RER.....GIDV...........VATREP.GGVR...............
gi|56422011|ref|YP_149329.1|  -----------------..---.....----...........--D---.----...............
gi|56419728|ref|YP_147046.1|  PNGSGKSNITDAIRWVL..GEQ.....SAKS...........LRGAKM.EDVI...............
gi|56421642|ref|YP_148960.1|  ---A-------------..---.....----...........------.----...............
gi|56420899|ref|YP_148217.1|  PNGAGKTTLMRIVAGLL..EFN.....AGRV...........SLGDEP.ISTGarvkrvneigylpqe
gi|56419677|ref|YP_146995.1|  PNGAGKTTLMRIVAGLL..EFN.....AGQV...........LLGEER.ISTGtrvkrvneigylpqe
gi|56421126|ref|YP_148444.1|  PPGLGKTTLAVIIANEM..---.....----...........------.----...............
gi|56421185|ref|YP_148503.1|  PPGVGKTSLARSIAKAL..GRR.....FVRV...........SLGGVR.DESE...............
gi|56420429|ref|YP_147747.1|  ENGAGKSTLMKILIGIY..TPD.....RGKI...........ILDGEE.LKVStikhaldrgismihq
gi|56420896|ref|YP_148214.1|  PNGAGKTTLMKILAGLT..PMD.....EGQV...........AIDERS.CTKGkyvkaherigylpqd
gi|56420444|ref|YP_147762.1|  ENGAGKSTLMKVLSGVY..PYGty...DGEI...........LFKGEV.CRFKdikqseqlgiviihq
gi|56420563|ref|YP_147881.1|  SNGAGKSTLMNLISGVL..FPD.....EGTI...........WIDGQD.VTMMpeyvrsryigrvfqd
gi|56421620|ref|YP_148938.1|  VSGSGKSTLVNEVLYKA..LAQ.....KLHRakakpgehrg.I-----.---Rglehldkvididqsp
gi|56420212|ref|YP_147530.1|  LNGSGKTSLLNIVTGYQ..YPT.....RGDV...........EVLGYR.FGQAslwelrrhigfvsss
gi|56419206|ref|YP_146524.1|  SNGAGKSTLMNIISGRL..SPD.....TGEV...........WINGCD.VTALkehararyigrvfqd
gi|56420341|ref|YP_147659.1|  PNGCGKTTLFLHLNGLL..RAQ.....EGAV...........YWKGRN.MYERgadwtqwrrevgivf
gi|56419798|ref|YP_147116.1|  HVDHGKTTLLDAIRH--..---.....----...........------.----...............
gi|56420778|ref|YP_148096.1|  -----------------..---.....----...........------.----...............
gi|56419605|ref|YP_146923.1|  ----GKTTLVDQLLRQS..---.....----...........------.----...............
gi|56419482|ref|YP_146800.1|  MNGAGKSTLMNILAGAI..PPD.....AGTI...........TIDGTI.YTFSspreakqagiglvvq
gi|56420961|ref|YP_148279.1|  -----------------..---.....----...........------.----...............
gi|56421023|ref|YP_148341.1|  RPNVGKSTFLNRVIGQK..IA-.....----...........------.----...............
gi|56420330|ref|YP_147648.1|  -----------------..---.....----...........------.----...............
gi|56421141|ref|YP_148459.1|  FPSVGKSTLLSVVSAAR..P--.....----...........------.----...............
gi|56419729|ref|YP_147047.1|  VNGVGKTTTIGKLAHKL..KSE.....GKSV...........LLAAGD.TFRA...............
gi|56418720|ref|YP_146038.1|  -----------------..---.....----...........------.----...............
gi|56420762|ref|YP_148080.1|  PAAAGKSTVAKRIAERL..SYV.....YIDT...........------.----...............
gi|56418614|ref|YP_145932.1|  DPGIGKSTLLLQTSAQL..AAA.....GHQVl..........YVSGEE.SVKQvklragrlraecdql
gi|56418826|ref|YP_146144.1|  PNGSGKTMLFRVISGLV..KPS.....SGTV...........AVFGQT.LHQDvsfpsdisvllekpg
gi|56421083|ref|YP_148401.1|  GSGSGKTSVARAIYDHF..G--.....----...........------.----...............
gi|56419816|ref|YP_147134.1|  ATGSGKSVCINGIIVSL..LMR.....T---...........------.----...............
gi|56420429|ref|YP_147747.1|  LMGSGRTEVLESVFGVT..KPD.....AGDI...........YVHGKK.ATIRstrdairygmgllte
gi|56421186|ref|YP_148504.1|  PPGVGKTAAARLVL---..---.....----...........------.----...............
gi|56418583|ref|YP_145901.1|  -----------------..---.....----...........------.----...............
gi|56420156|ref|YP_147474.1|  PNGAGKTTLLKMMAGIL..RQD.....RGTI...........TVDGED.VWENvrvkqrllflpdfvy
gi|56419155|ref|YP_146473.1|  PSGCGKSTLLQVMAGII..-PR.....SIDV...........PMKAER.LKRPerwgyvfqdpdaqfc
gi|56419739|ref|YP_147057.1|  IPNVGKSTLINRLAGRH..IAK.....TGDK...........------.----...............
gi|56419819|ref|YP_147137.1|  VDGNGQTELIEAITGLI..KAE.....SGTI...........RLNGRD.ITNLpprkiieagvghipq
gi|56421620|ref|YP_148938.1|  LSGSGKSSL----AFDT..IYA.....EGQR...........RYVESL.SAYA...............
gi|56418775|ref|YP_146093.1|  RNGAGKSTLLKIIAGEL..SFD.....SGKI...........IKPNHI.KIGYlaqnsgldsprsiwd
gi|56418536|ref|YP_145854.1|  GVGLGKTHLMHAIGHYV..IEH.....NPSA...........KV----.----...............
gi|56418775|ref|YP_146093.1|  PNGIGKSTLLKAIARKL..PIQ.....TGEL...........RYGANV.QIGYydqdqadlssnkrvl
gi|56422029|ref|YP_149347.1|  RPNVGKSSLLNALAHEN..RAI.....VTDI...........PGTTRD.V---...............
gi|56421705|ref|YP_149023.1|  -----------------..---.....----...........------.----...............
gi|56421351|ref|YP_148669.1|  ATGSGKSVCMNAMLISM..LY-.....----...........------.----...............
gi|56421763|ref|YP_149081.1|  LMGSGRTEIMEAIFGAR..PFD.....EGDI...........YIDGRP.VRIRsprqavehgiamite
gi|56421102|ref|YP_148420.1|  EPGTGKTSLAYAIARTA..---.....----...........------.----...............
gi|56420331|ref|YP_147649.1|  -SGAGKTTV--TLGLMA..AMR.....QQGY...........TVQGFK.CGP-...............
gi|56418678|ref|YP_145996.1|  KGGVGKSTV--SVNLAV..ALA.....RLGK...........KVGLID.ADI-...............
gi|56420415|ref|YP_147733.1|  LMGSGRTELFTSLFGAY..HGKk....KGTV...........WIDGKQ.VDIRrpaeaiqygmayvse
gi|56420756|ref|YP_148074.1|  RPNVGKSTIFNRIVGER..ISI.....VEDV...........PGVTRD.RIYS...............
gi|56421228|ref|YP_148546.1|  PNTGGKTVTLKTIGLLT..LMA.....QAGL...........FIPAADgSEAA...............
gi|56419775|ref|YP_147093.1|  -----------------..---.....----...........------.----...............
gi|56421552|ref|YP_148870.1|  -----------------..---.....----...........------.----...............
gi|56420444|ref|YP_147762.1|  LMGAGRTELAMSIFGRS..YGKki...SGEI...........WKNGVK.IDVSdvskaiangiayvte
gi|56418786|ref|YP_146104.1|  -----------------..---.....----...........------.----...............
gi|56418662|ref|YP_145980.1|  LPGAGKGTQA-------..---.....----...........------.----...............
gi|56421262|ref|YP_148580.1|  GIASGKSTVSAMMRELG..LP-.....----...........------.----...............
gi|56420961|ref|YP_148279.1|  -----------------..---.....----...........------.----...............
gi|56418539|ref|YP_145857.1|  ENAQGKTNMMEAIYVLA..M-A.....KSHR...........TSNDKD.LIRWneeyakiegraekrs
gi|56419950|ref|YP_147268.1|  PPGTGKTHFIAVALRLL..MEM.....YEKRgrrlai.....L-----.VSGFthaaienvlrkiqel
gi|56420072|ref|YP_147390.1|  -----------------..---.....----...........------.----...............
gi|56419155|ref|YP_146473.1|  KNGAGKSTLLHALMQLI..R-T.....DGEY...........MLLGAD.IKRQhplyrhiafvfqnpe
gi|56421530|ref|YP_148848.1|  PNGTGKSTLASAIMGHPkyEVT.....EGSV...........TLDGQD.VLEMevderaraglflamq
gi|56421861|ref|YP_149179.1|  ---EGKSTTAANLAVVF..AQQ.....GKKT...........LLIDAD.LRKP...............
gi|56419849|ref|YP_147167.1|  NPGTGKTTVARLLGKLF..F--.....EMNV...........LSKGHF.IEAE...............
gi|56419705|ref|YP_147023.1|  VTGSGKTEVYMQAIDEA..LRQ.....-GKEaiv........LVPEIS.LTPQ...............
gi|56421915|ref|YP_149233.1|  -----------------..---.....----...........------.----...............
gi|56418560|ref|YP_145878.1|  -----------------..---.....----...........------.----...............
gi|56419721|ref|YP_147039.1|  ------S----------..---.....----...........------.----...............
gi|56420639|ref|YP_147957.1|  -----------------..---.....----...........------.----...............
gi|56420018|ref|YP_147336.1|  NPNTGKSTLFNVLTGLR..QHT.....----...........------.----...............
gi|56418949|ref|YP_146267.1|  LSGSGKSTVANAVSRRL..FEL.....GIQN...........YVLDGD.NIRHglnkdlgfsaadrte
gi|56410473|ref|YP_145847.1|  --GCGKSTTTGVLAYLL..SRD.....GYRV...........LAVDMD.SQGNltellsrkpsnefte
gi|56421823|ref|YP_149141.1|  PPGCGKSLLAETFPTIL..P--.....----...........------.----...............
gi|56419482|ref|YP_146800.1|  LVGAGKTELAESLIAHR..N-T.....SGEW...........EIDGRR.YVFSspyeaidaglclipe
gi|56421184|ref|YP_148502.1|  RSNVGKSSFINKMINRK..NLA.....RTSS...........KPGKTQtLNFY...............
gi|56419257|ref|YP_146575.1|  PNGVGKTTLLHIISGLL..DKG.....ELHYqa.........FYKGNP.IQLPdmrahlsyvtsetvm
gi|56421028|ref|YP_148346.1|  PAGTGKTYLAVVMAVKA..L-K.....NGSVkriiltrpav.E-----.---Ageslgflpgdlkekv
gi|56418714|ref|YP_146032.1|  LSRSGKTTLANQLSQTL..REQ.....GISV...........CVFHMD.DHIVerakryhtgneewfe
gi|56419859|ref|YP_147177.1|  YTNAGKSTIFNRLTA--..---.....----...........------.----...............
gi|56420462|ref|YP_147780.1|  PVGAGKTMLVEKLTRAM..H--.....----...........------.----...............
gi|56421621|ref|YP_148939.1|  -----------------..---.....----...........------.----...............
gi|56420269|ref|YP_147587.1|  PTGSGKTRLAETLSALFgqPMH.....SINC...........------.----...............
gi|56419774|ref|YP_147092.1|  PTGVGKTTTLAKMAGRA..VLE.....QGKKvg.........FITADT.YRIA...............
gi|56420796|ref|YP_148114.1|  -----------------..---.....----...........------.----...............
gi|56420383|ref|YP_147701.1|  NPNTGKTSLFNCLTGSY..EYV.....----...........------.----...............
gi|56419705|ref|YP_147023.1|  -----------------..---.....----...........------.----...............
gi|56421682|ref|YP_149000.1|  -----------------..---.....----...........------.----...............
gi|56420072|ref|YP_147390.1|  -----------------..---.....----...........------.----...............
gi|56418881|ref|YP_146199.1|  -----------------..---.....----...........------.----...............
gi|56420088|ref|YP_147406.1|  HFSAGKSSLINALLGEP..MLP.....SSPI...........------.----...............
gi|56421060|ref|YP_148378.1|  CTNVGKSTFINRIIE--..---.....----...........------.----...............
gi|56420924|ref|YP_148242.1|  ETGAGKSIIIDAIHLLI..GGR.....---Gsaefv......RFGAEK.AEIEglfllddd.......
gi|56420088|ref|YP_147406.1|  AFSAGKSSLANALLGAP..LLP.....SS--...........------.----...............
gi|56421048|ref|YP_148366.1|  -----------------..---.....----...........------.----...............
gi|56419610|ref|YP_146928.1|  KAGTGKTLLALAAGLMQ..TED.....-LRTykkllvarpivP-----.---Mgkdlgflpgekeekl
gi|56419219|ref|YP_146537.1|  PTGSGKSTILDAMTLAL..F--.....-GSV...........ERAANR.TQAI...............
gi|56418583|ref|YP_145901.1|  -----------------..---.....----...........------.----...............
gi|56419416|ref|YP_146734.1|  EPGAGKTFALRALKESL..NPS.....LYHV...........VYFPLS.TGGV...............
gi|56419316|ref|YP_146634.1|  EPGAGKTFALRALKESL..NPS.....LYHV...........VYFPLS.TGGV...............
gi|56420452|ref|YP_147770.1|  EPGAGKTFALRALKESL..NPS.....LYHV...........VYFPLS.TGGV...............
gi|56418692|ref|YP_146010.1|  EPGAGKTFALRAFKESL..NPS.....LYHV...........VYFPLS.TGSV...............
gi|56418885|ref|YP_146203.1|  EPGAGKTFALRAFKESL..NPS.....LYHV...........VYFPLS.TGSV...............
gi|56420238|ref|YP_147556.1|  EPGAGKTFALRAFKESL..NPS.....LYHV...........VYFPLS.TGSV...............
gi|56419917|ref|YP_147235.1|  --GSGKSLSMLFFAGIL..---.....----...........------.----...............
gi|56420711|ref|YP_148029.1|  -----------------..---.....----...........------.----...............
gi|56419088|ref|YP_146406.1|  ESGSGKSTQLRSILTTL..IQY.....Y---...........--DENR.LHIYladlkmsefhifkrc
gi|56419319|ref|YP_146637.1|  SPGTGKTHLATALGIQA..CQQ.....GHEV...........RFFRVA.DLVA...............
gi|56418771|ref|YP_146089.1|  DLGAGKTTFTKGLAEGL..GIT.....Q---...........------.----...............
gi|56419830|ref|YP_147148.1|  PESSGKTTV--------..---.....----...........------.----...............
gi|56420943|ref|YP_148261.1|  SPQTGKTTLLRDAARLI..--S.....SGTR...........RIPAQK.VAIVde.............
gi|56420079|ref|YP_147397.1|  -----------------..---.....----...........------.----...............
gi|56419847|ref|YP_147165.1|  PTAVGKTKL----GIAL..AKK.....LGGE...........VISGDS.MQIYkgmdigtakvkpdem
gi|56420591|ref|YP_147909.1|  FMGAGKTTIGQLVAKKL..YRD.....FIDV...........------.----...............
gi|56421256|ref|YP_148574.1|  SFGVGKTYLLAAIANEL..AKR.....NVSS...........LIVYVP.ELFR...............
gi|56421803|ref|YP_149121.1|  PQASGKSTISKLIFFFQ..S--.....----...........-IPDEW.VNYLlsvrqteennpffef
gi|56419913|ref|YP_147231.1|  ISGTGKTKIVQWLAESV..---.....----...........------.----...............
gi|56419308|ref|YP_146626.1|  YKHSGKTTLME------..---.....----...........------.----...............
gi|56418881|ref|YP_146199.1|  -----------------..---.....----...........------.----...............
gi|56420752|ref|YP_148070.1|  AVRTGKSTFIKRFMELV..VI-.....----...........------.----...............
gi|56419021|ref|YP_146339.1|  PVGGGKSTLVTLLKRG-..---.....----...........------.----...............
gi|56419420|ref|YP_146738.1|  RNYAGKTTFSRIIRSLE..LGK.....PHKD...........FNNGKF.IITLddgkqiteldl....
gi|56421601|ref|YP_148919.1|  MSGAGKTVAIQ------..---.....----...........------.----...............
gi|56418742|ref|YP_146060.1|  -----------------..---.....----...........------.----...............
gi|56420793|ref|YP_148111.1|  -----------------..---.....----...........P-----.----...............
gi|56418854|ref|YP_146172.1|  SNGAGKSVTMQSLIPVL..L--.....----...........--DGKK.TPDR...............
gi|56419917|ref|YP_147235.1|  -----------------..---.....----...........------.----...............
gi|56419847|ref|YP_147165.1|  PTAVGKTKL----GIAL..AKK.....LGGE...........VISGDS.MQIYkgmdigtakvkpdem
gi|56419216|ref|YP_146534.1|  RSGSGKTAV--------..---.....----...........------.----...............
gi|56419674|ref|YP_146992.1|  ----------KALAGFH..PID.....EGEI...........HFDEQA.AKGKrnktvffvipenyhq
gi|56421780|ref|YP_149098.1|  -----------------..---.....----...........------.----...............


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  svvvvatsdqpalm......................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  tflfagtirdnirygrleatdeeveeaarqa.....................................
gi|56420904|ref|YP_148222.1|  la..................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  svrlvkerkmnevkdraeqqankrlvellvpgkpkqtiknplellfggqgaqadnsyshedeqveqkr
gi|56419871|ref|YP_147189.1|  pflfygtvkenirmynqelddeaikeaarlv.....................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  fqhfnllwsrtvreniafpleiagvpkeernk....................................
gi|56420545|ref|YP_147863.1|  lfphmtvyenldfglslrkvpkeerrk.........................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  hflfsasirdniafakpeagedevvraarlad....................................
gi|56419166|ref|YP_146484.1|  lyphmsvydnmafglklrkfpkaeidk.........................................
gi|56419258|ref|YP_146576.1|  lfphldvfenvafglrvkkmkeadirq.........................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  qhfnlyphmtvlqnitlaprkvlgmsekeane....................................
gi|56421990|ref|YP_149308.1|  qrfnlfphmtvlnnitlapmkvrkwprekaea....................................
gi|56418849|ref|YP_146167.1|  iglfphmtiaenialvpklkkwekhayek.......................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  vllfsgtvadnlrfgkmtatmeeivqaarda.....................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ifqdpyaslnprmtvadiiaegidihglaktkeermq...............................
gi|56419349|ref|YP_146667.1|  ifqdpmtslnptmtigkqimeailkhqklskdeark................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  fqdfkllpklnvyenvafalevieespkvirk....................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ifqeyhlldtltvkenvllplsitktpkreaek...................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  fvkyelkltenvgfgditridrdgelkqamerarvn................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  pdnqfvgatveddiafalenngiprlemve......................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  nirlfgelsvldnvkvayhaharhsiassilrlpshfrgekemee.......................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  tthlfeqatvidnviighrlrtssnlfdailrtkrhrreeqacke.......................
gi|56421558|ref|YP_148876.1|  nlqlfsdmtvlenvmvgfhsrlksgilsagfrlprtvkeerqaqk.......................
gi|56420799|ref|YP_148117.1|  aeaapgytvretvalgryahqrglfptwtkedea..................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  svdetlsatenlmifsrllglsrtearr........................................
gi|56421511|ref|YP_148829.1|  grrvfanmtveenlelgaflrkdkegiqq.......................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  qqdylfpwktieenillglkitdtltadtke.....................................
gi|56419996|ref|YP_147314.1|  pmapegltvlqlvkqgrypyqtwfkqwsdeder...................................
gi|56421148|ref|YP_148466.1|  lvdvvegrctvqkalvkdkrfdnhlyllpaaqtsdksavnpaqmkqlieelkqeydyvlidcpagieq
gi|56418847|ref|YP_146165.1|  gnltahenllvhakllhlpes...............................................
gi|56420198|ref|YP_147516.1|  grklfprmsvyenllmgayvhrkdkegirr......................................
gi|56418729|ref|YP_146047.1|  peatsgltvaelvsygrfpyqrgwgrltkqdye...................................
gi|56420178|ref|YP_147496.1|  emypyltgwenlehfarmmpgigad...........................................
gi|56419819|ref|YP_147137.1|  hfmlvdtftvteniilgseptragtidmkraer...................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  spsifpfltvwenmelamrqdrrlrsvlrakrtgeeee..............................
gi|56419007|ref|YP_146325.1|  sqlwwdiavqesfrllkkvyrvsdeqyrr.......................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  fnrsfpatveevaasglaakrglfrplthedrr...................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  rmseatglpaa.........................................................
gi|56421557|ref|YP_148875.1|  rrqifdslsvrdnlllgayrrhrrdgqevkr.....................................
gi|56420989|ref|YP_148307.1|  qkpnpfpksiydnvaygprihgirdrrrldeivek.................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  pklkvqeqllylgrlrgmkktdilp...........................................
gi|56420468|ref|YP_147786.1|  greifsaltveenillgleaqaenvrpqp.......................................
gi|56421763|ref|YP_149081.1|  elnviptltvaeniflgrepkigrtgvirykemeq.................................
gi|56418671|ref|YP_145989.1|  vfqfpehqlfeetvekdicfgplnfgvpedeakr..................................
gi|56419272|ref|YP_146590.1|  dnsysyltvlenllyfgllnkwsraeakr.......................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  sqliwdippmetflvnkaiydiddrafrq.......................................
gi|56420415|ref|YP_147733.1|  elavveemtvaenlflghelmrgkyidwnrlys...................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  vlyeeltleehlrlaamayglseaeyer........................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  fmmypeltmyevlehlavlqgehpaacrs.......................................
gi|56419677|ref|YP_146995.1|  fmmypeltmyevlehlavlqgehpaacrs.......................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  elspvpnmtvaeniflgrepsypfagwvkmkelvk.................................
gi|56420896|ref|YP_148214.1|  fmvypnitveealdhlallqgmmdkgerha......................................
gi|56420444|ref|YP_147762.1|  elalipylsiaeniflgnerakrgiinwnetia...................................
gi|56420563|ref|YP_147881.1|  pmagtapnmtieenlamaytrnqkrtlrrgvtkkrrddf.............................
gi|56421620|ref|YP_148938.1|  igrtprsnpatytgvfddirdvfastneakvrgykkgrfsfnvkggrceachgdgiikiemhflpdvy
gi|56420212|ref|YP_147530.1|  ldqfydtlqaetvedivisgkfatiglydavteddrs...............................
gi|56419206|ref|YP_146524.1|  pmagtaphmtieenlalaynrtkrrtlslgvtkqkre...............................
gi|56420341|ref|YP_147659.1|  qnpehqilaplvrdelaislvhagidrekmge....................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  evdtalfpglpiyenvaadefvhvkqrpirslrqeke...............................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  yvlaeadleyivaavetvqpacv.............................................
gi|56418826|ref|YP_146144.1|  fleqysgfdnlhflamiqnkiger............................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  drkltglflplsvednmitvtvnqytkagflqqrkire..............................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ffphatirqmadfyeqlypsfsrg............................................
gi|56419155|ref|YP_146473.1|  mpyadeeiafalenrsvprhempv............................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  drhkhglvldfpigenmvlqtyyqppyskrgllnfqaiye............................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  emlevftpllglekqlaelsmqlgdpdvladparyektlktydelqeqykeqggyqyea.........
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  delwdaypektek.......................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  drkqkglilemsvhenltlpkleqlatagfiqsskerd..............................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  drkkyglvlemdiiknstlvalkkvtkwnvidhalevk..............................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  drkgnglilmedirknitlsrlgkisnhfvvdenqeiv..............................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  gsltlelliskkgkkarcnhieqqrlsqyvghlnvvmfapedlnlvkgspqvrrrfvdmeigqvspvy
gi|56419950|ref|YP_147268.1|  aprrsvhiaklgeiqtenakgiaev...........................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  wqfvahsvreelayslrlegrpkeeieg........................................
gi|56421530|ref|YP_148848.1|  ypseisgvtnadflraainarlgegneislmkfir.................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  nirrigevaklfvdsgq...................................................
gi|56410473|ref|YP_145847.1|  ksvleamqerdpepyiv...................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  errkqglflpesvktnltvrllsrlsrwqwiswakeaa..............................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  fskltgyeniecfrllwkldqqyvr...........................................
gi|56421028|ref|YP_148346.1|  dpylr...............................................................
gi|56418714|ref|YP_146032.1|  yyylqwdvew..........................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  rpwmqp..............................................................
gi|56419219|ref|YP_146537.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  rqvksicttpeqiermlariqsemkrrskllnekevahindlpeaerppyilv...............
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  egiphhll............................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  nkrlrrkfvgyfgttkhmkpfhiryeydvekfvrldlkdgyvqihfsdplkreiqenfkhvvqmkkem
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  ....................................................................
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  egiphhlldikepcepfsvvefqrlcral.......................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  lwrnyrlqdisiwlnr....................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  rqvawqlangqlenemvtieieeqtp..........................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  gyrnavagadeaivvttpevs...............................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  vpcevchgkrynretlevtykgkniaevldmtvedaldffasipkik.....................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ihdlsqyqkllqqrnhylkmmqarersdeavldvlteqlvllaakitlrrrqflslleqwampihyei
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  qyeeqqlddfwnvsswkvrqqnvlekvkaaitevfgdsktpifipagrslvatlsdqlqdinpqqldv
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  ....................................................................
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         .......................................................P............
gi|56418810|ref|YP_146128.1|  .......................................................-............
gi|56422010|ref|YP_149328.1|  .......................................................-............
gi|56421621|ref|YP_148939.1|  .......................................................-............
gi|56421924|ref|YP_149242.1|  .......................................................-............
gi|56419217|ref|YP_146535.1|  .......................................................-............
gi|56418638|ref|YP_145956.1|  .......................................................-............
gi|56421164|ref|YP_148482.1|  .......................................................P............
gi|56419334|ref|YP_146652.1|  .......................................................-............
gi|56421895|ref|YP_149213.1|  .......................................................-............
gi|56419757|ref|YP_147075.1|  .......................................................R............
gi|56421893|ref|YP_149211.1|  .......................................................-............
gi|56420166|ref|YP_147484.1|  .......................................................N............
gi|56420904|ref|YP_148222.1|  .......................................................R............
gi|56418583|ref|YP_145901.1|  .......................................................-............
gi|56419749|ref|YP_147067.1|  .......................................................L............
gi|56419871|ref|YP_147189.1|  .......................................................Q............
gi|56422018|ref|YP_149336.1|  .......................................................-............
gi|56421534|ref|YP_148852.1|  .......................................................R............
gi|56420545|ref|YP_147863.1|  .......................................................R............
gi|56418613|ref|YP_145931.1|  .......................................................D............
gi|56419870|ref|YP_147188.1|  .......................................................I............
gi|56419166|ref|YP_146484.1|  .......................................................R............
gi|56419258|ref|YP_146576.1|  .......................................................K............
gi|56421642|ref|YP_148960.1|  .......................................................-............
gi|56420511|ref|YP_147829.1|  .......................................................I............
gi|56421990|ref|YP_149308.1|  .......................................................K............
gi|56418849|ref|YP_146167.1|  .......................................................R............
gi|56419334|ref|YP_146652.1|  .......................................................D............
gi|56420165|ref|YP_147483.1|  .......................................................Q............
gi|56421187|ref|YP_148505.1|  .......................................................-............
gi|56419918|ref|YP_147236.1|  .......................................................-............
gi|56418613|ref|YP_145931.1|  .......................................................-............
gi|56421705|ref|YP_149023.1|  .......................................................-............
gi|56418761|ref|YP_146079.1|  .......................................................-............
gi|56418597|ref|YP_145915.1|  .......................................................D............
gi|56419350|ref|YP_146668.1|  .......................................................R............
gi|56419349|ref|YP_146667.1|  .......................................................R............
gi|56420488|ref|YP_147806.1|  .......................................................-............
gi|56422025|ref|YP_149343.1|  .......................................................-............
gi|56421636|ref|YP_148954.1|  .......................................................K............
gi|56419244|ref|YP_146562.1|  .......................................................-............
gi|56420756|ref|YP_148074.1|  .......................................................R............
gi|56420970|ref|YP_148288.1|  .......................................................Q............
gi|56421163|ref|YP_148481.1|  .......................................................L............
gi|56419702|ref|YP_147020.1|  .......................................................-............
gi|56419503|ref|YP_146821.1|  .......................................................D............
gi|56420918|ref|YP_148236.1|  .......................................................-............
gi|56420877|ref|YP_148195.1|  .......................................................K............
gi|56419264|ref|YP_146582.1|  .......................................................-............
gi|56418731|ref|YP_146049.1|  .......................................................-............
gi|56421917|ref|YP_149235.1|  .......................................................-............
gi|56418838|ref|YP_146156.1|  .......................................................F............
gi|56419503|ref|YP_146821.1|  .......................................................D............
gi|56418670|ref|YP_145988.1|  .......................................................R............
gi|56421797|ref|YP_149115.1|  .......................................................-............
gi|56421512|ref|YP_148830.1|  .......................................................K............
gi|56419841|ref|YP_147159.1|  .......................................................I............
gi|56420197|ref|YP_147515.1|  .......................................................K............
gi|56421558|ref|YP_148876.1|  .......................................................Q............
gi|56420799|ref|YP_148117.1|  .......................................................A............
gi|56420924|ref|YP_148242.1|  .......................................................-............
gi|56421010|ref|YP_148328.1|  .......................................................-............
gi|56419920|ref|YP_147238.1|  .......................................................-............
gi|56418639|ref|YP_145957.1|  .......................................................-............
gi|56418583|ref|YP_145901.1|  .......................................................-............
gi|56419445|ref|YP_146763.1|  .......................................................K............
gi|56421511|ref|YP_148829.1|  .......................................................D............
gi|56419731|ref|YP_147049.1|  .......................................................A............
gi|56419721|ref|YP_147039.1|  .......................................................H............
gi|56421391|ref|YP_148709.1|  .......................................................R............
gi|56419996|ref|YP_147314.1|  .......................................................A............
gi|56421148|ref|YP_148466.1|  .......................................................A............
gi|56418847|ref|YP_146165.1|  .......................................................R............
gi|56420198|ref|YP_147516.1|  .......................................................S............
gi|56418729|ref|YP_146047.1|  .......................................................A............
gi|56420178|ref|YP_147496.1|  .......................................................R............
gi|56419819|ref|YP_147137.1|  .......................................................E............
gi|56419216|ref|YP_146534.1|  .......................................................-............
gi|56420469|ref|YP_147787.1|  .......................................................I............
gi|56419007|ref|YP_146325.1|  .......................................................H............
gi|56421926|ref|YP_149244.1|  .......................................................-............
gi|56418552|ref|YP_145870.1|  .......................................................-............
gi|56421006|ref|YP_148324.1|  .......................................................A............
gi|56419712|ref|YP_147030.1|  .......................................................-............
gi|56421096|ref|YP_148414.1|  .......................................................T............
gi|56421557|ref|YP_148875.1|  .......................................................D............
gi|56420989|ref|YP_148307.1|  .......................................................S............
gi|56421797|ref|YP_149115.1|  .......................................................-............
gi|56419179|ref|YP_146497.1|  .......................................................E............
gi|56420468|ref|YP_147786.1|  .......................................................I............
gi|56421763|ref|YP_149081.1|  .......................................................Q............
gi|56418671|ref|YP_145989.1|  .......................................................K............
gi|56419272|ref|YP_146590.1|  .......................................................R............
gi|56421043|ref|YP_148361.1|  .......................................................-............
gi|56420022|ref|YP_147340.1|  .......................................................T............
gi|56420415|ref|YP_147733.1|  .......................................................E............
gi|56420326|ref|YP_147644.1|  .......................................................-............
gi|56419193|ref|YP_146511.1|  .......................................................R............
gi|56418559|ref|YP_145877.1|  .......................................................I............
gi|56422011|ref|YP_149329.1|  .......................................................-............
gi|56419728|ref|YP_147046.1|  .......................................................Fagsesrkplnva
gi|56421642|ref|YP_148960.1|  .......................................................-............
gi|56420899|ref|YP_148217.1|  .......................................................K............
gi|56419677|ref|YP_146995.1|  .......................................................K............
gi|56421126|ref|YP_148444.1|  .......................................................-............
gi|56421185|ref|YP_148503.1|  .......................................................I............
gi|56420429|ref|YP_147747.1|  .......................................................K............
gi|56420896|ref|YP_148214.1|  .......................................................A............
gi|56420444|ref|YP_147762.1|  .......................................................Q............
gi|56420563|ref|YP_147881.1|  .......................................................R............
gi|56421620|ref|YP_148938.1|  .......................................................R............
gi|56420212|ref|YP_147530.1|  .......................................................K............
gi|56419206|ref|YP_146524.1|  .......................................................W............
gi|56420341|ref|YP_147659.1|  .......................................................A............
gi|56419798|ref|YP_147116.1|  .......................................................-............
gi|56420778|ref|YP_148096.1|  .......................................................-............
gi|56419605|ref|YP_146923.1|  .......................................................-............
gi|56419482|ref|YP_146800.1|  .......................................................R............
gi|56420961|ref|YP_148279.1|  .......................................................-............
gi|56421023|ref|YP_148341.1|  .......................................................-............
gi|56420330|ref|YP_147648.1|  .......................................................-............
gi|56421141|ref|YP_148459.1|  .......................................................-............
gi|56419729|ref|YP_147047.1|  .......................................................-............
gi|56418720|ref|YP_146038.1|  .......................................................-............
gi|56420762|ref|YP_148080.1|  .......................................................-............
gi|56418614|ref|YP_145932.1|  .......................................................I............
gi|56418826|ref|YP_146144.1|  .......................................................E............
gi|56421083|ref|YP_148401.1|  .......................................................-............
gi|56419816|ref|YP_147134.1|  .......................................................-............
gi|56420429|ref|YP_147747.1|  .......................................................D............
gi|56421186|ref|YP_148504.1|  .......................................................-............
gi|56418583|ref|YP_145901.1|  .......................................................-............
gi|56420156|ref|YP_147474.1|  .......................................................R............
gi|56419155|ref|YP_146473.1|  .......................................................R............
gi|56419739|ref|YP_147057.1|  .......................................................-............
gi|56419819|ref|YP_147137.1|  .......................................................K............
gi|56421620|ref|YP_148938.1|  .......................................................Rqflgqmekpdvd
gi|56418775|ref|YP_146093.1|  .......................................................D............
gi|56418536|ref|YP_145854.1|  .......................................................-............
gi|56418775|ref|YP_146093.1|  .......................................................E............
gi|56422029|ref|YP_149347.1|  .......................................................-............
gi|56421705|ref|YP_149023.1|  .......................................................-............
gi|56421351|ref|YP_148669.1|  .......................................................-............
gi|56421763|ref|YP_149081.1|  .......................................................V............
gi|56421102|ref|YP_148420.1|  .......................................................-............
gi|56420331|ref|YP_147649.1|  .......................................................-............
gi|56418678|ref|YP_145996.1|  .......................................................-............
gi|56420415|ref|YP_147733.1|  .......................................................Q............
gi|56420756|ref|YP_148074.1|  .......................................................-............
gi|56421228|ref|YP_148546.1|  .......................................................V............
gi|56419775|ref|YP_147093.1|  .......................................................-............
gi|56421552|ref|YP_148870.1|  .......................................................-............
gi|56420444|ref|YP_147762.1|  .......................................................E............
gi|56418786|ref|YP_146104.1|  .......................................................-............
gi|56418662|ref|YP_145980.1|  .......................................................-............
gi|56421262|ref|YP_148580.1|  .......................................................-............
gi|56420961|ref|YP_148279.1|  .......................................................-............
gi|56418539|ref|YP_145857.1|  ....srgaeqlciryepsvdvsekaelsriveaysetfaamrerevqrgttlvgpH............
gi|56419950|ref|YP_147268.1|  .......................................................A............
gi|56420072|ref|YP_147390.1|  .......................................................-............
gi|56419155|ref|YP_146473.1|  .......................................................I............
gi|56421530|ref|YP_148848.1|  .......................................................K............
gi|56421861|ref|YP_149179.1|  .......................................................T............
gi|56419849|ref|YP_147167.1|  .......................................................R............
gi|56419705|ref|YP_147023.1|  .......................................................M............
gi|56421915|ref|YP_149233.1|  .......................................................-............
gi|56418560|ref|YP_145878.1|  .......................................................-............
gi|56419721|ref|YP_147039.1|  .......................................................-............
gi|56420639|ref|YP_147957.1|  .......................................................-............
gi|56420018|ref|YP_147336.1|  .......................................................-............
gi|56418949|ref|YP_146267.1|  .......................................................F............
gi|56410473|ref|YP_145847.1|  .......................................................K............
gi|56421823|ref|YP_149141.1|  .......................................................-............
gi|56419482|ref|YP_146800.1|  .......................................................E............
gi|56421184|ref|YP_148502.1|  .......................................................L............
gi|56419257|ref|YP_146575.1|  .......................................................K............
gi|56421028|ref|YP_148346.1|  .......................................................P............
gi|56418714|ref|YP_146032.1|  .......................................................L............
gi|56419859|ref|YP_147177.1|  .......................................................-............
gi|56420462|ref|YP_147780.1|  .......................................................-............
gi|56421621|ref|YP_148939.1|  .......................................................-............
gi|56420269|ref|YP_147587.1|  .......................................................-............
gi|56419774|ref|YP_147092.1|  .......................................................A............
gi|56420796|ref|YP_148114.1|  .......................................................-............
gi|56420383|ref|YP_147701.1|  .......................................................-............
gi|56419705|ref|YP_147023.1|  .......................................................-............
gi|56421682|ref|YP_149000.1|  .......................................................-............
gi|56420072|ref|YP_147390.1|  .......................................................-............
gi|56418881|ref|YP_146199.1|  .......................................................-............
gi|56420088|ref|YP_147406.1|  .......................................................-............
gi|56421060|ref|YP_148378.1|  .......................................................-............
gi|56420924|ref|YP_148242.1|  .......................................................Rhpcwqkcadvgi
gi|56420088|ref|YP_147406.1|  .......................................................-............
gi|56421048|ref|YP_148366.1|  .......................................................-............
gi|56419610|ref|YP_146928.1|  .......................................................I............
gi|56419219|ref|YP_146537.1|  .......................................................Inhaeqelfvsft
gi|56418583|ref|YP_145901.1|  .......................................................-............
gi|56419416|ref|YP_146734.1|  .......................................................M............
gi|56419316|ref|YP_146634.1|  .......................................................M............
gi|56420452|ref|YP_147770.1|  .......................................................M............
gi|56418692|ref|YP_146010.1|  .......................................................M............
gi|56418885|ref|YP_146203.1|  .......................................................M............
gi|56420238|ref|YP_147556.1|  .......................................................M............
gi|56419917|ref|YP_147235.1|  .......................................................-............
gi|56420711|ref|YP_148029.1|  .......................................................-............
gi|56419088|ref|YP_146406.1|  .......................................................C............
gi|56419319|ref|YP_146637.1|  .......................................................Q............
gi|56418771|ref|YP_146089.1|  .......................................................-............
gi|56419830|ref|YP_147148.1|  .......................................................-............
gi|56420943|ref|YP_148261.1|  .......................................................R............
gi|56420079|ref|YP_147397.1|  .......................................................-............
gi|56419847|ref|YP_147165.1|  .......................................................D............
gi|56420591|ref|YP_147909.1|  .......................................................-............
gi|56421256|ref|YP_148574.1|  .......................................................E............
gi|56421803|ref|YP_149121.1|  lteqfierinllkkmfshsfeeiiedrkkfstekidfeairlaikmiegvmkgkyM............
gi|56419913|ref|YP_147231.1|  .......................................................-............
gi|56419308|ref|YP_146626.1|  .......................................................-............
gi|56418881|ref|YP_146199.1|  .......................................................-............
gi|56420752|ref|YP_148070.1|  .......................................................-............
gi|56419021|ref|YP_146339.1|  .......................................................-............
gi|56419420|ref|YP_146738.1|  .......................................................Ddgpynirvynad
gi|56421601|ref|YP_148919.1|  .......................................................-............
gi|56418742|ref|YP_146060.1|  .......................................................-............
gi|56420793|ref|YP_148111.1|  .......................................................-............
gi|56418854|ref|YP_146172.1|  .......................................................Ldpfgsrarrmed
gi|56419917|ref|YP_147235.1|  .......................................................-............
gi|56419847|ref|YP_147165.1|  .......................................................I............
gi|56419216|ref|YP_146534.1|  .......................................................-............
gi|56419674|ref|YP_146992.1|  .......................................................P............
gi|56421780|ref|YP_149098.1|  .......................................................-............


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  evtitldnedgflpleyqevsvtrrvyrsgeseffinrqpcrlkdivdlfldsglgkeafsiigqgrv
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  aieglspaisidqkttsrnprstvgtvteiydylrllfarigrpicpthgieiqsqtieqmvdrllay
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  dasdgmivlrrdifangksvcringklvttavlrdigatlvdihgqhehqelmdpsrhlplldefggl
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  felenaagakrytverslkkvdewrtrsavcrliehrsepvvladklsevdkaieqllgltmedftra
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  fkkdnlsflydengeilpfailgeenieiqykieqeekkiqeireklynpdhgvhkkyndnrkfldkl
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  yllgekdvvnrdertgylfleykrkesdqyvttgiglrakrqksldfwgfvlfdnrrigydlqlykqe
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  eeilsskpeerrtifeeaagvlkyklrkkkaeaklaetqdnlhrvndilheleqqleplrmqaslake
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  pertkmqilapivsgkkgthaktledirkqgyvrvridgemreltedieleknkkhsidvvvdriiik
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  eaaealaryravyeryeelgnklkklseneqqmahrldlltfqlreieqaalepgederlmeekvriv
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  vvlpqgkfaeflslkgserrqmlqrlfhlerygdqlnkklkdrlaaarqewekieaekaglgdaskaa
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  ekelskilrekasqirnnpnlflanqkkqydirdieqeipfanssleeqekkelentikenikeivpr
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  ktgekipltkrelatalgaggtvvetqkdymelvnkhvfrfesleafqelielliqlrspklskdfkp
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  flekreelerfevalmvhdieqlrgqwnelkealdghqrdevalaaalqkmeaqieqlrdqmtaides
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  dgiaarladsletalkladgkvvvdvigegellfsekhacpycgfsigeleprlfsfnspfgacpdcd
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  nfqkiytalqksyealsgegrgldsigeamrhlddvagmdaalkdahettancyylleevmyklrdqi
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  leqaeadvrelaglfakrkkeleeveadvertkqrwawqqekeaveqelaalrqhesaireleakker
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  cskldfdymelidkailllsmslkpskiieslannndlqewvregiglhkgileecafcgnkidvsrw
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  tviyeilesslppltddelrhlsdtienmdqakqqleqlerderalkrlcdqyrlyneymiaekatey
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  idglqqvlllaseeleklegrkevlkerkkhaarrkaqldditaalaakrrrlteqlhaereelarle
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  glgaklevdldlvipndeltlkehaiapwepqssqyypqlleavcrhygipmdvpvrdlpkeqldkil
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  eemeydperldaiesrlaeigqlkrkygatiadilhyaetiaeeietienrethvhelkqqlalvtde
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  aeqaeriwpyweqceqacrlraeafrryeglarrleeaqlsyeeaarryerarqekaqrepellvqme
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  eeldrhftreveeftenleklmdkikekkeyilnyqlpfdkysfysifeedyhliereldllqeeavs
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  vkavkqaeqlaaaqhrlhdeeeqarktldeldesitrlrreedvlrsreidlaghevfqqaekyeqlk
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  agaaalerelkekqalfsaheadieeeierrkgdyidlvheqaalknerahveqalgklhakrtalde
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ygsggepiyfrytndfgqvreqyiafegvipnverryretssdyireqmekymaeqpcptcqgyrlkk
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  llteaknvtavrqtyarrlierihqelkdlymdktkfdivfakregsldaplvdgvpvrfqedgid..
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  rlrqaaqleqqmevlgqelaalreerkrliaqekaaarrfeeasvwyergakrqrelkeelkqheeal
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  eldevyrvlgerrknlfspsnmlrkdgdinlkankllskintlinknneytlkytekqnearkklryd
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  sererlqerwerheqtiaekerlerqhrrrldesearlddlerkledelaqlradaeegafslhetne
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  anrrhlaereqleqkraalwaeqtrleqalteahnrqaalaaalaaqkteleqheallhqarqyrqqt
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  eslavlvggkhigevtamsvtealaffdgleltekeaqiarlilreird...................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  dgkdeaerayrqkqhieqaasaiarvdaqlqqkeavwrrakeeklererrsaavgsrlqelfrrvert
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  eiyrfkklinyeekkaaienqrnllqeinnekeklekiekesllkkaeleaslkdeknavklvnnylk
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  ddfhrhrqkqqefsfaawkqeadrhieqleelarlwrrhddvkrryeeasteagerrremdewrhqqq
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  karqqwleemqhdysgfvqgvkevlkardllpgihgaivelirvpdryetaietalggamqhivvdse
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  yrfvcwrqqdaekqlytlqktmeaerqraeeartaqlasalaerlrpgepcpvcgsrehphpaaaphd
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  sflghpelyldieeeg....................................................
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  kweelleqekerfeqavlawveqggidvseadiqaflrqmgalyelyslddlkrpfvqayydavgkkk
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  qaarqaihylktngygratflpldviqaralsereraaidrhpafvgiaselveydrayraaiahllg
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56421351|ref|YP_148669.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56421102|ref|YP_148420.1|  ....................................................................
gi|56420331|ref|YP_147649.1|  ....................................................................
gi|56418678|ref|YP_145996.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56421228|ref|YP_148546.1|  ....................................................................
gi|56419775|ref|YP_147093.1|  ....................................................................
gi|56421552|ref|YP_148870.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56418786|ref|YP_146104.1|  ....................................................................
gi|56418662|ref|YP_145980.1|  ....................................................................
gi|56421262|ref|YP_148580.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56418539|ref|YP_145857.1|  ....................................................................
gi|56419950|ref|YP_147268.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56421530|ref|YP_148848.1|  ....................................................................
gi|56421861|ref|YP_149179.1|  ....................................................................
gi|56419849|ref|YP_147167.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421915|ref|YP_149233.1|  ....................................................................
gi|56418560|ref|YP_145878.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56420639|ref|YP_147957.1|  ....................................................................
gi|56420018|ref|YP_147336.1|  ....................................................................
gi|56418949|ref|YP_146267.1|  ....................................................................
gi|56410473|ref|YP_145847.1|  ....................................................................
gi|56421823|ref|YP_149141.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56421184|ref|YP_148502.1|  ....................................................................
gi|56419257|ref|YP_146575.1|  ....................................................................
gi|56421028|ref|YP_148346.1|  ....................................................................
gi|56418714|ref|YP_146032.1|  ....................................................................
gi|56419859|ref|YP_147177.1|  ....................................................................
gi|56420462|ref|YP_147780.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56420269|ref|YP_147587.1|  ....................................................................
gi|56419774|ref|YP_147092.1|  ....................................................................
gi|56420796|ref|YP_148114.1|  ....................................................................
gi|56420383|ref|YP_147701.1|  ....................................................................
gi|56419705|ref|YP_147023.1|  ....................................................................
gi|56421682|ref|YP_149000.1|  ....................................................................
gi|56420072|ref|YP_147390.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421060|ref|YP_148378.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56420088|ref|YP_147406.1|  ....................................................................
gi|56421048|ref|YP_148366.1|  ....................................................................
gi|56419610|ref|YP_146928.1|  ....................................................................
gi|56419219|ref|YP_146537.1|  vqlerlseleaerqryeqdwqmiisfkaqleqlaelaagheappvfaesrsveevvdltvevralaqd
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419416|ref|YP_146734.1|  ....................................................................
gi|56419316|ref|YP_146634.1|  ....................................................................
gi|56420452|ref|YP_147770.1|  ....................................................................
gi|56418692|ref|YP_146010.1|  ....................................................................
gi|56418885|ref|YP_146203.1|  ....................................................................
gi|56420238|ref|YP_147556.1|  ....................................................................
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56420711|ref|YP_148029.1|  ....................................................................
gi|56419088|ref|YP_146406.1|  ....................................................................
gi|56419319|ref|YP_146637.1|  ....................................................................
gi|56418771|ref|YP_146089.1|  ....................................................................
gi|56419830|ref|YP_147148.1|  ....................................................................
gi|56420943|ref|YP_148261.1|  ....................................................................
gi|56420079|ref|YP_147397.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56420591|ref|YP_147909.1|  ....................................................................
gi|56421256|ref|YP_148574.1|  ....................................................................
gi|56421803|ref|YP_149121.1|  ....................................................................
gi|56419913|ref|YP_147231.1|  ....................................................................
gi|56419308|ref|YP_146626.1|  ....................................................................
gi|56418881|ref|YP_146199.1|  ....................................................................
gi|56420752|ref|YP_148070.1|  ....................................................................
gi|56419021|ref|YP_146339.1|  ....................................................................
gi|56419420|ref|YP_146738.1|  ....................................................................
gi|56421601|ref|YP_148919.1|  ....................................................................
gi|56418742|ref|YP_146060.1|  ....................................................................
gi|56420793|ref|YP_148111.1|  ....................................................................
gi|56418854|ref|YP_146172.1|  dekwrlehdirlleekraereaelrqwreqrdpeperdeqttaarlaleregipfvpfyaavefvddv
gi|56419917|ref|YP_147235.1|  ....................................................................
gi|56419847|ref|YP_147165.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56419674|ref|YP_146992.1|  ....................................................................
gi|56421780|ref|YP_149098.1|  ....................................................................


                                                                                                    
                                                                                                    
d1e3ma2                         ....................................................................
gi|56418810|ref|YP_146128.1|  ....................................................................
gi|56422010|ref|YP_149328.1|  ....................................................................
gi|56421621|ref|YP_148939.1|  ....................................................................
gi|56421924|ref|YP_149242.1|  ....................................................................
gi|56419217|ref|YP_146535.1|  ....................................................................
gi|56418638|ref|YP_145956.1|  ....................................................................
gi|56421164|ref|YP_148482.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56421895|ref|YP_149213.1|  ....................................................................
gi|56419757|ref|YP_147075.1|  ....................................................................
gi|56421893|ref|YP_149211.1|  ....................................................................
gi|56420166|ref|YP_147484.1|  ....................................................................
gi|56420904|ref|YP_148222.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419749|ref|YP_147067.1|  ....................................................................
gi|56419871|ref|YP_147189.1|  ....................................................................
gi|56422018|ref|YP_149336.1|  ....................................................................
gi|56421534|ref|YP_148852.1|  ....................................................................
gi|56420545|ref|YP_147863.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56419870|ref|YP_147188.1|  ....................................................................
gi|56419166|ref|YP_146484.1|  ....................................................................
gi|56419258|ref|YP_146576.1|  ....................................................................
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420511|ref|YP_147829.1|  ....................................................................
gi|56421990|ref|YP_149308.1|  ....................................................................
gi|56418849|ref|YP_146167.1|  ....................................................................
gi|56419334|ref|YP_146652.1|  ....................................................................
gi|56420165|ref|YP_147483.1|  ....................................................................
gi|56421187|ref|YP_148505.1|  ....................................................................
gi|56419918|ref|YP_147236.1|  ....................................................................
gi|56418613|ref|YP_145931.1|  ....................................................................
gi|56421705|ref|YP_149023.1|  ....................................................................
gi|56418761|ref|YP_146079.1|  ....................................................................
gi|56418597|ref|YP_145915.1|  ....................................................................
gi|56419350|ref|YP_146668.1|  ....................................................................
gi|56419349|ref|YP_146667.1|  ....................................................................
gi|56420488|ref|YP_147806.1|  ....................................................................
gi|56422025|ref|YP_149343.1|  ....................................................................
gi|56421636|ref|YP_148954.1|  ....................................................................
gi|56419244|ref|YP_146562.1|  ....................................................................
gi|56420756|ref|YP_148074.1|  ....................................................................
gi|56420970|ref|YP_148288.1|  ....................................................................
gi|56421163|ref|YP_148481.1|  ....................................................................
gi|56419702|ref|YP_147020.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56420918|ref|YP_148236.1|  ....................................................................
gi|56420877|ref|YP_148195.1|  ....................................................................
gi|56419264|ref|YP_146582.1|  ....................................................................
gi|56418731|ref|YP_146049.1|  ....................................................................
gi|56421917|ref|YP_149235.1|  ....................................................................
gi|56418838|ref|YP_146156.1|  ....................................................................
gi|56419503|ref|YP_146821.1|  ....................................................................
gi|56418670|ref|YP_145988.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56421512|ref|YP_148830.1|  ....................................................................
gi|56419841|ref|YP_147159.1|  ....................................................................
gi|56420197|ref|YP_147515.1|  ....................................................................
gi|56421558|ref|YP_148876.1|  ....................................................................
gi|56420799|ref|YP_148117.1|  ....................................................................
gi|56420924|ref|YP_148242.1|  ....................................................................
gi|56421010|ref|YP_148328.1|  ....................................................................
gi|56419920|ref|YP_147238.1|  ....................................................................
gi|56418639|ref|YP_145957.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56419445|ref|YP_146763.1|  ....................................................................
gi|56421511|ref|YP_148829.1|  ....................................................................
gi|56419731|ref|YP_147049.1|  ....................................................................
gi|56419721|ref|YP_147039.1|  ....................................................................
gi|56421391|ref|YP_148709.1|  ....................................................................
gi|56419996|ref|YP_147314.1|  ....................................................................
gi|56421148|ref|YP_148466.1|  ....................................................................
gi|56418847|ref|YP_146165.1|  ....................................................................
gi|56420198|ref|YP_147516.1|  ....................................................................
gi|56418729|ref|YP_146047.1|  ....................................................................
gi|56420178|ref|YP_147496.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56419216|ref|YP_146534.1|  ....................................................................
gi|56420469|ref|YP_147787.1|  ....................................................................
gi|56419007|ref|YP_146325.1|  ....................................................................
gi|56421926|ref|YP_149244.1|  ....................................................................
gi|56418552|ref|YP_145870.1|  ....................................................................
gi|56421006|ref|YP_148324.1|  ....................................................................
gi|56419712|ref|YP_147030.1|  ....................................................................
gi|56421096|ref|YP_148414.1|  ....................................................................
gi|56421557|ref|YP_148875.1|  ....................................................................
gi|56420989|ref|YP_148307.1|  ....................................................................
gi|56421797|ref|YP_149115.1|  ....................................................................
gi|56419179|ref|YP_146497.1|  ....................................................................
gi|56420468|ref|YP_147786.1|  ....................................................................
gi|56421763|ref|YP_149081.1|  ....................................................................
gi|56418671|ref|YP_145989.1|  ....................................................................
gi|56419272|ref|YP_146590.1|  ....................................................................
gi|56421043|ref|YP_148361.1|  ....................................................................
gi|56420022|ref|YP_147340.1|  ....................................................................
gi|56420415|ref|YP_147733.1|  ....................................................................
gi|56420326|ref|YP_147644.1|  ....................................................................
gi|56419193|ref|YP_146511.1|  ....................................................................
gi|56418559|ref|YP_145877.1|  ....................................................................
gi|56422011|ref|YP_149329.1|  ....................................................................
gi|56419728|ref|YP_147046.1|  hvivtadlkganelakllhyryrlvtldgdvvspggamtgggaakktasllsrnreletlsaklqemd
gi|56421642|ref|YP_148960.1|  ....................................................................
gi|56420899|ref|YP_148217.1|  ....................................................................
gi|56419677|ref|YP_146995.1|  ....................................................................
gi|56421126|ref|YP_148444.1|  ....................................................................
gi|56421185|ref|YP_148503.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56420896|ref|YP_148214.1|  ....................................................................
gi|56420444|ref|YP_147762.1|  ....................................................................
gi|56420563|ref|YP_147881.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56420212|ref|YP_147530.1|  ....................................................................
gi|56419206|ref|YP_146524.1|  ....................................................................
gi|56420341|ref|YP_147659.1|  ....................................................................
gi|56419798|ref|YP_147116.1|  ....................................................................
gi|56420778|ref|YP_148096.1|  ....................................................................
gi|56419605|ref|YP_146923.1|  ....................................................................
gi|56419482|ref|YP_146800.1|  ....................................................................
gi|56420961|ref|YP_148279.1|  ....................................................................
gi|56421023|ref|YP_148341.1|  ....................................................................
gi|56420330|ref|YP_147648.1|  ....................................................................
gi|56421141|ref|YP_148459.1|  ....................................................................
gi|56419729|ref|YP_147047.1|  ....................................................................
gi|56418720|ref|YP_146038.1|  ....................................................................
gi|56420762|ref|YP_148080.1|  ....................................................................
gi|56418614|ref|YP_145932.1|  ....................................................................
gi|56418826|ref|YP_146144.1|  ....................................................................
gi|56421083|ref|YP_148401.1|  ....................................................................
gi|56419816|ref|YP_147134.1|  ....................................................................
gi|56420429|ref|YP_147747.1|  ....................................................................
gi|56421186|ref|YP_148504.1|  ....................................................................
gi|56418583|ref|YP_145901.1|  ....................................................................
gi|56420156|ref|YP_147474.1|  ....................................................................
gi|56419155|ref|YP_146473.1|  ....................................................................
gi|56419739|ref|YP_147057.1|  ....................................................................
gi|56419819|ref|YP_147137.1|  ....................................................................
gi|56421620|ref|YP_148938.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56418536|ref|YP_145854.1|  ....................................................................
gi|56418775|ref|YP_146093.1|  ....................................................................
gi|56422029|ref|YP_149347.1|  ....................................................................