SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

(Phosphotyrosine protein) phosphatases II alignments in Bos taurus 76_3.1

These alignments are sequences aligned to the 0050432 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1wcha_               hs............................................................................
ENSBTAP00000022028  fpengwklydslseyrrqgipneswritkvneryelcdtypallvvpanipdeelkrvasfrsrgripvlswihpesq
ENSBTAP00000018789  fnvdgwtvynpveeyrrqglpnhhwritfinkcyklcdtypallvvpyrasdedlrrvatfrsrnripvlswihpenk
ENSBTAP00000012726  kfpvngwkvydpvseykrqglpneswkiskvnsnyelcdtypaiivvptsvkdddlskvaafrakgripvlswihpes
ENSBTAP00000048361  pgehvtsrfknevermgfdmnnawrisninekyrlcgsypqelivpawitdkelesvagfrswkripavvyrhqsnga
ENSBTAP00000004052  rgwelidlaeeykrmgvpnsnwqlsdanreykicetyprelyvpriaskpiivgsskfrskgrfpvlsyyhqskeaai
ENSBTAP00000030174  crqeaelarmgfdlqnvwrvshinsnyklcpsypqkllvpvwitdkelenvasfrswkripvvvyrhlrngaaiarcs
ENSBTAP00000048722  eqgwmlielseeykrmglpneywqlsdvnreyricdsyptelyvpksatahiivgsskfrsrrrfpalsyyykdnhas
ENSBTAP00000046933  mresgwklidqtsdfgrmgipnrywtitdanrnyeicstypleivipksvtlgtvvgsskfrskervpvlsylykenn
ENSBTAP00000004852  viedgwhsflpeqefelysstisewrlsyvnkefsvcpsyppavivpkaidddalrkvatfrhggrfpvlsyyhkkng
ENSBTAP00000019137  awhfhppecyykrvaretnawrlseanedfslcpsypravivpravddsavarsarfrqggrfpvlsyyhapsgtvll
ENSBTAP00000042388  gdmaehter.....................................................................
ENSBTAP00000024046  itdladnierl...................................................................
ENSBTAP00000028448  tmsslveraccrdyqrlglgtlssslsraksepfrispvnrmyaicrsypgllivpqsvqdnalqrvsrcyrqnrfpv
ENSBTAP00000013433  lelad.........................................................................
ENSBTAP00000015189  ppl...........................................................................
ENSBTAP00000006948  stmeqlvekacfrdyqrlglgtisgsssrskpeyfritasnrmyslcrsypgllvvpqavqdsslprvarcyrhnrlp
ENSBTAP00000003163  fpipvahlede...................................................................
ENSBTAP00000053189  stmeqlvekacfrdyqrlglgtisgsssrskpeyfritasnrmyslcrsypgllvvpqavqdsslprvarcyrhnrlp
ENSBTAP00000053498  adllqhin......................................................................
ENSBTAP00000034314  kli...........................................................................
ENSBTAP00000029213  a.............................................................................
ENSBTAP00000054347  a.............................................................................
ENSBTAP00000022588  mtiqelmdy.....................................................................
ENSBTAP00000020345  cp............................................................................
ENSBTAP00000013433  gntevparnlyayi................................................................
ENSBTAP00000015189  dtelevtslethlq................................................................
ENSBTAP00000000401  adllqhit......................................................................
ENSBTAP00000050372  irfpgd........................................................................
ENSBTAP00000002653  rinaaeies.....................................................................
ENSBTAP00000027046  g.............................................................................
ENSBTAP00000042388  gntevparslyayi................................................................
ENSBTAP00000053776  vga...........................................................................
ENSBTAP00000053345  ai............................................................................
ENSBTAP00000013320  pihadvlletykrkm...............................................................
ENSBTAP00000024046  ghtevparnlyahiqklgqvppg.......................................................
ENSBTAP00000008678  me............................................................................
ENSBTAP00000003163  gdteldvsslekhlqalh............................................................
ENSBTAP00000025085  gdtl..........................................................................
ENSBTAP00000030443  spvqlddfday...................................................................
ENSBTAP00000042825  ipekapldsvqqdd................................................................
ENSBTAP00000019901  lld...........................................................................
ENSBTAP00000045240  p.............................................................................
ENSBTAP00000013969  fee...........................................................................
ENSBTAP00000033929  g.............................................................................
ENSBTAP00000055241  ..............................................................................
ENSBTAP00000004985  yrtek.........................................................................
ENSBTAP00000017076  dllqhinqmktaeg................................................................
ENSBTAP00000019887  vsek..........................................................................
ENSBTAP00000026136  ksnkee........................................................................
ENSBTAP00000019182  fetysdwdrevkrtgasgwrvcsinegymistclpeyfvvpssladqdlkvfshsfvgrrmpfwcwshsngsalvrta
ENSBTAP00000018336  wceepaqanmdi..................................................................
ENSBTAP00000020359  prekvameylqsasriltrsqlrdvv....................................................
ENSBTAP00000024750  ratn..........................................................................
ENSBTAP00000028717  rvdat.........................................................................
ENSBTAP00000026996  preesareyllsa.................................................................
ENSBTAP00000015484  leqlealggrhgvvfagefsdirarsaawkt...............................................
ENSBTAP00000003923  rpp...........................................................................
ENSBTAP00000050785  relslk........................................................................
ENSBTAP00000053528  avmfdtlqdwcrelertkgnmkykavsvnegykvcerlpayfvvpaplleedieffqgrgipiwcwschngcallkms
ENSBTAP00000053345  e.............................................................................
ENSBTAP00000053498  a.............................................................................
ENSBTAP00000000401  aclcg.........................................................................
ENSBTAP00000017076  a.............................................................................
ENSBTAP00000013320  selh..........................................................................
ENSBTAP00000016579  tiedweterkkqaargwrvstvnerfdvatslpryfwvpnrtldsevrrafghfhqgrgprlswhhpggsdllrcggf
ENSBTAP00000029213  etevsssqlhsyvnsilipg..........................................................
ENSBTAP00000054347  etevsssqlhsyvnsilipg..........................................................
ENSBTAP00000053776  pgp...........................................................................
ENSBTAP00000003600  dpyerperlq....................................................................
ENSBTAP00000003532  kipprwlncprrgqpvagrflplktmlgprydsqvaeenrfhpsmlsnylkslkvkmgllvdltntsrfydrndiek.
ENSBTAP00000008825  eligacefmkdrlyfatlrnrpkstvnthyfsideelvyenfyadfgplnlamvyryccklnkklksyslsrkrivhy
ENSBTAP00000054725  eligacefmkdrlyfatlrnrpkstvnthyfsideelvyenfyadfgplnlamvyryccklnkklksyslsrkrivhy
ENSBTAP00000052724  kveriekrclelfgrdycysviqnvngdicghypqhivfleyessekekdtfqstvqvsklqdlvnrsktarcrgrfv
ENSBTAP00000044476  iperwkdylpvgqrmpgtrfiafkvplkksfekhlapeecfspldlfnkiqeqneelgliidltytrry.........
ENSBTAP00000015397  dqqddlyldithrlcfailfsrpksssnvhyfsidneleyenfyadfgplnlamvyrycckinkklksitmmrkkiih
ENSBTAP00000021830  nvfelerllytgktacnhadevwpglylgdqeiannhrelrrlgithvlnashsrwrgtpeay...............
ENSBTAP00000005170  sgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegrsfmhvntnanfykdsgitylgikandtqefn
ENSBTAP00000015397  fn............................................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000018411  cstplydqggpveilpflylgsayhasrkdmldalgitalinvsancp..............................
ENSBTAP00000053215  csscgtplhdqggpveilpflylgsayhaarrdmldalgitallnvssdc............................
ENSBTAP00000000929  lvptcisqpclpvanigptrilpnlylgcqrdvlnkelmqqngigyvlnasntcpkpdfipeshflrvpvndsfceki
ENSBTAP00000027120  dsrapsydqggpveilpylylgscshssdlqglracgitavlnvsascpnhfegllryksipvednqmveisawfp..
ENSBTAP00000013570  lmaprmisegdlggiaqitsslflgrgsvasnrhllqargitcivnatieipnfnwp.....................
ENSBTAP00000040594  sgcyslpsqpcnevtpriyvgnaiestmldegeirkccqgrsvaqdipklqklgithvlnaaegrsfmhvntnanfyk
ENSBTAP00000027029  nisyrpaydqggpveilpflylgsayhaskceflanlhital....................................
ENSBTAP00000010955  lpsfpvqilpnlylgsardsanveslaklgiryilnvtpnlpnlfekngd............................
ENSBTAP00000002933  apve..........................................................................
ENSBTAP00000012499  mgfpaerlegvyrnnidd............................................................
ENSBTAP00000018426  plqqyrdfidnqmlllmaqqdrasrifphlylgsewnaanleelqrnrvshilnmareidnfyperftyhnvrl....
ENSBTAP00000002265  ipstpdienaeltpilpflflgneqdaqdletmqrlnigyvinvtthlplyh..........................
ENSBTAP00000035646  gfdldltyvteriiamsfpssgkqsfyrnpike.............................................
ENSBTAP00000048125  apvei.........................................................................
ENSBTAP00000029212  pssqpafpvqilpylylgcakdstnldvlgkygikyilnvtpnlpnafehgge.........................
ENSBTAP00000003800  gafelerlfwkgspqythvnevwpklyigdettaldryglqkagfthvlnaahgrwnvdtgpdyyrdmaieyhgvead
ENSBTAP00000006022  nsqpsfpveilpflylgcakdstnldvleefgikyilnvtpnlpnlfenagef.........................
ENSBTAP00000003801  tlaslqrllwvrraamlnhinevwpnlflgdayaardkkkltqlgithvvnvaagkfqvdtgakfyrgmpleyygiea
ENSBTAP00000025062  dnemllilgqmdkpslifdhlylgsewnasnleelqgsgv......................................
ENSBTAP00000031268  devwpnlyigdaatannrfelwklgithvlnaahgglycqgspdfygssvs...........................
ENSBTAP00000014625  dnemivilgqmdsptqifehvflgsewnasnledlq..........................................
ENSBTAP00000056281  apve..........................................................................
ENSBTAP00000039071  lnkilpglyignfkdardaeqlsknkvthilsvhdsarpmleg...................................
ENSBTAP00000002365  iqavrqpaahglsqitkslylsdavaakdkamlstnhittvinvsmeatdtfl.........................
ENSBTAP00000054687  edaeewtypmrremqeilpglfl.......................................................
ENSBTAP00000031268  dhinevwpnlflgdayaardkkkltqlgithvvnvaagkfqvdtgakfyrgmpleyygieaddnpffdl.........
ENSBTAP00000027915  kvgvikpwlllgsqdaahdldtlkrlkvthilnvaygvenaflnd.................................
ENSBTAP00000011856  ngmtkvlpglylgnfidakdtdqlgrnkithiisihespqpllqd.................................
ENSBTAP00000007630  kgiysswvtdnilamarpstevlekfciieqfr.............................................
ENSBTAP00000023205  vsglsqitsslyissgvaannrlmlssnristvinvsvevvnalyed...............................
ENSBTAP00000006274  ppnfswvlprrlaglalprlpa........................................................
ENSBTAP00000011408  drqeapwnevdevwpnvfiaeksvavnkgrlkrlgithilnaahgtgvytgpefytg.....................
ENSBTAP00000011320  qyplafalsfsrwlcvhpelyrlpvilssagpvapkdlialgslvaddlvspdalstiremdvanfrrvprlpiygma
ENSBTAP00000039412  ytvfrgkmpgrahrdwyhridstvllgalplrsmtr..........................................
ENSBTAP00000028997  arhmlevrpglflggaaavaepdhlreaavtavltvdseepnfktgagveglrslfvpald.................
ENSBTAP00000003229  ldlvyvteriiavsfpstaneenfrsnlrevaqmlkskhg......................................
ENSBTAP00000012722  ldltyiteriiavsfpagcseesylhnlqevtrmlrskhg......................................
ENSBTAP00000011320  kvapvvitynckeefqihdellkahytlgrlsdatpehylvqgryflvrdvtekmdtlgtlqscgapnfrqvqgglav
ENSBTAP00000012447  kiiwmpqeldafqpypieimpgriylgnfkqacdpkiqkdlkisahvnismetgpffvgdadk...............
ENSBTAP00000041263  iqiswlplsrvncsqflglcalpgckfkdvrrniqkd.........................................
ENSBTAP00000025537  dldisyitsriavmsfpaegvesaiknniedvrlfldskhpgryavynlsprtyrpskfhnrvs..............
ENSBTAP00000041032  dldftyvtsriivmsfpldsvdigfrnqvddirsfl..........................................
ENSBTAP00000009070  wdldltyvterilaasfparpdeqrhrghlrelahvlqskhrdky.................................
ENSBTAP00000020200  iaghqamhysrilpniwlgscprqvehvtiklkhelgvtavmnfqtewdivqnssgcnrypepmtpdtmiklykeegl
ENSBTAP00000055811  sqpclpvpsvgltrilphlylgsqkdvlnkvwypqstcgvwlsrentpslpemcretrtrqraptnrffarclcpwmg
ENSBTAP00000041416  sqpclpvpsvgltrilphlylgsqkdvlnkgartrqggsglfqstgflippefycsprgqraptnrffarclcpwmgr


                                                                                                    
                                                                                                    
d1wcha_               ..............................................................................
ENSBTAP00000022028  atitrcsqpmvgvsgkrskedekylqaimdsnaqshkififdarpsvnavankakgggyesedayqnaelvfldihni
ENSBTAP00000018789  tvivrcsqplvgmsgkrnkederyldviretnrqvnkltiydarpnvnavankatgggyesddvyhnaelffldihni
ENSBTAP00000012726  qatitrcsqplvgpndkrckedekylqtimdanaqahkliifdarqnsvadtnkakgggyesesaypnaelmfleihn
ENSBTAP00000048361  viarcgqpevswwgwrnaddehlvqsvakacasdsrsggskpsarnsprdfpcagdlsdvefdsslsnasgaeslaiq
ENSBTAP00000004052  crcsqplsgfsarcledehllqaiskanpanrymyvmdtrprlnamanraagkgyenednysnirfqfvgienihvmr
ENSBTAP00000030174  qpeiswwgwrnaddeylvtsiakacaldpgprtsggslstgsseaseacdtdfdssltacsgvesstaapqkllilda
ENSBTAP00000048722  icrssqplsgfsarcledeqmlqairkanpgsdflyvvdtrpklnamanraagkgyenednysnikfqfigienihvm
ENSBTAP00000046933  aaicrcsqplsgfytrciddellleairqtnpgsqflyvvdtrpklnalanraagkgyenednyanirfrfmsienih
ENSBTAP00000004852  mvimrsgqpltgtngrrckedeklinatlragkrgyiidtrplniaqqarakgggfeqeahypqwrrihksidryhil
ENSBTAP00000019137  ragqpltgpqkrrcsedeellravlagarpgargfivdtrspqaakqarmtgggteakaaypgwkrlhrplergrplq
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000028448  vcwrsgrskavllrsgglhgkgvvglfkaqnapspgqsqadsssleqekylqavvssmpryadasgrntlsgfssahm
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000006948  vvcwrnsrsstlllrsggfhgkgvvglfksqnspqaaptsslessssieqekylqallsavsvhqklsgnnpltvrpa
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000053189  vvcwrnsrsstlllrsggfhgkgvvglfksqnspqaaptsslessssieqekylqallsavsvhqklsgnnpltvrpa
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000034314  ..............................................................................
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000022588  ..............................................................................
ENSBTAP00000020345  ..............................................................................
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000050372  ..............................................................................
ENSBTAP00000002653  ..............................................................................
ENSBTAP00000027046  ..............................................................................
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000008678  ..............................................................................
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000025085  ..............................................................................
ENSBTAP00000030443  ..............................................................................
ENSBTAP00000042825  ..............................................................................
ENSBTAP00000019901  ..............................................................................
ENSBTAP00000045240  ..............................................................................
ENSBTAP00000013969  ..............................................................................
ENSBTAP00000033929  ..............................................................................
ENSBTAP00000055241  ..............................................................................
ENSBTAP00000004985  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000019887  ..............................................................................
ENSBTAP00000026136  ..............................................................................
ENSBTAP00000019182  lirdvlqqrkieqricnaitkshpqrndvyksdldktlpniqdiqvafvklkqlcvnepfeeteekwlsslentrwle
ENSBTAP00000018336  ..............................................................................
ENSBTAP00000020359  ..............................................................................
ENSBTAP00000024750  ..............................................................................
ENSBTAP00000028717  ..............................................................................
ENSBTAP00000026996  ..............................................................................
ENSBTAP00000015484  ..............................................................................
ENSBTAP00000003923  ..............................................................................
ENSBTAP00000050785  ..............................................................................
ENSBTAP00000053528  alpkeqddsmsqiqknfsdriyrtvhrppyetaktedlssnflslqeiqmayskfkqlflidnstefwdtdikwfsll
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000016579  ytasdpnkediravesmlqaghsdvvlvdtmdelpsladvqlahlrlralclpdssvaedkwfsalegtrwldytrsc
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000003600  ..............................................................................
ENSBTAP00000003532  ..............................................................................
ENSBTAP00000008825  tcfdqrkranaafligayaviylkktpeeayrall...........................................
ENSBTAP00000054725  tcfdqrkranaafligayaviylkktpeeayrall...........................................
ENSBTAP00000052724  cpvilfkgkhicrsatlagwgelygrtgynyifsggaddawadaedlteedcalrssdthlfdkvrgydikllrylsv
ENSBTAP00000044476  ..............................................................................
ENSBTAP00000015397  ftgpdqrkqanaaflvgcymviylgktpedayril...........................................
ENSBTAP00000021830  ..............................................................................
ENSBTAP00000005170  ls............................................................................
ENSBTAP00000015397  ..............................................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000018411  ..............................................................................
ENSBTAP00000053215  ..............................................................................
ENSBTAP00000000929  lpw...........................................................................
ENSBTAP00000027120  ..............................................................................
ENSBTAP00000013570  ..............................................................................
ENSBTAP00000040594  dsgitylgikandtqefnls..........................................................
ENSBTAP00000027029  ..............................................................................
ENSBTAP00000010955  ..............................................................................
ENSBTAP00000002933  ..............................................................................
ENSBTAP00000012499  ..............................................................................
ENSBTAP00000018426  ..............................................................................
ENSBTAP00000002265  ..............................................................................
ENSBTAP00000035646  ..............................................................................
ENSBTAP00000048125  ..............................................................................
ENSBTAP00000029212  ..............................................................................
ENSBTAP00000003800  dlpsfdlsvff...................................................................
ENSBTAP00000006022  ..............................................................................
ENSBTAP00000003801  ddnpffdl......................................................................
ENSBTAP00000025062  ..............................................................................
ENSBTAP00000031268  ..............................................................................
ENSBTAP00000014625  ..............................................................................
ENSBTAP00000056281  ..............................................................................
ENSBTAP00000039071  ..............................................................................
ENSBTAP00000002365  ..............................................................................
ENSBTAP00000054687  ..............................................................................
ENSBTAP00000031268  ..............................................................................
ENSBTAP00000027915  ..............................................................................
ENSBTAP00000011856  ..............................................................................
ENSBTAP00000007630  ..............................................................................
ENSBTAP00000023205  ..............................................................................
ENSBTAP00000006274  ..............................................................................
ENSBTAP00000011408  ..............................................................................
ENSBTAP00000011320  qpsakalgsvlayltdskrklqqvmwvnlreeavlecdgrthslrwpgppmapdqlenletqlkahltrpppdadgpq
ENSBTAP00000039412  ..............................................................................
ENSBTAP00000028997  ..............................................................................
ENSBTAP00000003229  ..............................................................................
ENSBTAP00000012722  ..............................................................................
ENSBTAP00000011320  fgmgqpslsgfrqvlqklqkdghrecvifcvreepvlflraaedfipytprdkqnlhenlqglgpgvqaerlelairk
ENSBTAP00000012447  ..............................................................................
ENSBTAP00000041263  ..............................................................................
ENSBTAP00000025537  ..............................................................................
ENSBTAP00000041032  ..............................................................................
ENSBTAP00000009070  ..............................................................................
ENSBTAP00000020200  a.............................................................................
ENSBTAP00000055811  rtenylhka.....................................................................
ENSBTAP00000041416  tenylhka......................................................................


                                                                                                    
                                                                                                    
d1wcha_               ..............................................................................
ENSBTAP00000022028  hvmreslrklkeivypnieeth........................................................
ENSBTAP00000018789  hvmreslkkvkdivypnveeshwlsslest................................................
ENSBTAP00000012726  ihvmreslrklkeiaypaidearwlsnvdgthwleyirmllaga..................................
ENSBTAP00000048361  pqkllildarsyaaavanrakg........................................................
ENSBTAP00000004052  sslqkllevngtkglsvndfysglessgwlr...............................................
ENSBTAP00000030174  rsytaavanrakgggceceeyypncevvfmgmanihairnsfqylravcsqmpdpsnwlsalest.............
ENSBTAP00000048722  rnslqkmlevcelkspsmsdflwglensgwlrhikaimdag.....................................
ENSBTAP00000046933  vmrsslqkllevcelktptmseflsglessgwlrhikaimdagif.................................
ENSBTAP00000004852  qesliklvescndqtqnmdrwlskleasnwlthikeilttaclaaqcldregasilihgte.................
ENSBTAP00000019137  esfvrlveacgdleqsmdrwlnrlescrwlshvketlstaclaaqsmeq.............................
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000028448  gshgkwgsvrasgrsgglstdvgsrlagvgppqangappepgflrpqraalyiigdkaqlkgvrpdplqqwelvpiev
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000006948  lalspgvwaslrsstrlissptsfidvgarlagkdhstsfsnstylqnqllkrqatlyifgeksqlrnfklefalnce
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000053189  lalspgvwaslrsstrlissptsfidvgarlagkdhstsfsnstylqnqllkrqatlyifgeksqlrnfklefalnce
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000034314  ..............................................................................
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000022588  ..............................................................................
ENSBTAP00000020345  ..............................................................................
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000050372  ..............................................................................
ENSBTAP00000002653  ..............................................................................
ENSBTAP00000027046  ..............................................................................
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000008678  ..............................................................................
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000025085  ..............................................................................
ENSBTAP00000030443  ..............................................................................
ENSBTAP00000042825  ..............................................................................
ENSBTAP00000019901  ..............................................................................
ENSBTAP00000045240  ..............................................................................
ENSBTAP00000013969  ..............................................................................
ENSBTAP00000033929  ..............................................................................
ENSBTAP00000055241  ..............................................................................
ENSBTAP00000004985  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000019887  ..............................................................................
ENSBTAP00000026136  ..............................................................................
ENSBTAP00000019182  yvraflkhaaelvyvleskrlsvvlqeeegrdlsciiaslvqvmldpyfrtitgfqsliqkewvmag...........
ENSBTAP00000018336  ..............................................................................
ENSBTAP00000020359  ..............................................................................
ENSBTAP00000024750  ..............................................................................
ENSBTAP00000028717  ..............................................................................
ENSBTAP00000026996  ..............................................................................
ENSBTAP00000015484  ..............................................................................
ENSBTAP00000003923  ..............................................................................
ENSBTAP00000050785  ..............................................................................
ENSBTAP00000053528  essswldiirrclkkaveiiecleaqnmnvlllednasdlcclvsslaqvmmdphcrtvfgfqslvqkew........
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000016579  lrkasdisvlvtsrvrsvvlqergdrdfngllsslvqllsapeartllgfqslvqrewvaaghpfltrlggsgaseea
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000003600  ..............................................................................
ENSBTAP00000003532  ..............................................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000052724  kyicdlmvenkkvkfgmnvtssekvdkaqryadftllsipypgceffkeykdrdymaeglifnwkqdyvdaplsipdf
ENSBTAP00000044476  ..............................................................................
ENSBTAP00000015397  ..............................................................................
ENSBTAP00000021830  ..............................................................................
ENSBTAP00000005170  ..............................................................................
ENSBTAP00000015397  ..............................................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000018411  ..............................................................................
ENSBTAP00000053215  ..............................................................................
ENSBTAP00000000929  ..............................................................................
ENSBTAP00000027120  ..............................................................................
ENSBTAP00000013570  ..............................................................................
ENSBTAP00000040594  ..............................................................................
ENSBTAP00000027029  ..............................................................................
ENSBTAP00000010955  ..............................................................................
ENSBTAP00000002933  ..............................................................................
ENSBTAP00000012499  ..............................................................................
ENSBTAP00000018426  ..............................................................................
ENSBTAP00000002265  ..............................................................................
ENSBTAP00000035646  ..............................................................................
ENSBTAP00000048125  ..............................................................................
ENSBTAP00000029212  ..............................................................................
ENSBTAP00000003800  ..............................................................................
ENSBTAP00000006022  ..............................................................................
ENSBTAP00000003801  ..............................................................................
ENSBTAP00000025062  ..............................................................................
ENSBTAP00000031268  ..............................................................................
ENSBTAP00000014625  ..............................................................................
ENSBTAP00000056281  ..............................................................................
ENSBTAP00000039071  ..............................................................................
ENSBTAP00000002365  ..............................................................................
ENSBTAP00000054687  ..............................................................................
ENSBTAP00000031268  ..............................................................................
ENSBTAP00000027915  ..............................................................................
ENSBTAP00000011856  ..............................................................................
ENSBTAP00000007630  ..............................................................................
ENSBTAP00000023205  ..............................................................................
ENSBTAP00000006274  ..............................................................................
ENSBTAP00000011408  ..............................................................................
ENSBTAP00000011320  thrfqtcltmqevfsqhhgacpg.......................................................
ENSBTAP00000039412  ..............................................................................
ENSBTAP00000028997  ..............................................................................
ENSBTAP00000003229  ..............................................................................
ENSBTAP00000012722  ..............................................................................
ENSBTAP00000011320  eihdfaqlsenkyyvyhntedlrgephavairgeddvhvteevfkrplflqp..........................
ENSBTAP00000012447  ..............................................................................
ENSBTAP00000041263  ..............................................................................
ENSBTAP00000025537  ..............................................................................
ENSBTAP00000041032  ..............................................................................
ENSBTAP00000009070  ..............................................................................
ENSBTAP00000020200  ..............................................................................
ENSBTAP00000055811  ..............................................................................
ENSBTAP00000041416  ..............................................................................


                                                                                                    
                                                                                                    
d1wcha_               ..............................................................................
ENSBTAP00000022028  ..............................................................................
ENSBTAP00000018789  ..............................................................................
ENSBTAP00000012726  ..............................................................................
ENSBTAP00000048361  ..............................................................................
ENSBTAP00000004052  ..............................................................................
ENSBTAP00000030174  ..............................................................................
ENSBTAP00000048722  ..............................................................................
ENSBTAP00000046933  ..............................................................................
ENSBTAP00000004852  ..............................................................................
ENSBTAP00000019137  ..............................................................................
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000028448  fearqvkasfkkllkacvpgcpatepspasflrsledsewliqihkllqvsvlvvelldsgssvlvsledgwdittqv
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000006948  fvpveyhdirqvkasfkklmracvpsaiptdsevtflralgdsewfpqlhrilqlav.....................
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000053189  fvpveyhdirqvkasfkklmracvpsaiptdsevtflralgdsewfpqlhrilqlav.....................
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000034314  ..............................................................................
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000022588  ..............................................................................
ENSBTAP00000020345  ..............................................................................
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000050372  ..............................................................................
ENSBTAP00000002653  ..............................................................................
ENSBTAP00000027046  ..............................................................................
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000008678  ..............................................................................
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000025085  ..............................................................................
ENSBTAP00000030443  ..............................................................................
ENSBTAP00000042825  ..............................................................................
ENSBTAP00000019901  ..............................................................................
ENSBTAP00000045240  ..............................................................................
ENSBTAP00000013969  ..............................................................................
ENSBTAP00000033929  ..............................................................................
ENSBTAP00000055241  ..............................................................................
ENSBTAP00000004985  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000019887  ..............................................................................
ENSBTAP00000026136  ..............................................................................
ENSBTAP00000019182  ..............................................................................
ENSBTAP00000018336  ..............................................................................
ENSBTAP00000020359  ..............................................................................
ENSBTAP00000024750  ..............................................................................
ENSBTAP00000028717  ..............................................................................
ENSBTAP00000026996  ..............................................................................
ENSBTAP00000015484  ..............................................................................
ENSBTAP00000003923  ..............................................................................
ENSBTAP00000050785  ..............................................................................
ENSBTAP00000053528  ..............................................................................
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000016579  pvfllfldcvwq..................................................................
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000003600  ..............................................................................
ENSBTAP00000003532  ..............................................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000052724  ltcslni.......................................................................
ENSBTAP00000044476  ..............................................................................
ENSBTAP00000015397  ..............................................................................
ENSBTAP00000021830  ..............................................................................
ENSBTAP00000005170  ..............................................................................
ENSBTAP00000015397  ..............................................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000018411  ..............................................................................
ENSBTAP00000053215  ..............................................................................
ENSBTAP00000000929  ..............................................................................
ENSBTAP00000027120  ..............................................................................
ENSBTAP00000013570  ..............................................................................
ENSBTAP00000040594  ..............................................................................
ENSBTAP00000027029  ..............................................................................
ENSBTAP00000010955  ..............................................................................
ENSBTAP00000002933  ..............................................................................
ENSBTAP00000012499  ..............................................................................
ENSBTAP00000018426  ..............................................................................
ENSBTAP00000002265  ..............................................................................
ENSBTAP00000035646  ..............................................................................
ENSBTAP00000048125  ..............................................................................
ENSBTAP00000029212  ..............................................................................
ENSBTAP00000003800  ..............................................................................
ENSBTAP00000006022  ..............................................................................
ENSBTAP00000003801  ..............................................................................
ENSBTAP00000025062  ..............................................................................
ENSBTAP00000031268  ..............................................................................
ENSBTAP00000014625  ..............................................................................
ENSBTAP00000056281  ..............................................................................
ENSBTAP00000039071  ..............................................................................
ENSBTAP00000002365  ..............................................................................
ENSBTAP00000054687  ..............................................................................
ENSBTAP00000031268  ..............................................................................
ENSBTAP00000027915  ..............................................................................
ENSBTAP00000011856  ..............................................................................
ENSBTAP00000007630  ..............................................................................
ENSBTAP00000023205  ..............................................................................
ENSBTAP00000006274  ..............................................................................
ENSBTAP00000011408  ..............................................................................
ENSBTAP00000011320  ..............................................................................
ENSBTAP00000039412  ..............................................................................
ENSBTAP00000028997  ..............................................................................
ENSBTAP00000003229  ..............................................................................
ENSBTAP00000012722  ..............................................................................
ENSBTAP00000011320  ..............................................................................
ENSBTAP00000012447  ..............................................................................
ENSBTAP00000041263  ..............................................................................
ENSBTAP00000025537  ..............................................................................
ENSBTAP00000041032  ..............................................................................
ENSBTAP00000009070  ..............................................................................
ENSBTAP00000020200  ..............................................................................
ENSBTAP00000055811  ..............................................................................
ENSBTAP00000041416  ..............................................................................


                                                                                                    
                                                                                                    
d1wcha_               ..............................................................................
ENSBTAP00000022028  ..............................................................................
ENSBTAP00000018789  ..............................................................................
ENSBTAP00000012726  ..............................................................................
ENSBTAP00000048361  ..............................................................................
ENSBTAP00000004052  ..............................................................................
ENSBTAP00000030174  ..............................................................................
ENSBTAP00000048722  ..............................................................................
ENSBTAP00000046933  ..............................................................................
ENSBTAP00000004852  ..............................................................................
ENSBTAP00000019137  ..............................................................................
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000028448  vslvqllsdpfyrtlegfrllvekewlsfghrfshrgahtlagqssgftpvflqfldcvhqihlqfpmefefspfylk
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000006948  ..............................................................................
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000053189  ..............................................................................
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000034314  ..............................................................................
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000022588  ..............................................................................
ENSBTAP00000020345  ..............................................................................
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000050372  ..............................................................................
ENSBTAP00000002653  ..............................................................................
ENSBTAP00000027046  ..............................................................................
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000008678  ..............................................................................
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000025085  ..............................................................................
ENSBTAP00000030443  ..............................................................................
ENSBTAP00000042825  ..............................................................................
ENSBTAP00000019901  ..............................................................................
ENSBTAP00000045240  ..............................................................................
ENSBTAP00000013969  ..............................................................................
ENSBTAP00000033929  ..............................................................................
ENSBTAP00000055241  ..............................................................................
ENSBTAP00000004985  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000019887  ..............................................................................
ENSBTAP00000026136  ..............................................................................
ENSBTAP00000019182  ..............................................................................
ENSBTAP00000018336  ..............................................................................
ENSBTAP00000020359  ..............................................................................
ENSBTAP00000024750  ..............................................................................
ENSBTAP00000028717  ..............................................................................
ENSBTAP00000026996  ..............................................................................
ENSBTAP00000015484  ..............................................................................
ENSBTAP00000003923  ..............................................................................
ENSBTAP00000050785  ..............................................................................
ENSBTAP00000053528  ..............................................................................
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000016579  ..............................................................................
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000003600  ..............................................................................
ENSBTAP00000003532  ..............................................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000052724  ..............................................................................
ENSBTAP00000044476  ..............................................................................
ENSBTAP00000015397  ..............................................................................
ENSBTAP00000021830  ..............................................................................
ENSBTAP00000005170  ..............................................................................
ENSBTAP00000015397  ..............................................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000018411  ..............................................................................
ENSBTAP00000053215  ..............................................................................
ENSBTAP00000000929  ..............................................................................
ENSBTAP00000027120  ..............................................................................
ENSBTAP00000013570  ..............................................................................
ENSBTAP00000040594  ..............................................................................
ENSBTAP00000027029  ..............................................................................
ENSBTAP00000010955  ..............................................................................
ENSBTAP00000002933  ..............................................................................
ENSBTAP00000012499  ..............................................................................
ENSBTAP00000018426  ..............................................................................
ENSBTAP00000002265  ..............................................................................
ENSBTAP00000035646  ..............................................................................
ENSBTAP00000048125  ..............................................................................
ENSBTAP00000029212  ..............................................................................
ENSBTAP00000003800  ..............................................................................
ENSBTAP00000006022  ..............................................................................
ENSBTAP00000003801  ..............................................................................
ENSBTAP00000025062  ..............................................................................
ENSBTAP00000031268  ..............................................................................
ENSBTAP00000014625  ..............................................................................
ENSBTAP00000056281  ..............................................................................
ENSBTAP00000039071  ..............................................................................
ENSBTAP00000002365  ..............................................................................
ENSBTAP00000054687  ..............................................................................
ENSBTAP00000031268  ..............................................................................
ENSBTAP00000027915  ..............................................................................
ENSBTAP00000011856  ..............................................................................
ENSBTAP00000007630  ..............................................................................
ENSBTAP00000023205  ..............................................................................
ENSBTAP00000006274  ..............................................................................
ENSBTAP00000011408  ..............................................................................
ENSBTAP00000011320  ..............................................................................
ENSBTAP00000039412  ..............................................................................
ENSBTAP00000028997  ..............................................................................
ENSBTAP00000003229  ..............................................................................
ENSBTAP00000012722  ..............................................................................
ENSBTAP00000011320  ..............................................................................
ENSBTAP00000012447  ..............................................................................
ENSBTAP00000041263  ..............................................................................
ENSBTAP00000025537  ..............................................................................
ENSBTAP00000041032  ..............................................................................
ENSBTAP00000009070  ..............................................................................
ENSBTAP00000020200  ..............................................................................
ENSBTAP00000055811  ..............................................................................
ENSBTAP00000041416  ..............................................................................


                                 10        20        30           40        50                 60   
                                  |         |         |            |         |                  |   
d1wcha_               ...--FLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRG...LLDQGIPSKELENLQELKP.........LDQCLIG
ENSBTAP00000022028  ...-------------------------------------...-------------------.........-------
ENSBTAP00000018789  ...-------------------------------------...-------------------.........-------
ENSBTAP00000012726  ...-------------------------------------...-------------------.........-------
ENSBTAP00000048361  ...-------------------------------------...-------------------.........-------
ENSBTAP00000004052  ...-------------------------------------...-------------------.........-------
ENSBTAP00000030174  ...-------------------------------------...-------------------.........-------
ENSBTAP00000048722  ...-------------------------------------...-------------------.........-------
ENSBTAP00000046933  ...-------------------------------------...-------------------.........-------
ENSBTAP00000004852  ...-------------------------------------...-------------------.........-------
ENSBTAP00000019137  ...-------------------------------------...-------------------.........-------
ENSBTAP00000042388  ...-----------------------------------LK...ANDSLKLSQEYESIDPGQQ.........-FTWEHS
ENSBTAP00000024046  ...------------------------------------K...ANDGLKFSQEYESIDPGQQ.........-FTWENS
ENSBTAP00000028448  flg-------------------------------------...-------------------.........-------
ENSBTAP00000013433  ...---------------------------------HIERlk.ANDNLKFSQEYESIDPGQQ.........-FTWEHS
ENSBTAP00000015189  ...--------------------------PVDKLEEEINRrm.ADDNKLFREEFNALPACPI.........QATCEAA
ENSBTAP00000006948  ...-------------------------------------...-------------------.........-------
ENSBTAP00000003163  ...--------------------------------IRARS...ADDCKRFREEFNSLPSGHV.........QGTFELA
ENSBTAP00000053189  ...-------------------------------------...-------------------.........-------
ENSBTAP00000053498  ...----------------------------------LMK...TSDSYGFKEEYESFFEGQS.........-ASWDVA
ENSBTAP00000034314  ...--------------------------KVENFEAYFKKqq.ADSNCGFAEEYEDLKLVGI.........NLPKYAA
ENSBTAP00000029213  ...-------------------------IPVKQFVKHIGEly.SNNQHGFSEDFEEVQRCTAdm.......NITAEHS
ENSBTAP00000054347  ...-------------------------IPVKQFVKHIGEly.SNNQHGFSEDFEEVQRCTAdm.......NITAEHS
ENSBTAP00000022588  ...-----------------------------------VS...TRQKRGIYEEYEDIRRENP.........VGTFHCS
ENSBTAP00000020345  ...-------------------------IKVNQFEGHFMKlq.ADSNYLLSKEYEDLKDVGR.........NQSCDIA
ENSBTAP00000013433  ...-----------------------------QKLTQIET...GENVTGMELEFKRLASSKAh........TSRFISA
ENSBTAP00000015189  ...---------------------------------KIYNkipGTSNNGLEEEFKKLTSIKIq........NDKMRTG
ENSBTAP00000000401  ...------------------------------------Qmk.RGQGYGFKEEYEALPEGQT.........-ASWDTA
ENSBTAP00000050372  ...-------------------------ILAEDFAEHVWRne.RDSNYGFAEEYQQLALEDH.........GQSQTVA
ENSBTAP00000002653  ...--------------------------RVRELSKLAETt..DKVKQGFWEEFETLQQQECkl.......LYSRKEG
ENSBTAP00000027046  ...-------------------------------------...------FWEEFESLQKQEVkn.......LHQRLEG
ENSBTAP00000042388  ...-----------------------------QKLTQVEP...GEHVTGMELEFKRLANSKAh........TSRFISA
ENSBTAP00000053776  ...-------------------------IPIKHFPKHVAD...LHASSGFTEEFETLKEFYQevqsctvdlGITADSS
ENSBTAP00000053345  ...--------------------------RVADLLQHITQmk.CAEGYGFKEEYESFFEGQS.........-APWDSA
ENSBTAP00000013320  ...-------------------------------------...ADEGRLFLAEFQSIPRVFS.........KFSIKDA
ENSBTAP00000024046  ...-------------------------------------...-ESVTAMELEFKLLANSKAh........TSRFISA
ENSBTAP00000008678  ...--------------------------------KEFEQ...IDRAGSWAAIYQDIRHEAS.........DFPCRVA
ENSBTAP00000003163  ...------------------------------------GptaHFDKIGLEEEFRKLTNVRIm........KENMRTG
ENSBTAP00000025085  ...----------------------------EGSMEQLKK...GLESGTVLIQFEQLYRKKP.........GLAITFA
ENSBTAP00000030443  ...---------------------------IKDMA-----...KDSDYKFSLQFEELKLIGL.........DIPHFAA
ENSBTAP00000042825  ...-------------------------HSLRESMIQLAE...GLITGTVLTQFDQLYRKKP.........GMTMCCA
ENSBTAP00000019901  ...-------------------------------------...---QGIPSKELENLQELKP.........LDQCLIG
ENSBTAP00000045240  ...-------------------------ISKKSFLQHVEElc.TNNNLKFQEEFSELPKFLQ.........DLSSTDA
ENSBTAP00000013969  ...-------------------------------------...LDAQNRWQQLYLEIRSESH.........DYPHRVA
ENSBTAP00000033929  ...-------------------------------------...------FWEEFEMLQQQECrl.......LYPRKEG
ENSBTAP00000055241  ...-------------------------------------...-------------------.........-------
ENSBTAP00000004985  ...-------------------------------------...-------------------.........IYPTATG
ENSBTAP00000017076  ...-------------------------------------...----YGFKQEYESFFE---.........--GWDAT
ENSBTAP00000019887  ...-------ELAQLALVRPLIFNTQEESTIRDYFKILTK...KVSEDEITQEFKALEVKNL.........PAVFHSG
ENSBTAP00000026136  ...-------------------------------------...------FANEFLTLKRLSSkykadk...TYPTTVA
ENSBTAP00000019182  ...-------------------------------------...-------------------.........-------
ENSBTAP00000018336  ...-------------------------STGHMILAYMEDh..LRNRDRLAKEWQALCAYQAe........PNTCATA
ENSBTAP00000020359  ...-------------------------------------...-ASSHLLQSEFMEIPMNFV.........DPK--EI
ENSBTAP00000024750  ...----------------------------DERCKILEQ...RLEQGMVFTEYERILKKRLv........DGECSTA
ENSBTAP00000028717  ...------------------------RVPMDERFRTLKK...KLEEGMVFTEYEQIPKKKA.........NGIFSTA
ENSBTAP00000026996  ...-------------------------SRVLQAEELHEK...ALDPFLLQAEFFEIPMNFV.........DPK--EY
ENSBTAP00000015484  ...-------------------------------------...-----------------ES.........VRSTEAG
ENSBTAP00000003923  ...-------------------------------------...--SPTQLEEEFLRIPSNFV.........SPE--DL
ENSBTAP00000050785  ...-------------------------------------...-------------------.........-------
ENSBTAP00000053528  ...-------------------------------------...-------------------.........-------
ENSBTAP00000053345  ...----------ACLCGDTSVPASQVRSLYYDMNK-LDP...QTNSSQIKEEFRTLNMVTPtlr......VEDCSIA
ENSBTAP00000053498  ...-------ILEACLCGETAIPVCEFKAAYFDMIR-IDS...QTNSSHLKDEFQTLNSVTPrlq......AEDCSIA
ENSBTAP00000000401  ...---------------NTAIPVCEFRSLYYNISR-LDP...QTNSSQIKDEFQTLNIVTPrvr......PEDCSIG
ENSBTAP00000017076  ...-------ILEACLCGETTIPVSEFKATYKEMIR-IDP...QSNSSQLREEFQTLNSVTPpld......VEECSIA
ENSBTAP00000013320  ...--------------------------PYLSNMKKRDP...PSEPSPLEAEFQRLPSYRS.........WRTQHIG
ENSBTAP00000016579  ...-------------------------------------...------------L------.........-------
ENSBTAP00000029213  ...-------------------------------------...VGGKTRLEKQFKLVTQCNAk........YVECFSA
ENSBTAP00000054347  ...-------------------------------------...VGGKTRLEKQFKLVTQCNAk........YVECFSA
ENSBTAP00000053776  ...-------------------------------------...-TGKTKLEKQFKLLSQSNIq........QSDYSTA
ENSBTAP00000003600  ...-------------------------QLRQELETFRGQ...LGAAGALDTVWRELQDAQEld.......ARGRSIA
ENSBTAP00000003532  ...-------------------------------------...-------------------.........-------
ENSBTAP00000008825  ...----SGSNPPYLPFRDASFGNCTYNLTILDCLQGIRK...GLQHGFFD-----------.........-------
ENSBTAP00000054725  ...----SGSNPPYLPFRDASFGNCTYNLTILDCLQGIRK...GLQHGFFD-----------.........-------
ENSBTAP00000052724  ...-------------------------------------...-------------------.........-------
ENSBTAP00000044476  ...-------------------------------------...-------------------.........-------
ENSBTAP00000015397  ...----MFGDATYIPFRDAAYGSCNFFITLLDCFYAVKK...AMQYGFFN-----------.........-------
ENSBTAP00000021830  ...-------------------------------------...-------------------.........-------
ENSBTAP00000005170  ...-------------------------------------...-------------------.........-------
ENSBTAP00000015397  ...-------------------------------------...-------------------.........LDEYEYY
ENSBTAP00000008825  ...---------PYLPFRDASFGNCTYNLTILDCLQGIRK...GLQHGFFD------FETFD.........VDEYEHY
ENSBTAP00000054725  ...---------PYLPFRDASFGNCTYNLTILDCLQGIRK...GLQHGFFD------FETFD.........VDEYEHY
ENSBTAP00000018411  ...-------------------------------------...-------------------.........-------
ENSBTAP00000053215  ...-------------------------------------...-------------------.........-------
ENSBTAP00000000929  ...-------------------------------------...-------------------.........-------
ENSBTAP00000027120  ...-------------------------------------...-------------------.........-------
ENSBTAP00000013570  ...-------------------------------------...-------------------.........-------
ENSBTAP00000040594  ...-------------------------------------...-------------------.........-------
ENSBTAP00000027029  ...-------------------------------------...-------------------.........-------
ENSBTAP00000010955  ...-------------------------------------...-------------------.........-------
ENSBTAP00000002933  ...-------------------------------------...-------------------.........-------
ENSBTAP00000012499  ...-------------------------------------...-------------------.........-------
ENSBTAP00000018426  ...-------------------------------------...-------------------.........-------
ENSBTAP00000002265  ...-------------------------------------...-------------------.........-------
ENSBTAP00000035646  ...-------------------------------------...-------------------.........-------
ENSBTAP00000048125  ...-------------------------------------...-------------------.........-------
ENSBTAP00000029212  ...-------------------------------------...-------------------.........-------
ENSBTAP00000003800  ...-------------------------------------...-------------------.........-------
ENSBTAP00000006022  ...-------------------------------------...-------------------.........-------
ENSBTAP00000003801  ...-------------------------------------...-------------------.........-------
ENSBTAP00000025062  ...-------------------------------------...-------------------.........-------
ENSBTAP00000031268  ...-------------------------------------...-------------------.........-------
ENSBTAP00000014625  ...-------------------------------------...-------------------.........-------
ENSBTAP00000056281  ...-------------------------------------...-------------------.........-------
ENSBTAP00000039071  ...-------------------------------------...-------------------.........-------
ENSBTAP00000002365  ...-------------------------------------...-------------------.........-------
ENSBTAP00000054687  ...-------------------------------------...-------------------.........-------
ENSBTAP00000031268  ...-------------------------------------...-------------------.........-------
ENSBTAP00000027915  ...-------------------------------------...-------------------.........-------
ENSBTAP00000011856  ...-------------------------------------...-------------------.........-------
ENSBTAP00000007630  ...-------------------------------------...-------------------.........-------
ENSBTAP00000023205  ...-------------------------------------...-------------------.........-------
ENSBTAP00000006274  ...-------------------------------------...-------------------.........-------
ENSBTAP00000011408  ...-------------------------------------...-------------------.........-------
ENSBTAP00000011320  ...-------------------------------------...-------------------.........-------
ENSBTAP00000039412  ...-------------------------------------...-------------------.........-------
ENSBTAP00000028997  ...-------------------------------------...-------------------.........-------
ENSBTAP00000003229  ...-------------------------------------...-------------------.........-------
ENSBTAP00000012722  ...-------------------------------------...-------------------.........-------
ENSBTAP00000011320  ...-------------------------------------...-------------------.........-------
ENSBTAP00000012447  ...-------------------------------------...-------------------.........-------
ENSBTAP00000041263  ...-------------------------------------...-------------------.........-------
ENSBTAP00000025537  ...-------------------------------------...-------------------.........-------
ENSBTAP00000041032  ...-------------------------------------...-------------------.........-------
ENSBTAP00000009070  ...-------------------------------------...-------------------.........-------
ENSBTAP00000020200  ...-------------------------------------...-------------------.........-------
ENSBTAP00000055811  ...-------------------------------------...-------------------.........-------
ENSBTAP00000041416  ...-------------------------------------...-------------------.........-------


                           70        80                        90                  100             1
                            |         |                         |                    |              
d1wcha_               QTKENRRKNRYKNILPYDATRVPL..............G..DE...........GGYINASFIKIPV......GKEEF
ENSBTAP00000022028  ------------------------..............-..--...........-------------......-----
ENSBTAP00000018789  ------------------------..............-..--...........-------------......-----
ENSBTAP00000012726  ------------------------..............-..--...........-------------......-----
ENSBTAP00000048361  ------------------------..............-..--...........-------------......-----
ENSBTAP00000004052  ------------------------..............-..--...........-------------......-----
ENSBTAP00000030174  ------------------------..............-..--...........-------------......-----
ENSBTAP00000048722  ------------------------..............-..--...........-------------......-----
ENSBTAP00000046933  ------------------------..............-..--...........-------------......-----
ENSBTAP00000004852  ------------------------..............-..--...........-------------......-----
ENSBTAP00000019137  ------------------------..............-..--...........-------------......-----
ENSBTAP00000042388  NLEVNKPKNRYANVIAYDHSRVILqpie..........Gi.VG...........SDYINANYVDGY-......-RRQN
ENSBTAP00000024046  NLEVNKPKNRYANVIAYDHSRVILtsid..........Gv.PG...........SDYINANYIDGY-......-RKQN
ENSBTAP00000028448  ------------------------..............-..--...........-------------......-----
ENSBTAP00000013433  NLEVNKPKNRYANVIAYDHSRVLLsaie..........Gi.PG...........SDYVNANYIDGY-......-RKQN
ENSBTAP00000015189  SKEENKEKNRYVNILPYDHSRVHLtpve..........Gv.PD...........SDYINASFINGY-......-QEKN
ENSBTAP00000006948  ------------------------..............-..--...........-------------......-----
ENSBTAP00000003163  NKEENREKNRYPNILPNDHSRVILsqvdg.........T..PC...........SDYINASYIDGY-......-KEKN
ENSBTAP00000053189  ------------------------..............-..--...........-------------......-----
ENSBTAP00000053498  KKDQNRAKNRYGNIIAYDHSRVILqpved.........D..PS...........SDYINANYIDIWLyrdg..YQRPS
ENSBTAP00000034314  ELAENRGKNRYNNVLPYDVSRVKLsvqt..........H..ST...........DDYINANYMPGY-......-HSKE
ENSBTAP00000029213  NHPDNKHKNRYINILAYDHSRVKLrplpgkd.......S..KH...........SDYINANYVDGY-......-NKAK
ENSBTAP00000054347  NHPDNKHKNRYINILAYDHSRVKLrplpgkd.......S..KH...........SDYINANYVDGY-......-NKAK
ENSBTAP00000022588  MSPGNLEKNRYGDVPCLDQTRVKLtkrsg.........H..TQ...........TDYINASFMDGY-......-KQKN
ENSBTAP00000020345  LLPENRGKNRYNNILPYDSSRVKLsnvdd.........D..PC...........SDYINASYIPGN-......-NFRR
ENSBTAP00000013433  NLPCNKFKNRLVNIMPYESTRVCLqpir..........Gv.EG...........SDYINASFIDGY-......-RQQK
ENSBTAP00000015189  NLPANMKKNRVLQIIPYEFNRVIIpvkrg.........E..EN...........TDYVNASFIDGY-......-RQKD
ENSBTAP00000000401  KEDENRNKNRYGNIISYDHSRVRLlvldg.........D..PH...........SDYINANYIDGY-......-HRPR
ENSBTAP00000050372  SALENSGKNRYRNVLPYDWSRVPLqallg.........Q..PG...........SEYINASFIPGL-......-WSPR
ENSBTAP00000002653  QRQENKNKNRYKNILPFDHTRVVLhdgdpn........E..PV...........SDYINANIIMPEFetkcnnSKPKK
ENSBTAP00000027046  QRPENKSKNRYKNILPFDHSRVVLqgrds.........Ni.PG...........SDYINANYVKNQLlgp...DENAK
ENSBTAP00000042388  NLPCNKFKNRLVNIMPYESTRVCLqpir..........Gv.EG...........SDYINASFIDGY-......-RQQK
ENSBTAP00000053776  NHPDNKHKNRYINIVAYDHSRVKLaqlaekd.......G..KL...........TDYINANYVDGY-......-NRPK
ENSBTAP00000053345  KKDENRMKNRYGNIIAYDHSRVRLqtve..........G..DN...........SDYINGNYIDGY-......-HRPN
ENSBTAP00000013320  RKSFNQNKNRYVDILPYDYNRVELsding.........D..AG...........SNYINASYIDGF-......-KEPR
ENSBTAP00000024046  NLPCNKFKNRLVNIMPYELTRVCLqpir..........Gv.EG...........SDYINASFLDGY-......-RQQK
ENSBTAP00000008678  KLPKNKNRNRYRDVSPFDHSRIKLh.............Q..ED...........NDYINASLIKME-......-EAQR
ENSBTAP00000003163  NLPANMKKARVIQIIPYDFNRVILsmkrg.........Q..EY...........TDYINASFIDGY-......-RQKD
ENSBTAP00000025085  KLPQNLDKNRYKDVLPYDTTRVLL..............Q..GN...........EDYINASYVNMEIpa....AHLMN
ENSBTAP00000030443  DLPLNRCKNRYTNILPYDFSRVRLismne.........E..EG...........ADYINANYIPGY-......-NSPQ
ENSBTAP00000042825  KLPQNISKNRYRDISPYDATRVIL..............K..GN...........EDYINANYINMEIps....SRIIN
ENSBTAP00000019901  QTKENRRKNRYKNILPYDATRVPL..............G..DE...........GGYINASFIKIPV......GREEF
ENSBTAP00000045240  DLPWNRAKNRFPNIKPYNNNRVKLiada..........Si.PG...........SDYINASYVSGY-......-LCPN
ENSBTAP00000013969  KFPENRNRNRYRDVSPYDHSRVKLq.............N..AE...........NDYINASLVDIE-......-EAQR
ENSBTAP00000033929  QRPENKPKNRYKNILPFDTTRVILhdvd..........DrvPG...........ADYINANYIRSDPeekpg.HGLGK
ENSBTAP00000055241  --PANSTKNRYPHVLPYDHSRVRLalldg.........K..PH...........SDYINASFIPGY-......-THPQ
ENSBTAP00000004985  EKEENVKKNRYKDILPFDHSRVKLtlktp.........S..QD...........SDYINANFIKGV-......-YGPK
ENSBTAP00000017076  KKKDKVKGGRQEPMPAYDRHRVKLhpmlg.........D..PD...........ADYINANYIDGY-......-HRSN
ENSBTAP00000019887  NELHNRDKNRYRDILPYDSTRVPL..............G..-N...........KDYINASYIKIAN......SREEY
ENSBTAP00000026136  ERPKNIKKNRYKDILPYDHSLVELcmits.........D..ED...........SSYINANFIKGV-......-YGPK
ENSBTAP00000019182  ------------------------..............-..--...........-------------......-----
ENSBTAP00000018336  QGEGNIKKNRHPDFLPYDHARIKLkvess.........P..SR...........SDYINASPIIEHD......-PRMP
ENSBTAP00000020359  DIPRHGTKNRYKTILPNPLSRVCLrpknvt........D..SL...........STYINANYIRGYS......-GKEK
ENSBTAP00000024750  RLPENAERNRFQDVLPYDDARVELvptk..........E..NN...........TGYINASHIKVSV......SGIEW
ENSBTAP00000028717  ALPENAERSRIREVVPYEENRVELiptk..........E..NN...........TGYINASHIKVVV......GGAEW
ENSBTAP00000026996  DIPGLVRKNRYKTILPNPHSRVCLtspdpd........D..PL...........SSYINANYIRGYG......-GEEK
ENSBTAP00000015484  SRPENVRKNRYKDVLPYDQTRVILsllqe.........E..GH...........GDYINGNFIRGT-......-DGSQ
ENSBTAP00000003923  DIPGHASKDRYKTILPNPQSRVCLgraqs.........Q..ED...........GDYINANYIRGYD......-GQDK
ENSBTAP00000050785  ---------------ADDHSRIRLksens.........H..SS...........SDYINASPIMDHD......-PRKP
ENSBTAP00000053528  ------------------------..............-..--...........-------------......-----
ENSBTAP00000053345  LLPRNHEKNRCMDILPPDRCLPFLitid..........G..ES...........SNYINAALMDSY-......-KQPS
ENSBTAP00000053498  CLPRNHDKNRFMDMLPPDRCLPFLitid..........G..ES...........SNYINAALMDSY-......-RQPA
ENSBTAP00000000401  LLPRNHDKNRSMDVLPLDRCLPFLisvd..........G..ES...........SNYINAALMDSH-......-KQPA
ENSBTAP00000017076  LLPRNRDKNRSMDVLPPDRCLPFLvstd..........G..DP...........NNYINAALTDSY-......-TRSA
ENSBTAP00000013320  NQEENKSKNRNSKIIPYDFNRVALkheletskeseqdsD..-EssdddsdleeiSRYINASFVMSY-......-WKPE
ENSBTAP00000016579  ------------------------..............-..--...........-------------......-----
ENSBTAP00000029213  QKECNKEKNRNSSVVPSERARVGLaplp..........Gm.KG...........TDYINASYIMGY-......-YRSN
ENSBTAP00000054347  QKECNKEKNRNSSVVPSERARVGLaplp..........Gm.KG...........TDYINASYIMGY-......-YRSN
ENSBTAP00000053776  LKQCNREKNRTSSIIPVERSRVGIssls..........G..EG...........ADYINASYIMGY-......-YQSN
ENSBTAP00000003600  IARCYSLKNRHQDVMPYDSNRVVLr.............S..GK...........DDYINASRVEGLS......-PYCP
ENSBTAP00000003532  ------------------------..............-..--...........-------------......-----
ENSBTAP00000008825  ------------------------..............-..--...........-------------......-----
ENSBTAP00000054725  ------------------------..............-..--...........-------------......-----
ENSBTAP00000052724  ------------------------..............-..--...........-------------......-----
ENSBTAP00000044476  ------------------------..............-..--...........-------------......-----
ENSBTAP00000015397  ------------------------..............-..--...........-------------......-----
ENSBTAP00000021830  ------------------------..............-..--...........-------------......-----
ENSBTAP00000005170  ------------------------..............-..--...........-------------......-----
ENSBTAP00000015397  EKAENGDLNW--------------..............-..--...........-------------......-IIPD
ENSBTAP00000008825  ERVENGDFNW--------------..............-..--...........-------------......-IVPG
ENSBTAP00000054725  ERVENGDFNW--------------..............-..--...........-------------......-IVPG
ENSBTAP00000018411  ------------------------..............-..--...........-------------......-----
ENSBTAP00000053215  ------------------------..............-..--...........-------------......-----
ENSBTAP00000000929  ------------------------..............-..--...........-------------......-----
ENSBTAP00000027120  ------------------------..............-..--...........-------------......-----
ENSBTAP00000013570  ------------------------..............-..--...........-------------......-----
ENSBTAP00000040594  ------------------------..............-..--...........-------------......-----
ENSBTAP00000027029  ------------------------..............-..--...........-------------......-----
ENSBTAP00000010955  ------------------------..............-..--...........-------------......-----
ENSBTAP00000002933  ------------------------..............-..--...........----------VT-......-YRNM
ENSBTAP00000012499  ------------------------..............-..--...........-------------......-----
ENSBTAP00000018426  ------------------------..............-..--...........-------------......-----
ENSBTAP00000002265  ------------------------..............-..--...........-------------......-----
ENSBTAP00000035646  ------------------------..............-..--...........-------------......-----
ENSBTAP00000048125  ------------------------..............-..--...........-----------S-......-YENM
ENSBTAP00000029212  ------------------------..............-..--...........-------------......-----
ENSBTAP00000003800  ------------------------..............-..--...........-------------......-----
ENSBTAP00000006022  ------------------------..............-..--...........-------------......-----
ENSBTAP00000003801  ------------------------..............-..--...........-------------......-----
ENSBTAP00000025062  ------------------------..............-..--...........-------------......-----
ENSBTAP00000031268  ------------------------..............-..--...........-------------......-----
ENSBTAP00000014625  ------------------------..............-..--...........-------------......-----
ENSBTAP00000056281  ------------------------..............-..--...........----------VS-......-YKNM
ENSBTAP00000039071  ------------------------..............-..--...........-------------......-----
ENSBTAP00000002365  ------------------------..............-..--...........-------------......-----
ENSBTAP00000054687  ------------------------..............-..--...........-------------......-----
ENSBTAP00000031268  ------------------------..............-..--...........-------------......-----
ENSBTAP00000027915  ------------------------..............-..--...........-------------......-----
ENSBTAP00000011856  ------------------------..............-..--...........-------------......-----
ENSBTAP00000007630  ------------------------..............-..--...........-------------......-----
ENSBTAP00000023205  ------------------------..............-..--...........-------------......-----
ENSBTAP00000006274  ------------------------..............-..--...........-------------......-----
ENSBTAP00000011408  ------------------------..............-..--...........-------------......-----
ENSBTAP00000011320  ------------------------..............-..--...........-------------......-----
ENSBTAP00000039412  ------------------------..............-..--...........-------------......-----
ENSBTAP00000028997  ------------------------..............-..--...........-------------......-----
ENSBTAP00000003229  ------------------------..............-..--...........-------------......-----
ENSBTAP00000012722  ------------------------..............-..--...........-------------......-----
ENSBTAP00000011320  ------------------------..............-..--...........-------------......-----
ENSBTAP00000012447  ------------------------..............-..--...........-------------......-----
ENSBTAP00000041263  ------------------------..............-..--...........-------------......-----
ENSBTAP00000025537  ------------------------..............-..--...........-------------......-----
ENSBTAP00000041032  ------------------------..............-..--...........-------------......-----
ENSBTAP00000009070  ------------------------..............-..--...........-------------......-----
ENSBTAP00000020200  ------------------------..............-..--...........-------------......-----
ENSBTAP00000055811  ------------------------..............-..--...........-------------......-----
ENSBTAP00000041416  ------------------------..............-..--...........-------------......-----


                      10                 120       130       140                                150 
                       |                   |         |         |                                  | 
d1wcha_               VYIACQGPL..........PTTVGDFWQMIWEQKSTVIAMMTQEVE....................GEKIK.....CQ
ENSBTAP00000022028  ---------..........---------------------------....................-----.....--
ENSBTAP00000018789  ---------..........---------------------------....................-----.....--
ENSBTAP00000012726  ---------..........---------------------------....................-----.....--
ENSBTAP00000048361  ---------..........---------------------------....................-GGCE.....CP
ENSBTAP00000004052  ---------..........---------------------------....................-----.....--
ENSBTAP00000030174  ---------..........---------------------------....................-----.....--
ENSBTAP00000048722  ---------..........---------------------------....................-----.....--
ENSBTAP00000046933  ---------..........---------------------------....................-----.....--
ENSBTAP00000004852  ---------..........---------------------------....................-----.....--
ENSBTAP00000019137  ---------..........---------------------------....................-----.....--
ENSBTAP00000042388  AYIATQGPL..........PETFGDFWRMVWEQRSATIVMMTRLEE....................KSRIK.....CD
ENSBTAP00000024046  AYIATQGPL..........PETMGDFWRMVWEQRTATVVMMTRLEE....................KSRVK.....CD
ENSBTAP00000028448  ---------..........---------------------------....................-----.....--
ENSBTAP00000013433  AYIATQGSL..........PETFGDFWRMIWEQRSATVVMMTKLEE....................RSRVK.....CD
ENSBTAP00000015189  KFIAAQGPK..........EETVNDFWRMIWEQNTATIVMVTNLKE....................RKECK.....CA
ENSBTAP00000006948  ---------..........---------------------------....................-----.....--
ENSBTAP00000003163  KFIAAQGPK..........QETVNDFRRMIWEQKCATIVMLTNLKE....................RKEEK.....CY
ENSBTAP00000053189  ---------..........---------------------------....................-----.....--
ENSBTAP00000053498  HYIATQGPV..........HETVYDFWRMIWQEQSACIVMVTNLVE....................VGRVK.....CY
ENSBTAP00000034314  DFIATQGPL..........PNTLKDFWRMVWEKNVYAVVMLTKCVE....................QGRTK.....CE
ENSBTAP00000029213  AYIATQGPL..........KSTFEDFWRMIWEQNTGIIVMITNLVE....................KGRRK.....CD
ENSBTAP00000054347  AYIATQGPL..........KSTFEDFWRMIWEQNTGIIVMITNLVE....................KGRRK.....CD
ENSBTAP00000022588  AYIGTQGPL..........ENTYRDFWLMVWEQKVLVIVMTTRFEE....................GGRRK.....CG
ENSBTAP00000020345  EYIATQGPL..........PGTKDDFWKMAWEQNVHNIVMVTQCVE....................KGRVK.....CD
ENSBTAP00000013433  AYIATQGPL..........AETTEDFWRMLWEHNSTIVVMLTKLRE....................MGREK.....CH
ENSBTAP00000015189  SYIASQGPL..........FHTIEDFWRMIWEWKSCSIVMLTELEE....................RGQEK.....CA
ENSBTAP00000000401  HYIATQGPM..........QETVKDFWRMIWQENSASIVMVTNLVEvgrhpaghtvgnatlgraasPGMVK.....CV
ENSBTAP00000050372  EFIAAQGPL..........PQTVGDFWRMVWEQQSHTLVMLTNCVE....................SGRVK.....CE
ENSBTAP00000002653  SYIATQGCL..........QNTVNDFWRMVFQENSRVIVMTTKEVE....................RGKSK.....CV
ENSBTAP00000027046  TYIASQGCL..........EATVNDFWQMVWQENTCVIVMTTREVE....................KGRNK.....CV
ENSBTAP00000042388  AYIATQGPL..........AETTEDFWRMLWENNSTIVVMLTKLRE....................MGREK.....CH
ENSBTAP00000053776  AYIAAQGPL..........KSTAEDFWRMIWEHNVEVIVMITNLVE....................KGRRK.....CD
ENSBTAP00000053345  HYIATQGPM..........QETISDFWRMVWHENTASIVMVTNLVE....................VGRVK.....CC
ENSBTAP00000013320  KYIAAQGPR..........DETVDDFWRMIWEQKATVIVMVTRCEE....................GNKNK.....CA
ENSBTAP00000024046  AYIATQGPL..........AESTEDFWRMLWEHNSTIIVMLTRLRE....................MGREK.....CH
ENSBTAP00000008678  SYILTQGPL..........PNTCGHFWEMVWEQKSRGVVMLNRVME....................KGSLK.....CA
ENSBTAP00000003163  YFIATQGPL..........AHTVEDFWRMVWEWKCHTIVMLTEVQE....................REQDK.....CY
ENSBTAP00000025085  KYIAAQGPL..........PHTCAQFWQVVWDQKLSLIVMLTTLTE....................RGRTK.....CH
ENSBTAP00000030443  EYIATQGPL..........PETRNDFWKMVLQQKSQIIVMLTQCNE....................KRRVK.....CD
ENSBTAP00000042825  QYIACQGPL..........PHTCTDFWQMTWEQGSSMVVMLTTQVE....................RGRVK.....CH
ENSBTAP00000019901  VYIACQGPL..........PTTVGDFWQMIWEQNSSVIAMMTQEVE....................GEKIK.....CQ
ENSBTAP00000045240  EFIATQGPL..........PGTVGDFWRMVWETRAKTLVMLTQCFE....................KGRIR.....CH
ENSBTAP00000013969  SYILTQGPL..........PNTGCHFWLMVWQQKTKAVVMLNRIVE....................KDSVK.....CA
ENSBTAP00000033929  VYIATQGCL..........PTTVAAFWAMVHQENTHVIVMTTREVE....................RGRNK.....CF
ENSBTAP00000055241  EFIATQGPL..........KKTLADFWRLVWEQQVHVIVMLTVGME....................NGRVL.....CE
ENSBTAP00000004985  AYVATQGPL..........ANTVIDFWRMIWEYNVVIIVMACREFE....................MGRKK.....CE
ENSBTAP00000017076  HFIATQGPK..........PEMVYDFWRMVWQEHCSSIVMITKLVE....................VGRVK.....CS
ENSBTAP00000019887  YYIATQGPL..........PTTTNDFWQMVCENNS-VIVMITKEKE....................GG-VK.....CH
ENSBTAP00000026136  TYIATQGPL..........PTTVLDFWRMIWEYSILIIVMACMEFE....................MGKKK.....CE
ENSBTAP00000019182  ------Y--..........---------------------------....................-----.....--
ENSBTAP00000018336  AYIATQGPL..........SHTIADFWQMVWESGCTVIVMLTPLVE....................DGVKQ.....CD
ENSBTAP00000020359  AFIATQGPM..........INTVNDFWQMVWQEDSPVIVMITKLKE....................KN-EK.....CV
ENSBTAP00000024750  DYIATQGPL..........QNTCPDFWQMVWEQGIAIIAMVTAEEE....................GGREK.....SF
ENSBTAP00000028717  HYIATQGPL..........PHTCHDFWQMVWEQGANVIAMVTAEEE....................GGRTK.....SH
ENSBTAP00000026996  VYIATQGPI..........VSTVGDFWRMVWQEHTPIIVMITNIEE....................MN-EK.....CT
ENSBTAP00000015484  AYIATQGPL..........PHTLLDFWRLIWEFGVKVILMACQEME....................NGRKK.....CE
ENSBTAP00000003923  AYIATQGPM..........PNTVSDFWEMVWQEEAPLIIMLTQLRE....................GK-EK.....CV
ENSBTAP00000050785  AYIATQGPL..........PSTVADFWQMVWESGCVVVVMLTPLAE....................NGVRQ.....CY
ENSBTAP00000053528  ---------..........---------------------------....................---V-.....--
ENSBTAP00000053345  AFIVTQHPL..........PNTVKDFWRLVLDYHCTSVVMLNDVDP....................A--QL.....CP
ENSBTAP00000053498  AFIVTQYPL..........PNTVKDFWRLVYDYGCTSIVMLNEVDL....................S--QG.....CP
ENSBTAP00000000401  AFVVTQHPL..........PNTVADFWRLVFDYNCSSVVMLNELDT....................A--QL.....CM
ENSBTAP00000017076  AFIVTLHPL..........QSTTPDFWRLVYDYGCTSIVMLNQLHQs...................NSAWP.....CP
ENSBTAP00000013320  VMIAAQGPL..........KETIGDFWQMVFQRKVRVIVMLTELKS....................GDKEA.....CA
ENSBTAP00000016579  ---------..........---------------------------....................-----.....--
ENSBTAP00000029213  EFIITQHPL..........PHTTKDFWRMIWDHNAQIIVMLPDNQS....................LA-ED.....EF
ENSBTAP00000054347  EFIITQHPL..........PHTTKDFWRMIWDHNAQIIVMLPDNQS....................LA-ED.....EF
ENSBTAP00000053776  EFIITQHPL..........LHTIQDFWRMIWDHNAQLVVMLPDGQN....................MA-ED.....EF
ENSBTAP00000003600  PLVATQAPL..........PGTAADFWLMVHEQKVSVIVMLVSEAE....................MEKQK.....VA
ENSBTAP00000003532  ---------..........---------------------------....................-----.....--
ENSBTAP00000008825  ---------..........---------------------------....................-----.....--
ENSBTAP00000054725  ---------..........---------------------------....................-----.....--
ENSBTAP00000052724  ---------..........---------------------------....................-----.....--
ENSBTAP00000044476  ---------..........---------------------------....................-----.....--
ENSBTAP00000015397  ---------..........---------------------------....................-----.....--
ENSBTAP00000021830  ---------..........---------------------------....................-----.....--
ENSBTAP00000005170  ---------..........---------------------------....................-----.....--
ENSBTAP00000015397  RFLAFCGPHsrtrlesgyhQHSPEAYIPYFKNHNVTTVIRLNKRMY....................D----.....-A
ENSBTAP00000008825  KFLAFSGPHpkskiengypLHAPEAYFPYFKKHNVTAVVRLNKKIY....................E----.....-A
ENSBTAP00000054725  KFLAFSGPHpkskiengypLHAPEAYFPYFKKHNVTAVVRLNKKIY....................E----.....-A
ENSBTAP00000018411  ---------..........---------------------------....................-----.....--
ENSBTAP00000053215  ---------..........---------------------------....................-----.....--
ENSBTAP00000000929  ---------..........---------------------------....................-----.....--
ENSBTAP00000027120  ---------..........---------------------------....................-----.....--
ENSBTAP00000013570  ---------..........---------------------------....................-----.....--
ENSBTAP00000040594  ---------..........---------------------------....................-----.....--
ENSBTAP00000027029  ---------..........---------------------------....................-----.....--
ENSBTAP00000010955  ---------..........---------------------------....................-----.....--
ENSBTAP00000002933  RFLITHNPT..........NATLSKFIEELKKYGVTTIVRVCEATY....................DTT--.....--
ENSBTAP00000012499  ---------..........---------------------------....................-----.....--
ENSBTAP00000018426  ---------..........---------------------------....................-----.....--
ENSBTAP00000002265  ---------..........---------------------------....................-----.....--
ENSBTAP00000035646  ---------..........---------------------------....................-----.....--
ENSBTAP00000048125  RFLITHNPT..........NATLNKFTEELKKYGVTTLVRVCDATY....................DK---.....--
ENSBTAP00000029212  ---------..........---------------------------....................-----.....--
ENSBTAP00000003800  ---------..........---------------------------....................-----.....--
ENSBTAP00000006022  ---------..........---------------------------....................-----.....--
ENSBTAP00000003801  ---------..........---------------------------....................-----.....--
ENSBTAP00000025062  ---------..........----------------DYILNVTREID....................NFF--.....--
ENSBTAP00000031268  ---------..........---------------------------....................-----.....--
ENSBTAP00000014625  ---------..........------------NRGVRYILNVTREID....................NFF--.....--
ENSBTAP00000056281  RFLITHNPT..........NATLSSFIEDLKKYGATTVVRVCEVTY....................DK---.....--
ENSBTAP00000039071  ---------..........---------------------------....................-----.....--
ENSBTAP00000002365  ---------..........---------------------------....................-----.....--
ENSBTAP00000054687  ------GPY..........SSAMKSKLPILQKHGITHIICIRQNIE....................ANFIKpnfqqLF
ENSBTAP00000031268  ---------..........---------------------------....................-----.....--
ENSBTAP00000027915  ---------..........---------------------------....................-----.....--
ENSBTAP00000011856  ---------..........---------------------------....................-----.....--
ENSBTAP00000007630  ---------..........------------SHGIKSIINLQRPGEhascgnp.............LEQES.....GF
ENSBTAP00000023205  ---------..........---------------------------....................-----.....--
ENSBTAP00000006274  ---------..........------HYQFLLDQGVRHLVSLTERGP....................P----.....--
ENSBTAP00000011408  ---------..........---------------------------....................-----.....--
ENSBTAP00000011320  ---------..........---------------------------....................-----.....--
ENSBTAP00000039412  ---------..........--------RLVQDENVRGVITMNEEYE....................TR---.....--
ENSBTAP00000028997  ---------..........---------------------------....................-----.....--
ENSBTAP00000003229  ---------..........---------------------------....................-----.....--
ENSBTAP00000012722  ---------..........---------------------------....................-----.....--
ENSBTAP00000011320  ---------..........---------------------------....................-----.....--
ENSBTAP00000012447  ---------..........---------------------------....................-----.....--
ENSBTAP00000041263  ---------..........---------------------------....................-----.....--
ENSBTAP00000025537  ---------..........---------------------------....................-----.....--
ENSBTAP00000041032  ---------..........---------------------------....................-----.....--
ENSBTAP00000009070  ---------..........---------------------------....................-----.....--
ENSBTAP00000020200  ---------..........---------------------------....................-----.....--
ENSBTAP00000055811  ---------..........---------------------------....................-----.....--
ENSBTAP00000041416  ---------..........---------------------------....................-----.....--


                             160         170            180       190                         200   
                               |           |              |         |                           |   
d1wcha_               RYWPNIL.GKTTMVSN..RLRLALVRMQQ.....LKGFVVRAMTLED...IQ...........TR..EV..RHISHLN
ENSBTAP00000022028  -------.--------..-----------.....-------------...--...........--..--..-WLSNLE
ENSBTAP00000018789  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000012726  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000048361  EYYPNC-.--EVVFMG..MANI-------.....--HSIRRSF----...--...........--..--..-QSLRLL
ENSBTAP00000004052  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000030174  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000048722  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000046933  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000004852  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000019137  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000042388  QYWPNR-.--GTETYG..FIQVTLLDTIE.....LATFCVRTFSLHK...SG...........SS..EK..REVRQFQ
ENSBTAP00000024046  QYWPAR-.--GTETYG..LIQVTLLDTVE.....LATYTVRTFALYK...SG...........SS..EK..RELRQFQ
ENSBTAP00000028448  -------.--------..-----------.....-YHHVSRRFRTFL...LD...........SD..YE..RIELGLL
ENSBTAP00000013433  QYWPSR-.--GTETHG..LVQVTLLDTVE.....LATYCVRTFALYK...NG...........SS..EK..REVRQFQ
ENSBTAP00000015189  QYWPDQ-.--GCWTYG..NIRVSVEDVTV.....LVDYTVRKFCIQQ...VGdvtn.......RK..PQ..RLITQFH
ENSBTAP00000006948  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000003163  QYWPDQ-.--GCWTYG..NIRVCVEDCAV.....LVDYTIRKFCIQSqlpDG...........CK..AP..RLVCQLH
ENSBTAP00000053189  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000053498  KYWPD--.--DTEVYG..DFKVTCVEMEP.....LAEYVVRTFTLER...RG...........YN..EI..REVKQFH
ENSBTAP00000034314  EYWPSK-.--QAQDYG..DITVAMTSEIV.....LPEWTIRDFTVKN...TP...........TS..ES..HPLRQFH
ENSBTAP00000029213  QYWPTE-.--NSEEYG..NIIVTLKSTKV.....HACYTVRHFSVRN...TKvkkgqkgnpkgRQ..NE..RVVIQYH
ENSBTAP00000054347  QYWPTE-.--NSEEYG..NIIVTLKSTKV.....HACYTVRHFSVRN...TKvkkgqkgnpkgRQ..NE..RVVIQYH
ENSBTAP00000022588  QYWPLEK.D-SRIRFG..FLTVTNLGVEN.....MTHYKKTTLEIHN...IE...........ER..QK..RQVTHFQ
ENSBTAP00000020345  HYWPAD-.-QDSLYYG..DLILQMLSESV.....LPEWTIREFRICS...EE...........QLd.AH..RLIRHFH
ENSBTAP00000013433  QYWPAE-.--RSARYQ..YFVVDPMAEYN.....MPQYILREFKVTD...AR...........DG..QS..RTVRQFQ
ENSBTAP00000015189  QYWPSD-.--GLVSYG..DITVELKKEEE.....CESYTVRDLLVTN...TR...........EN..KS..RQIRQFH
ENSBTAP00000000401  RYWPD--.--DTEVYG..DIKVTLIETEP.....LAEYVIRTFTVQK...KG...........YH..EI..RELRLFH
ENSBTAP00000050372  HYWPLD-.-AQPFTHG..HLQVTLVGEEV.....AENWAVRNLKLCH...VQ...........QQ..KT..LPVRQFH
ENSBTAP00000002653  KYWPDE-.-YALKEYG..VMRVRNVKESA.....AHDYTLRELKLSK...VG...........QG..NTe.RTVWQYH
ENSBTAP00000027046  PYWPEV-.-GSQRVYG..PYTVTNCGEHD.....TTEYKLRNLQVSP...LE...........NE..NLi.REIWHYQ
ENSBTAP00000042388  QYWPAE-.--RSARYQ..YFVVDPMAEYN.....MPQYILREFKVTD...AR...........DG..QS..RTVRQFQ
ENSBTAP00000053776  QYWPVD-.--GSEEYG..NFLVTQKSIQV.....LAYYTVRNFTLRN...TKikkgsqkg...RP..SG..RVVTQYH
ENSBTAP00000053345  KYWPD--.--DTEIYK..DIKVTLIETEL.....LAEYVIRTFAVEK...RG...........VH..EI..REIRQFH
ENSBTAP00000013320  EYWPSMD.E-GSRVYG..DVIVEINEHKR.....CPDYIIQKLTVGN...RK...........EK..ASg.RAVTHIQ
ENSBTAP00000024046  QYWPAE-.--RSARYQ..YFVVDPMAEYN.....MPQYILREFKVTD...AR...........DG..QS..RTIRQFQ
ENSBTAP00000008678  QYWPQKE.E-REMVFEdtNLKLTLISEDI.....KSYYTVRQLELEN...LM...........SR..ET..REILHFH
ENSBTAP00000003163  QYWPTE-.--GSVTHG..EITIEIKSDTL.....SEAISIRDFLVTF...NQplarp......EE..QT..RVVRQFH
ENSBTAP00000025085  QYWPDP-.-PDVMEHG..SFHIRCQSEDC.....TIAYVFREMLVTN...TE...........TG..EE..HTVTHLQ
ENSBTAP00000030443  HYWPFT-.-EEPIAYG..DITVEMMSEEE.....QDDWACRHFRINY...--...........AD..EM..QDVMHFN
ENSBTAP00000042825  QYWPEP-.-TGSSSYG..CYQVTCHSEEG.....NTAYVFRKMTLFN...QE...........KN..ES..RPLTQIQ
ENSBTAP00000019901  RYWPNVL.GKSTMVSN..RLRLALVRVQQ.....LKGFVVRAMTLED...IQ...........TG..EV..RHVSHLN
ENSBTAP00000045240  QYWPEDN.K-PVTVFG..DIVITKLMEDV.....QIDWTIRDLKIER...--...........HG..DC..MTIRQCN
ENSBTAP00000013969  QYWPTKD.D-REMLFKetGFSVKFLSEDV.....KSYYTVHLLQLGN...TR...........TG..ET..RTISHFH
ENSBTAP00000033929  RYWPEL-.-HGSQEYG..HLHVCNMAEHW.....AQGYCVRELQVWR...PD...........QE..ESp.HTVKHYQ
ENSBTAP00000055241  HYWPAD-.-SSPVTHG..PVTICLLAEQP.....QDEWTTREFQLHH...AA...........QQ..QL..RRVKQLQ
ENSBTAP00000004985  RYWPLFG.E-DPITFA..PFKISCEAEQA.....RTDYFIRTLLLEF...--...........QN..ES..RRLYQFH
ENSBTAP00000017076  RYWPE--.--DSDMYG..DIKITLVKTET.....LAEYVVRSFALER...RG...........YS..AR..HEVRQFH
ENSBTAP00000019887  HYWPISM.K-KPLELN..SCRIFLENYQI.....LRYFIIRMFQVVK...KS...........TG..AS..HFVKHLQ
ENSBTAP00000026136  RYWAEPG.D-TQLQLG..PFSISCEAENR.....KSDYTIRTLKAKF...--...........NS..ET..RTIYQFH
ENSBTAP00000019182  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000018336  RYWPDE-.--GSSLYH..VYEVNLVSEHIw....CEDFLVRSFYLKN...VQ...........TQ..ET..RTLTQFH
ENSBTAP00000020359  LYWPEKR.G----IYG..KVEVLVISVNE.....CDNYTVRNLVLKQ...--...........GS..HT..QRVKHYW
ENSBTAP00000024750  RYWPRLGsRHNTVTYG..RFKITTRFRTD.....SGCYATTGLKMKH...LL...........SG..QE..RTIWHLQ
ENSBTAP00000028717  RYWPKLGsKHSSATYG..KFKVTTKFRTD.....SGCYATTGLKVKH...LL...........SG..QE..RTVWHLQ
ENSBTAP00000026996  EYWPE--.--EQVVYD..GVEITVRKVIH.....TEDYRLRLIALRS...--...........GT..EE..RGLKHYW
ENSBTAP00000015484  RYWALQ-.-QEPLQIG..PFCITLTRDMWl....NPDIKLRILQVTF...--...........QK..ES..RSVFQLQ
ENSBTAP00000003923  HYWPTEE.E----TYG..PFRIRVQDVRE.....RPEYTVRTLTIQH...--...........QE..QR..RALKHIL
ENSBTAP00000050785  RYWPDE-.--GSSLYH..IYEVHLVSEHIw....CEDFLVRSFYLKN...LQ...........TS..ET..RTVTQFH
ENSBTAP00000053528  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000053345  QYWPEN-.--GVHRHG..PIQVEFVSADL.....EEDIISRIFRIYN...AA...........RPqdGY..RMVQQFQ
ENSBTAP00000053498  QYWPEE-.--GTLRYG..PIQVECMSCSM.....DCDVINRIFRICN...LT...........RP..QEgyLMVQQFQ
ENSBTAP00000000401  QYWPEK-.--TSGCYG..PIQVEFVSADI.....DEDIIHRIFRICN...MA...........RPqdGY..RIVQHLQ
ENSBTAP00000017076  QYWPEP-.--GRQQYG..LMEVEFVSGTA.....DEDLVARVFRVQN...IS...........RM..QEghLLVRHFQ
ENSBTAP00000013320  QYWEE--.--GKQAYG..DVEVHMKDTNK.....SSAYTVRAFELRH...SK...........RK..DP..RTVYQYQ
ENSBTAP00000016579  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000029213  VYWPSR-.-EESMNCE..AFTVTLISKDRlclsnEEQIIIHDFILEA...TQ...........DD..YV..LEVRHFQ
ENSBTAP00000054347  VYWPSR-.-EESMNCE..AFTVTLISKDRlclsnEEQIIIHDFILEA...TQ...........DD..YV..LEVRHFQ
ENSBTAP00000053776  VYWPNK-.-DEPINCE..SFKVTLMAEEHkclsnEEKLIMQDFILEA...TQ...........DD..YV..LEVRHFQ
ENSBTAP00000003600  RYFPTER.G-QPMVHG..ALSLALSSVRT.....TETHVERVLSLQF...RD...........QS..LK..RSLVHLH
ENSBTAP00000003532  -------.--------..-----------.....-------------...--...........--..EG..IKYIKLQ
ENSBTAP00000008825  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000054725  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000052724  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000044476  -YKPEEL.PENFPYLK..IYTV-------.....-------------...--...........--..--..-------
ENSBTAP00000015397  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000021830  -------.--------..-----------.....-------------...--...........--..--..-EGLGIR
ENSBTAP00000005170  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000015397  KRFTNA-.--GFDHYD..LFF--------.....-------------...--...........--..--..-------
ENSBTAP00000008825  KRFTDA-.--GFEHYD..LFFI-------.....-------------...--...........--..--..-------
ENSBTAP00000054725  KRFTDA-.--GFEHYD..LFFI-------.....-------------...--...........--..--..-------
ENSBTAP00000018411  -------.--------..-----------.....-------------...--...........--..-N..HFEGHYQ
ENSBTAP00000053215  -------.--------..-----------.....-------------...--...........--..PN..HFEGHYQ
ENSBTAP00000000929  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000027120  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000013570  -------.--------..-----------.....-------------...--...........--..--..----QFE
ENSBTAP00000040594  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000027029  -------.--------..-----------.....--------LNVSR...RT...........SE..AC..TMHLHYK
ENSBTAP00000010955  -------.--------..-----------.....-------------...--...........--..--..-----FH
ENSBTAP00000002933  --LVEKE.G-------..-----------.....-------------...--...........--..--..-----IH
ENSBTAP00000012499  -------.--------..--VVRFLDSKH.....KNHYKIYNLCAER...HY...........DT..AK..FNCRVAQ
ENSBTAP00000018426  -------.--------..------WDE--.....-------------...--...........--..--..-------
ENSBTAP00000002265  -------.--------..-----------.....---YEKGLFNYKR...--...........--..--..-----LP
ENSBTAP00000035646  -------.--------..--VVRFLDTKH.....PNHYQVYNLCSER...AY...........DP..KY..FHHRVHR
ENSBTAP00000048125  -------.--APVEKE..G----------.....-------------...--...........--..--..-----IH
ENSBTAP00000029212  -------.--------..-----------.....-------------...--...........--..--..-----FT
ENSBTAP00000003800  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000006022  -------.--------..-----------.....-------------...--...........--..--..------K
ENSBTAP00000003801  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000025062  ---P---.--GLFAYH..NIRV-------.....-------------...--...........--..--..-------
ENSBTAP00000031268  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000014625  ---P---.--GVFEYH..NIRV-------.....-------------...--...........--..--..-------
ENSBTAP00000056281  -------.--APLEKD..GITV-------.....-------------...--...........--..--..-------
ENSBTAP00000039071  -------.--------..-----------.....-------------...--...........--..--..-----VK
ENSBTAP00000002365  -------.--------..-----------.....-------------...--...........--..--..---EDIQ
ENSBTAP00000054687  RYLVLD-.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000031268  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000027915  -------.--------..-----------.....---FIYKNI----...--...........--..--..------S
ENSBTAP00000011856  -------.--------..-----------.....---ITYLRISVAD...--...........--..--..-------
ENSBTAP00000007630  TYLPE--.--AFMEAG..IYF--------.....-------------...--...........--..--..------Y
ENSBTAP00000023205  -------.--------..-----------.....-------------...--...........--..--..-----IH
ENSBTAP00000006274  -------.--------..-----------.....-------------...--...........HS..DS..CPGLTLH
ENSBTAP00000011408  -------.--------..-----------.....-------------...--...........--..--..---LEIQ
ENSBTAP00000011320  -------.--------..-----------.....-------------...--...........--..--..---LTYH
ENSBTAP00000039412  -FLCN--.--------..-----SS----.....-------------...-K...........EW..EK..AGVEQLR
ENSBTAP00000028997  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000003229  -------.-------G..NYLLFNLSERR.....PDITKLHAKVLEF...--...........--..--..-------
ENSBTAP00000012722  -------.-------D..NYLVLNLSEK-.....------------R...--...........YD..LT..KLNPKIL
ENSBTAP00000011320  -------.--------..-----------.....-------------...--...........--..--..--SYRYH
ENSBTAP00000012447  -------.--------..-----------.....-------------...--...........--..--..--LLHIQ
ENSBTAP00000041263  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000025537  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000041032  -------.--DSRHLD..HYTVYNLSPKS.....YRTAKFHSRVSE-...--...........--..--..-------
ENSBTAP00000009070  -------.--------..-----------.....----LLFNLSEKR...--...........HD..LT..RLNPKVQ
ENSBTAP00000020200  -------.--------..-----------.....-------------...--...........--..--..-----YI
ENSBTAP00000055811  -------.--------..-----------.....-------------...--...........--..--..-------
ENSBTAP00000041416  -------.--------..-----------.....-------------...--...........--..--..-------


                            210            220       230                                    240     
                              |              |         |                                      |     
d1wcha_               FTAWP..DHDTPSQ.....PDDLLTFISYMRHIH...............RS............GPIITHC..SAGIGR
ENSBTAP00000022028  STHW-..----LEH.....IKLILAGALRIADRVes.............GK............TSVVVHC..SDGWDR
ENSBTAP00000018789  --HW-..----LEH.....IKLVLTGAIQVADRVss.............GK............SSVVVHC..SDGWDR
ENSBTAP00000012726  -----..-------.....-------VRIADKVEs..............GK............TSVVVHC..SDGWDR
ENSBTAP00000048361  CTQMP..DPGNWLS.....ALESTKWLHHLSVLLksallvvhavdr...DQ............RPVLAHC..SDGWDR
ENSBTAP00000004052  -----..------H.....IKAVMDAAIFLAKAIaa.............ES............ASVLVHC..SDGWDR
ENSBTAP00000030174  --KW-..----LQH.....LSVMLKAAVLVANTVdr.............EG............RPVLVHC..SDGWDR
ENSBTAP00000048722  -----..-------.....--------IFIAKAVse.............EG............ASVLVHC..SDGWDR
ENSBTAP00000046933  -----..-------.....----------IAKAVkv.............EK............TNVLVHC..SDGWDR
ENSBTAP00000004852  -----..-------.....---------------...............--............-------..--G---
ENSBTAP00000019137  -----..-------.....---------------...............EG............ACILVHG..AEGTDS
ENSBTAP00000042388  FTAWP..DHGVPEY.....PTPFLAFLRRVKTCN...............PPda..........GPIVVHC..SAGVGR
ENSBTAP00000024046  FMAWP..DHGVPEY.....PTPILAFLRRVKACNpl.............DA............GPMVVHC..SAGVGR
ENSBTAP00000028448  YEEKG..DRRAPQA.....CRSVWEYVE------...............--............-------..------
ENSBTAP00000013433  FTAWP..DHGVPEH.....PTPFLAFLRRVKTCN...............PPda..........GPMVVHC..SAGVGR
ENSBTAP00000015189  FTSWP..DFGVPFT.....PIGMLKFLKKVKACN...............PQya..........GAIVVHC..SAGVGR
ENSBTAP00000006948  -----..-------.....---------V-----...............--............-------..------
ENSBTAP00000003163  FTSWP..DFGVPFT.....PIGMLKFLKKVRTLNpa.............HA............GPIVVHC..SAGVGR
ENSBTAP00000053189  -----..-------.....---------V-----...............--............-------..------
ENSBTAP00000053498  FTGWP..DHGVPYH.....ATGLLSFIRRVKFSN...............PPsa..........GPIVVHC..SAGAGR
ENSBTAP00000034314  FTSWP..DHGVPDT.....TDLLINFRYLVRDYMkqsp...........PE............SPILVHC..SAGVGR
ENSBTAP00000029213  YTQWP..DMGVPEY.....ALPVLTFVRRSSAARt..............PEm...........GPVLVHC..SAGVGR
ENSBTAP00000054347  YTQWP..DMGVPEY.....ALPVLTFVRRSSAARt..............PEm...........GPVLVHC..SAGVGR
ENSBTAP00000022588  FLSWP..DYGVPSS.....AASLIDFLRAVRNQQrlavssmgarakgqcPE............PPIVVHC..SAGIGR
ENSBTAP00000020345  YTVWP..DHGVPES.....TQSLIQFVRTVRDYInrt............PGa...........GPTVVHC..SAGVGR
ENSBTAP00000013433  FTDWP..EQGVPKS.....GEGFIDFIGQVHKTKeqfg...........QD............GPISVHC..SAGVGR
ENSBTAP00000015189  FHGWP..EVGIPSD.....GKGMISIIAAVQKQQqqs............GN............HPITVHC..SAGAGR
ENSBTAP00000000401  FTSWP..DHGVPCY.....ATGLLGFVRQVKFLNpp.............EA............GPIVVHC..SAGAGR
ENSBTAP00000050372  YMTWP..DHGVPHS.....PDPLLAFWRMLRQWLdqtv...........GG............GPPIVHC..SAGVGR
ENSBTAP00000002653  FRTWP..DHGVPSD.....PGGVLDFLEEVHHKQ...............ESivda........GPVVVHC..SAGIGR
ENSBTAP00000027046  YLSWP..DHGVPSE.....PGGVLSFLDQINQRQ...............ESlpha........GPIIVHC..SAGIGR
ENSBTAP00000042388  FTDWP..EQGVPKS.....GEGFIDFIGQVHKTKeqfg...........QD............GPITVHC..SAGVGR
ENSBTAP00000053776  YTQWP..DMGVPEY.....SLPVLTFVRKASHAK...............RHav..........GPVVVHC..SAGVGR
ENSBTAP00000053345  FTGWP..DHGVPYH.....ATGLLGFVRQVKSKSp..............PNa...........GPLVVHC..SAGAGR
ENSBTAP00000013320  FTSWP..DHGVPED.....PHLLLKLRRRVNAFSnf.............FS............GPIVVHC..SAGVGR
ENSBTAP00000024046  FTDWP..EQGVPKT.....GEGFIDFIGQVHKTKeqfg...........QD............GPITVHC..SAGVGR
ENSBTAP00000008678  YTTWP..DFGVPES.....PASFLNFLFKVRESGslsr...........EH............GPIVVHC..SAGIGR
ENSBTAP00000003163  FHGWP..EIGIPAE.....GKGMIDLIAAVQKQQqqt............GN............HPITVHC..SAGAGR
ENSBTAP00000025085  YVAWP..DHGVPDD.....SSDFLEFVNYVRSLRv..............DG............EPVLVHC..SAGIGR
ENSBTAP00000030443  YTAWP..DHGVPTAna...AESILQFVHKVRQQAmk.............SK............GPMIVHC..SAGVGR
ENSBTAP00000042825  YIAWP..DHGVPDD.....SSDFLDFVCHVRNKRag.............KE............EPIVVHC..SAGIGR
ENSBTAP00000019901  FTAWP..DHDTPSQ.....PDDLLTFISYMRHVH...............RS............GPIITHC..SAGIGR
ENSBTAP00000045240  FTAWP..EHGVPEN.....SAPLVHFVKLVRASRah.............DT............TPMIVHC..SAGVGR
ENSBTAP00000013969  YTTWP..DFGVPES.....PASFLNFLFKVRESGslnp...........EH............GPAVIHC..SAGIGR
ENSBTAP00000033929  YFSWP..DHGVPAE.....PTGVLSFLEEVNRTHssm............PGa...........GPMVVHC..SAGIGR
ENSBTAP00000055241  FTTWP..DHSVPEA.....PSSLLAFVELAREQAraav...........GA............GPLLVHC..SAGVGR
ENSBTAP00000004985  YVNWP..DHDVPSS.....FDSILDMISLMRKYQeh.............ED............VPICIHC..SAGCGR
ENSBTAP00000017076  FTAWP..EHGVPYH.....ATGLLAFIRRVKAST...............PPda..........GPVVIHC..SAGTGR
ENSBTAP00000019887  FTNWP..DHGTPAS.....AEGFIKYVRYVRKSH...............LT............GPVVVHC..SAGVGR
ENSBTAP00000026136  YKNWP..DHDVPSS.....IDPILELIWDVRCYQdd.............NS............VPICIHC..SAGCGR
ENSBTAP00000019182  -----..-------.....---------------...............--............-------..------
ENSBTAP00000018336  FLSWP..AEGTPAS.....TRPLLDFRRKVNKCYrg.............RS............CPIIVHC..SDGAGR
ENSBTAP00000020359  YTSWP..DHKTPDS.....AQPLLQLMLDVEEDRlasa...........GR............GPVVVHC..SAGIGR
ENSBTAP00000024750  YTDWP..EHGCPED.....LKGFLSYLEEIQSVRrhtnsasepqs....PN............PPLLVHC..SAGVGR
ENSBTAP00000028717  YTDWP..DHGCPED.....VQGFLSYLEEIQSVR...............RHtnsmlegtrnlrPPIVVHC..SAGVGR
ENSBTAP00000026996  FTSWP..DQKTPDR.....APPLLHLVREVEEAA...............QQegphc.......APIVVHC..SAGIGR
ENSBTAP00000015484  YMSWP..DRGVPSN.....PDNVLAMVEKARHLQgs.............GP............NPLCVHC..SAGCGR
ENSBTAP00000003923  FSAWP..DHQTPES.....AGPLLRLVAEVEDGPetga...........RS............GPIVVHC..SAGIGR
ENSBTAP00000050785  FLSWY..DQGVPSS.....TRSLLDFRRKVNKCFrg.............RS............CPIIVHC..SDGAGR
ENSBTAP00000053528  -----..-------.....---------------...............--............-------..------
ENSBTAP00000053345  FLGWPm.YRDTPVS.....KRSFLKLIRQVDKWQeeyng..........GE............GRTVVHC..LNGGGR
ENSBTAP00000053498  YLGWAs.HREVPGS.....KRSFLKLILQVEKWQeecee..........GE............GRTIIHC..LNGGGR
ENSBTAP00000000401  YIGWPa.YRDTPPS.....KRSLLKVVRRLEKWQeqcdg..........RE............GRAVVHC..LNGGGR
ENSBTAP00000017076  FLRWSa.YRDTPDS.....KKAFLHLLAAVDKWQaes............GD............GRTIVHC..LNGGGR
ENSBTAP00000013320  FNNWN..GEELPAE.....PKELVLMIQNLKQKLpkknsaegnkyh...RN............VPLLIHC..RDGSQQ
ENSBTAP00000016579  -----..-------.....---------------...............--............-------..------
ENSBTAP00000029213  CPKWP..NPDAP--.....ISSTFELINVIKEEAlt.............RD............GPTIVHD..EYGAVS
ENSBTAP00000054347  CPKWP..NPDAP--.....ISSTFELINVIKEEAlt.............RD............GPTIVHD..EYGAVS
ENSBTAP00000053776  CPKWP..NPDSP--.....ISKTFELISIIKEEAat.............RD............GPMIVHD..EHGGVT
ENSBTAP00000003600  FPTWP..ELGLPDS.....PSHLLRFIQEVHAHClhq............RPlh..........TPVVVHCsrSSGVGR
ENSBTAP00000003532  CKGHG..ECPTTEN.....TETFIRLCERFNERN...............PP............ELIGVHC..THGFNR
ENSBTAP00000008825  -----..-------.....---------------...............--............-------..------
ENSBTAP00000054725  -----..-------.....---------------...............--............-------..------
ENSBTAP00000052724  --DWS..QYQSWDL.....VQQTQNYLKLLLSIInnd............DD............SGLLVHC..ISGWDR
ENSBTAP00000044476  -----..GHQVPDD.....-DTIFKFKNAVNGFLrenkd..........ND............RLIGVHC..THGVNR
ENSBTAP00000015397  -----..-------.....---------------...............--............-------..------
ENSBTAP00000021830  YLGVE..AHDSPAFdmsvhFQAAADFIHRA---Lsq.............PG............GRILVHC..AVGVSR
ENSBTAP00000005170  -----..-------.....-AYFEKAADFIDQALaq.............KN............GRVLVHC..REGYSR
ENSBTAP00000015397  ----A..DGSTPTD.....-AIVKEFLDICENA-...............-E............GAIAVHC..KAGLGR
ENSBTAP00000008825  -----..DGSTPSD.....-NIVRRFLNICENT-...............-E............GAIAVHC..KAGLGR
ENSBTAP00000054725  -----..DGSTPSD.....-NIVRRFLNICENT-...............-E............GAIAVHC..KAGLGR
ENSBTAP00000018411  YKSIPveDNHKADIssw..FNEAIDFIDSIKNA-...............-G............GRVFVHC..QAGISR
ENSBTAP00000053215  YKCIPveDNHKADI.....SSWFMEAIEYIDAVKd..............CR............GRVLVHC..QAGISR
ENSBTAP00000000929  -----..-------.....LDKSVDFIEKAKAS-...............-N............GCVLVHC..LAGISR
ENSBTAP00000027120  -----..-------.....--EAIGFIDSVKNS-...............-G............GRVLVHC..QAGISR
ENSBTAP00000013570  YVKVPlaDMPHAPI.....GLYFDTVADKIHSVSr..............KH............GATLVHC..AAGVSR
ENSBTAP00000040594  -----..-------.....-AYFEKAADFIDQALaq.............KN............GRVLVHC..REGYSR
ENSBTAP00000027029  WIPVE..DSNAADI.....SSHFQEAIDFIDCVRe..............KG............GKVLVHC..EAGISR
ENSBTAP00000010955  YKQIPisDHWSQNL.....SQFFPEAIAFIDEALs..............QN............CGVLVHC..LAGVSR
ENSBTAP00000002933  VLDWPf.DDGAPPS.....NQIVDDWLSLVKIKFred............PG............CCIAVHC..VAGLGR
ENSBTAP00000012499  YPF-E..DHNPPQ-.....LELIKPFCEDLDQWLsed............DN............HVAAIHC..KAGKGR
ENSBTAP00000018426  ----E..SAQLLPH.....WKETHRFVEAARAQ-...............-G............TRVLVHC..KMGVSR
ENSBTAP00000002265  ATDSN..KQNLRQY.....FEEAFEFIEEAHQC-...............-G............KGLLIHC..QAGVSR
ENSBTAP00000035646  YLI-D..DHNVPS-.....LSEMLAFSMEVKEWMaqd............KD............NIIVVHC..KGGKGR
ENSBTAP00000048125  VLDWPf.DDGAPPP.....NQIVDDWLNLLKTKFree............PG............CCVAVHC..VAGLGR
ENSBTAP00000029212  YKQIPisDHWSQNL.....SQFFPEAISFIDEARs..............KK............CGVLVHC..LAGISR
ENSBTAP00000003800  -----..-------.....-YPAAAFIDAALRY-...............DH............NKILVHC..VMGRSR
ENSBTAP00000006022  YKQIPisDHWSQNL.....SQFFPEAISFIDEARg..............KN............CGVLVHC..LAGISR
ENSBTAP00000003801  -----..-------.....SVYFLPVARYIRSALsv.............PQ............GRVLVHC..AMGVSR
ENSBTAP00000025062  ----Y..DEETTDLlah..WNEAYHFINKAKRN-...............-H............SKCLVHC..KMGVSR
ENSBTAP00000031268  YLGVP..AHDLPE-.....FDISVYFSSAADFIHralst..........PG............AKVLVHC..VVGVSR
ENSBTAP00000014625  -YDEE..ATDLLAY.....WNDTYKFISKAKKH-...............-G............SKCLVHC..KMGVSR
ENSBTAP00000056281  -VDWPf.DDGAPPP.....GKVVEDWLSLLKNKFcdd............PG............SCVAVHC..VAGLGR
ENSBTAP00000039071  YLCIP..AADSPSQnl...TRHFKESIKFIHECRl..............QG............EGCLVHC..LAGVSR
ENSBTAP00000002365  YVKVP..LADAPNSr....LYDFFDFIADHIHSVem.............KQ............GRTLLHC..AAGVSR
ENSBTAP00000054687  ---IA..DNP----.....VENIIRFFPMTKEFIdeslq..........SG............GKVLVHG..NAGISR
ENSBTAP00000031268  -----..-------.....SVYFLPVARYIRSALsv.............PQ............GRVLVHC..AMGVSR
ENSBTAP00000027915  ILDLP..ETNILSY.....FPECFEFIEEAKMK-...............-D............GVVLVHC..NAGVSR
ENSBTAP00000011856  -----..APEVPI-.....KKHFKECINFIHCCRl..............NG............GNCLVHC..FAGISR
ENSBTAP00000007630  NFGWK..DYGVAS-.....LTTILDMVKVMTFAL...............QE............GKVAIHC..HAGLGR
ENSBTAP00000023205  YVQVP..VADTPTS.....--RLCDFFDPIADHIhsvem..........KQ............GRTLLHC..AAGVSR
ENSBTAP00000006274  RLRIP..DFCPPG-.....PEQIDRFVKIVDEANa..............RG............EAVAVHC..ALGFGR
ENSBTAP00000011408  YLGVE..VDDFPEVdi...SQHFRKAAEFLDEALlt.............YR............GKVLVSS..EMGVSR
ENSBTAP00000011320  RIPVP..DFCAPRE.....-EDFDRLLGALQAALakd............PG............TGFVFSC..LSGQGR
ENSBTAP00000039412  LSTVD..MTGVPT-.....LANLQKGVQFTIRHQs..............LG............HSVYVHC..KAGRSR
ENSBTAP00000028997  ---KP..ETDLLSH.....LDRCVAFIVQARAE-...............-G............RAVLVHC..HSGVSR
ENSBTAP00000003229  --GWP..DLHTPA-.....LEKICSVCKAMDTWLnad............PH............NVVVLHN..KGNRGR
ENSBTAP00000012722  DVGWP..ELHAPP-.....LDKVCTICKAQEAWLnsd............PQ............HVVVIHC..RGGKGR
ENSBTAP00000011320  RLPLP..EQGAPLE.....-TQFDAFVSVLRETPsllllqdahg.....PP............PALLFSC..QTGVGR
ENSBTAP00000012447  IEDSL..EANITPF.....LRHLCHFIDIHLEL-...............-N............SVILVFS..TLGISR
ENSBTAP00000041263  ----T..DGGTPD-.....ITSCCEIMEELEICLk..............NN............RKTLIHC..YGGLGR
ENSBTAP00000025537  DCGWV..ARRAPS-.....LRSLYSLCRNMHAWLrrd............PG............NVCVVHC..MDGRAV
ENSBTAP00000041032  -CSWP..IRQAPS-.....LHNLFAVCRNMYNWLlqn............PK............NVCVVHC..LDGRAA
ENSBTAP00000009070  DFGWP..ELHAPP-.....LDKLCSICKAMETWLsad............PQ............HVVVLYC..KGSKGK
ENSBTAP00000020200  WMPTP..DMSTEGR.....VQMLPQAVCLLHALLe..............KG............HTVYVHC..NAGVGR
ENSBTAP00000055811  -----..-------.....--------------Kl..............SS............CQVIVHC..LAGISR
ENSBTAP00000041416  -----..-------.....--------------Kl..............SS............CQVIVHC..LAGISR


                        250       260          270       280          290       300                 
                          |         |            |         |            |         |                 
d1wcha_               SGTLICIDVVLGLISQD...LDFDISDLVRCMRLQRHG...MVQTEDQYIFCYQVILYVLTRL------qaeeeq...
ENSBTAP00000022028  TAQLTSLAMLM------...------------------...----------------------------ldgyyrtir
ENSBTAP00000018789  TAQLTSLAMLM------...------------------...----------------------------ldsfyrsie
ENSBTAP00000012726  TAQLTSLAMLM------...------------------...----------------------------ldsyyrtik
ENSBTAP00000048361  TPQIVALAKL-------...------------------...----------------------------lldpyyrti
ENSBTAP00000004052  TSQVCSLGSL-------...------------------...----------------------------lldpyyrti
ENSBTAP00000030174  TPQIVALAKI-------...------------------...----------------------------lldpyyrtl
ENSBTAP00000048722  TAQVCSVASLL------...------------------...----------------------------lephyrtlk
ENSBTAP00000046933  TAQVCSVASI-------...------------------...----------------------------lldpfyrtf
ENSBTAP00000004852  -----------------...------------------...----------------------------tdstlqvts
ENSBTAP00000019137  T----------------...------------------...----------------------------llitslaql
ENSBTAP00000042388  TGCFIVIDAMLERIKPE...KTVDVYGHVTLMRSQRNY...MVQTEDQYSFIHEALLEAVGCG------ntevparsl
ENSBTAP00000024046  TGCFIVIDAMLERMKHE...KTVDIYGHVTCMRAQRNY...MVQTEDQYVFIHEALLEAAMCGHT----evparnlya
ENSBTAP00000028448  -----------------...------------------...----------------------------rlskrtpvf
ENSBTAP00000013433  TGCFIVIDAMLERIKHE...KTVDIYGHVTLMRAQRNY...MVQTEDQYIFIHDALLEAVTCGN-----tevparnly
ENSBTAP00000015189  TGTFVVIDAMLDMMHTE...RKVDVYGFVSRIRAQRCQ...MVQTDMQYVFIYQALLEHY---------.........
ENSBTAP00000006948  -----------------...------------------...----------------------------vsevlengs
ENSBTAP00000003163  TGTFIVIDAMMDMVHAE...QKVDVFDFVSRIRNQRPQ...MVQTDMQYTFIYQALLEYY---------.........
ENSBTAP00000053189  -----------------...------------------...----------------------------vsevlengs
ENSBTAP00000053498  TGCYIVIDIMLDMAERE...GVVDIYNCVKALRSRRIN...MVQTEEQYIFIHDAILEACLCGET----aipvcefka
ENSBTAP00000034314  TGTFVAIDRLIYQIENE...NTVDVYGIVYDLRMHRPL...MVQTEDQYVFLNQCVLDI----------i........
ENSBTAP00000029213  TGTYIVIDSMLQQIKDK...STVNVLGFLKHIRTQRNY...LVQTEEQYIFIHDALLEAI---------.........
ENSBTAP00000054347  TGTYIVIDSMLQQIKDK...STVNVLGFLKHIRTQRNY...LVQTEEQYIFIHDALLEAI---------.........
ENSBTAP00000022588  TGTFCSLDICLAQLEEL...GTLNVFQTVSRMRTQRAF...SIQTPEQYYFCYKAILEFA---------e........
ENSBTAP00000020345  TGTFIALDRILQQLDSK...DSVDIYGAVHDLRLHRVH...MVQTECQYVYLHQCVR------------dv.......
ENSBTAP00000013433  TGVFITLSIVLERMRYE...GVVDIFQTVKMLRTQRPA...MVQTEDQYQFCYRAALEYL---------.........
ENSBTAP00000015189  TGTFCALSTVLERVKAE...GILDVFQTVKSLRLQRPH...MVQTLEQYEFCYKVVQEYI---------.........
ENSBTAP00000000401  TGCFIAIDTMLDMAENE...GVVDIFNCVRELRAQRVN...LVQTEEQYVFVHDAILEACLCGNT----aipvcefrs
ENSBTAP00000050372  TGTLIALDVLLRQLECE...GLVGPFGYVKKMRESRPL...MVQTEAQYVFLHQCILQFL---------q........
ENSBTAP00000002653  TGTFIVIDILIDIIREKgvdCDIDVPKTIQMVRSQRSG...MVQTEAQYRFIYMAVQHYI---------.........
ENSBTAP00000027046  TGTIIVIDMLMESISTKgldCDIDIQKTIQMVRAQRSG...MVQTEAQYKFIYVAIAQFIETTK-----kkl......
ENSBTAP00000042388  TGVFITLSIVLERMRYE...GVVDIFQTVKMLRTQRPA...MVQMEDEYQFCYQAALEYL---------.........
ENSBTAP00000053776  TGTYIVLDSMLQQIQHE...GTVNVFGFLKHIRSQRNY...LVQTEEQYVFIHDALVEAILSKE-----te.......
ENSBTAP00000053345  TGCFIVIDIMLDMAERE...GVVDIYNCVRELRSRRVN...MVQTEEQYVFIHDAILEA----------c........
ENSBTAP00000013320  TGTYIGIDAMLEGLEAE...NKVDVYGYVVKLRRQRCL...MVQVEAQYILIHQALVEY----------.........
ENSBTAP00000024046  TGVFITLSIVLERMRYE...GVVDMFQTVKTLRTQRPA...MVQTEDQYQLCYRAALEYL---------.........
ENSBTAP00000008678  SGTFCLADTCLLLMDKRkdpSSVDIKKVLLEMRKFRMG...LIQTADQLRFSYLAVIEGAKFIM-----gdssvqeqw
ENSBTAP00000003163  TGTFIALSNILERVKAE...GLLDVFQAVKSLRLQRPH...MVQTLEQYEFCYKVVQDFI---------.........
ENSBTAP00000025085  TGVLVTMETAMCMIERN...LPVYPLDIVRKMRDQRAM...MVQTSSQYKFVCEAILRV----------ye.......
ENSBTAP00000030443  TGTFIALDRLLQHIRDH...EFVDILGLVSEMRSYRMS...MVQTEEQYIFIHQCVQ------------l........
ENSBTAP00000042825  TGVLITMETAMCLIECN...QPVYPLDIVRTMRDQRAM...MIQTPSQYRFVCEAILKVY---------e........
ENSBTAP00000019901  SGTLICIDVVLGLISQD...LEFDISDLVRCMRLQRHG...MVQTEDQYIFCYQVILYVL---------tr.......
ENSBTAP00000045240  TGVFIALDHLTQHINDH...DFVDIYGLVAELRSERMC...MVQNLAQYIFLHQCVLDL----------l........
ENSBTAP00000013969  SGTFSLVDSCLVLIEKG...DNINIKQLLLNMRKYRMG...LIQTPDQLRFSYMTIIEGAKFI------kgdssiqkr
ENSBTAP00000033929  TGTIIVIDILVDVIRRQgldCDIDVPKTIQLVRRQRSG...MVQTEAQYKFVY----------------.........
ENSBTAP00000055241  SGTFVALWRLLQQLEEE...QVVDAFHAVHMLRLHRPL...MIQTPSQYVFLHRCLL------------s........
ENSBTAP00000004985  TGAICAIDYTWNLLKAGkipEEFNVFNLIQEMRTQRHS...AVQTKEQYELVHRAIAQLFE--------kql......
ENSBTAP00000017076  TGCYIVLDVMLDMAECE...GVVDIYNCVKTLCSRRVN...MIQTEEQYIFIHDAILEACLCGETT---ipvsefkat
ENSBTAP00000019887  TGVFLCVDVVFCAIEKN...FSFDIMNIVSQMREQRHG...MVQTKEQYMFCYKIVLEVLQK-------lw.......
ENSBTAP00000026136  TGVLCAIDYTWMLLKDGiipENFSVFSLIQEMRTQRPS...LVQTQQQYELVYNAVLELF---------trq......
ENSBTAP00000019182  -----------------...------------------...----------------------------pfldrcnhl
ENSBTAP00000018336  TGTYILIDMVLNRMAKGv..KEIDIAATLEHVRDQRPG...LVRSKDQFEFALTAVAEEV---------nail.....
ENSBTAP00000020359  TGCFIATSIGCRQLREE...GVVDALSIVCQLRVDRGG...MVQTSEQYEFVHHALCLY----------e........
ENSBTAP00000024750  TGVVILSEIMIACLEHN...EALDVPRVLDMLRRQRML...MVQTLCQYTFVYRVLIQFL---------r........
ENSBTAP00000028717  TGVVILSELMIYCLEHN...EKVEVPMMLRLLREQRMF...MIQTIAQYKFVYQVLIQFLQ--------n........
ENSBTAP00000026996  TGCFIATSICCQQLRQE...GVVDILKTTCQLRQDRGG...MIQTCEQYQFVHHVMSLY----------ek.......
ENSBTAP00000015484  TGVLCTVDYVRQLLLTQmipPNFSLFSVVLEIRKQRPL...AIQTEEQYRFLYHTV-------------s........
ENSBTAP00000003923  TGCFIATRIGCQQLKAR...GEVDILSIVCQLRLDRGG...MIQTAEQYQFLHHTLALF----------a........
ENSBTAP00000050785  SGTYVLIDMVLNKMAKGa..KEIDIAATLEHLRDQRPG...MVQTKEQFEFALTAVAEEV---------nail.....
ENSBTAP00000053528  -----------------...------------------...----------------------------mgghcfldr
ENSBTAP00000053345  SGTFCAISIVCEMLRHQ...RTVDVFHAVKTLRNNKPN...MVDLLDQYKFCYEVALEYL---------n........
ENSBTAP00000053498  SGMFCAIGIVVEMVKRQ...NVVDVFHAVKTLRNSKPN...MVEAPEQYRFCYDVALEYL---------e........
ENSBTAP00000000401  SGTFCAICSVCEMIQQQ...NIIDVFHIVKTLRNNKAN...MVETLDQYKFVYEVALEYLS--------s........
ENSBTAP00000017076  SGTFCACATVLEMIRCH...NLVDVFFAAKTLRNYKPN...MVETLDQYHFCYDVALEYL---------e........
ENSBTAP00000013320  TGIFCALFNLLESADTE...EVIDVFQAVKSLRKARPG...MVPTFEQYQFLYDVI-------------a........
ENSBTAP00000016579  -----------------...------------------...----------------------------lqqfpaefe
ENSBTAP00000029213  AGMLCALTTLSQQLENE...NAVDVFQVAKMINLMRPG...VFTDIEQYQFVYKAML------------sl.......
ENSBTAP00000054347  AGMLCALTTLSQQLENE...NAVDVFQVAKMINLMRPG...VFTDIEQYQFVYKAML------------sl.......
ENSBTAP00000053776  AGTFCALTTLMHQLEKE...NSMDVYQVAKMINLMRPG...VFADIEQYQFLYKAVLSLV---------st.......
ENSBTAP00000003600  TGAFALLYAAVQEVEAGs..GIPQLPQLVRRMRQQRKH...MLQEKLHLKFCHEAVVRHVE--------qvlq.....
ENSBTAP00000003532  TGFLICAFLV-----EK...MDWSIEAAVATFAQARPP...GIY-------------------------kgdylkelf
ENSBTAP00000008825  -----------------...------------------...----------------------------fe.......
ENSBTAP00000054725  -----------------...------------------...----------------------------fe.......
ENSBTAP00000052724  TPLFISLLRL-------...------------------...----------------------------slwadglih
ENSBTAP00000044476  TGYLICRYLI-----DV...EGMRPDDAIELFSRCRGH...CLERQ-----------------------nyiddlrng
ENSBTAP00000015397  -----------------...------------------...----------------------------fn.......
ENSBTAP00000021830  SATLVLAYLM-----LY...HRLTLVEAIKKVKDHRG-...----------------------------iipnrgflr
ENSBTAP00000005170  SPTLVIAYLM-----MR...QKMDVKSALSIVRQNR--...----------------------------eigpndgfl
ENSBTAP00000015397  TGTLIACYIM-----KH...YRMTATETIAWVRICRPG...SVIGPQQQFLMMK---------------qaslwiegd
ENSBTAP00000008825  TGTLIACYVM-----KH...YRFTHAEIIAWIRICRPG...SIIGPQQHF-------------------leekqaslw
ENSBTAP00000054725  TGTLIACYVM-----KH...YRFTHAEIIAWIRICRPG...SIIGPQQHF-------------------leekqaslw
ENSBTAP00000018411  SATICLAYLM-----RT...NRVKLDEAFEFVKQRRSI...ISPNF-----------------------sfmgqllqf
ENSBTAP00000053215  SATICLAYLM-----MK...KRVRLEEAFEFVKQRRSI...ISPNF-----------------------sfmgqllqf
ENSBTAP00000000929  SATIAIAYIM-----KR...MDMSLDEAYRFVKEKRPT...ISPNFN----------------------flgqlldye
ENSBTAP00000027120  SATICLAYLI-----QS...RRVRLDEAFDFVKQRRGV...ISPNF-----------------------sfmgqllqf
ENSBTAP00000013570  SATLCIAYLM-----KF...HNVCLLEAYNWVKARRPV...IRPNV-----------------------gfwrqlidy
ENSBTAP00000040594  SPTLVIAYLM-----MR...QKMDVKSALSIVRQNR--...----------------------------eigpndgfl
ENSBTAP00000027029  SPTICMAYLM-----KT...KQFHLKEAFDYIKQRRSV...VSPN------------------------fgfmgqllq
ENSBTAP00000010955  SVTVTVAYLM-----QK...LHLSLNDAYDLVKRKKSN...ISPNF-----------------------sfmgqlldf
ENSBTAP00000002933  APVLVALALI------E...GGMKYEDAVQFIRQKRRG...AFNSKQL---------------------lylekyrpk
ENSBTAP00000012499  TGVMICAYLL----HRG...KFLKAQEALDFYGEVRTRdkkGVTIPSQRRYVYYY--------------syllknh..
ENSBTAP00000018426  SAATVIAYAM-----KQ...YGWSLEQALRHVQELRPI...ARPNPGFL--------------------rqlqtyqgi
ENSBTAP00000002265  SATIVIAYLM-----KH...TRMTMTDAYKFVKGKRPI...ISPNL-----------------------nfmgqllef
ENSBTAP00000035646  TGTMVCAYLLASEIFAT...AEDS--------------...----------------------------lyyfgerrt
ENSBTAP00000048125  APVLVALALI------E...CGMKYEDAVQFIRQKRRG...AFNSKQL---------------------lylekyrpk
ENSBTAP00000029212  SVTVTVAYLM-----QK...MNLSLNDAYDFVKRKKSN...ISPNF-----------------------nfmgqlldf
ENSBTAP00000003800  SATLVLAYLM-----IH...RNMTLVDAIQQVAKNRC-...----------------------------vlpnrgflk
ENSBTAP00000006022  SVTVTVAYLM-----QK...LNLSMNDAYDIVKMKKSN...ISPNF-----------------------nfmgqlldf
ENSBTAP00000003801  SATVVLAFLM-----IC...ENMTLVEAIQTVQAHR--...----------------------------dicpnsgfl
ENSBTAP00000025062  SASTVIAYAM-----KE...FGWTLEKAYNYVKQKRSI...T---------------------------rpnagfmrq
ENSBTAP00000031268  SATLVLAYLM-----LR...QQLSLRQAVITVRERRWV...----------------------------fpnrgflhq
ENSBTAP00000014625  SASTVIAYAM-----KE...YGWNLDRAYDYVKERRTV...TKPNPS----------------------fmrqleeyq
ENSBTAP00000056281  APVLVALALI------E...SGMKYEDAIQFIRQKRRG...AINSKQ----------------------ltylekyrp
ENSBTAP00000039071  SVTLVVAYIM-----TV...TDFGWEDALHTVRAGRSC...ANPNL-----------------------gfqrqlqef
ENSBTAP00000002365  SATFCLAYLM-----KY...HSMSLLDAHTWTKSCRPT...IRPN------------------------ngfweqliy
ENSBTAP00000054687  SAAFVIAYIM-----ET...FGMKYRDAFAYVQERRFC...INPN------------------------agfvhqlqe
ENSBTAP00000031268  SATVVLAFLM-----IC...ENMTLVEAIQTVQAHR--...----------------------------dicpnsgfl
ENSBTAP00000027915  AAAIIIGFLM-----NS...EEISFTSAFSLVKNARPS...ICPNA-----------------------gfleqlrty
ENSBTAP00000011856  STTIVTAYVM-----TV...TGLSWRDVLEAIKATRPI...ANPNP-----------------------gfrqqleef
ENSBTAP00000007630  TGVLIACYLV-----FA...TRMTADQAIIFVRAKRPN...SIQTRGQLLCV-----------------reftqfl..
ENSBTAP00000023205  SAALCLAYLM-----KY...HAMSLLDAHTWTKSCRPI...IRP-------------------------nngfweqli
ENSBTAP00000006274  TGTMLACYLV-----KE...RGLAAGDAIAEIRRLRPG...SIETYEQEKAVFQ---------------fyqr.....
ENSBTAP00000011408  SAVLVVAYLM-----IF...HNMAVLEALMTVRKKRA-...----------------------------iypndgflk
ENSBTAP00000011320  TTTAMVVAVL-------...------------------...----------------------------af.......
ENSBTAP00000039412  SATMVAAYLI-----QV...YHWTPEEAIRAITKIRSH...IYIRPGQLEVL-----------------kefhk....
ENSBTAP00000028997  SVTVITAFMM-----KT...DQLTFEEAYENLKTVKPEak.MNE-------------------------gfewqlkly
ENSBTAP00000003229  IGVVIAAYMHY----SN...ISASADQALDRFAMKR--...----------------------------fyedkivpi
ENSBTAP00000012722  IGVVISSYMHF------...------------------...----------------------------tnvsasadq
ENSBTAP00000011320  ASL--------------...------------------...----------------------------gmvlgtlll
ENSBTAP00000012447  SCAAILAYLM-----HW...NGQTLKKSWAYLKKCKNN...MRPNR-----------------------alvaqlsew
ENSBTAP00000041263  SCLVAACLLL----YLS...DTVSPQQAIDSLRDLRGSg..AIQTIKQYNYLHE---------------frdkl....
ENSBTAP00000025537  SAVAVCSFLCFCRLFST...----AEAA----------...----------------------------vymfsmkrc
ENSBTAP00000041032  SSILVGAMFI----FCN...LYSTPGPAIRLLYAKRPG...IGLSPSHRRYL-----------------gymcdll..
ENSBTAP00000009070  LGVIVSAYMHYSKISA-...------------------...----------------------------gadqalatl
ENSBTAP00000020200  STAAVCGWLQ-----YV...LGWSRRKVQYFLVAKRP-...----------------------------avyi.....
ENSBTAP00000055811  SATIAIAYIM-----KT...MGMSSDDAYRFVKDRRPS...ISPNFN----------------------flgqlleye
ENSBTAP00000041416  SATIAIAYIM-----KT...MGMSSDDAYRFVKDRRPS...ISPNFN----------------------flgqlleye


                                                                                                    
                                                                                                    
d1wcha_               ..............................................................................
ENSBTAP00000022028  gfevlvekewlsfghrfqlrvghgdknhadadrspvflqfidcvwqmtrqfptafefneyflitildhlysclfgtfl
ENSBTAP00000018789  gfeilvqkewisfghkfasrighgdknhadadrspiflqfidcvwqmskqfptafefnerflitildhlyscrfgtfl
ENSBTAP00000012726  gfealiekewisfghrfalrvghgndnhadadrspiflqfidcvwqmtrqfpsafefnefflitildhlysclfgtfl
ENSBTAP00000048361  egfqvlvemewldfghkfadrcghgensddlnercpvflqwldcvhqlqrqfpcsfefneaflvklvqhtysclfgtf
ENSBTAP00000004052  rgfmvliekdwisfghkfsercghldgdpkevspvftqflecvwhlteqfpqafefneafllqihehihscqfgnfig
ENSBTAP00000030174  egfqvlvesdwldfghkfgdrcghqenaedqneqcpvflqwldsvhqllkqfpclfefneaflvklvqhtysclygtf
ENSBTAP00000048722  gfmvliekdwisfghkfthrygnldgdpreispvidqflecvwqlmeqfpcafefnerflihiqhhiyscqfgnflcn
ENSBTAP00000046933  kglmkikiliekewismghkfsqrcghldgdskevspiftqfldciwqlmeqfpcafefnenflleihdhvfscqfgn
ENSBTAP00000004852  laqiileprsrtirgfealierewlqaghpfqqrcaqsaycnskqkwespvfllfldcvwqilrqfpcsfefnenfli
ENSBTAP00000019137  ildplsrtmagfqelierewvqaghpfqlrcahsafsharpkheaptfllfldcvwqlgrqfplslefgegmllalfd
ENSBTAP00000042388  yayiqkltqvepgehvtgmelefkrla...................................................
ENSBTAP00000024046  hiqklgqvppgesvtamelefklla.....................................................
ENSBTAP00000028448  ynymyapedaevlrpysnvsnlkvwdfyteet..............................................
ENSBTAP00000013433  ayiqkltqietgenvtgmelefkrl.....................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000006948  svlvcleegwditaqvtslvqllsdpfyrtlegfrmlvekewlsfghkfsqrssltlscqgsgftpvflqfldcvhqv
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000053189  svlvcleegwditaqvtslvqllsdpfyrtlegfrmlvekewlsfghkfsqrssltlscqgsgftpvflqfldcvhqv
ENSBTAP00000053498  ayfdmiridsqtnsshlkdefqt.......................................................
ENSBTAP00000034314  ..............................................................................
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000022588  ..............................................................................
ENSBTAP00000020345  ..............................................................................
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000000401  lyynisrldpqtnssqikdefq........................................................
ENSBTAP00000050372  ..............................................................................
ENSBTAP00000002653  ..............................................................................
ENSBTAP00000027046  ..............................................................................
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000008678  kel...........................................................................
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000025085  ..............................................................................
ENSBTAP00000030443  ..............................................................................
ENSBTAP00000042825  ..............................................................................
ENSBTAP00000019901  ..............................................................................
ENSBTAP00000045240  ..............................................................................
ENSBTAP00000013969  wke...........................................................................
ENSBTAP00000033929  ..............................................................................
ENSBTAP00000055241  ..............................................................................
ENSBTAP00000004985  ..............................................................................
ENSBTAP00000017076  ykemiridpqsnssqlreefqt........................................................
ENSBTAP00000019887  ..............................................................................
ENSBTAP00000026136  ..............................................................................
ENSBTAP00000019182  krsekeapvfllfldttwqlleqcpaafefsetylavlhdstrvalfgtflfnsphqrvqqstefaiskniqlgdekg
ENSBTAP00000018336  ..............................................................................
ENSBTAP00000020359  ..............................................................................
ENSBTAP00000024750  ..............................................................................
ENSBTAP00000028717  ..............................................................................
ENSBTAP00000026996  ..............................................................................
ENSBTAP00000015484  ..............................................................................
ENSBTAP00000003923  ..............................................................................
ENSBTAP00000050785  ..............................................................................
ENSBTAP00000053528  cnhlrqsdkeevpvfllfldcvwqlvhqhppafeftetyltvlsdslyipifstfffnsphqkdmnvgkesqdsqsrp
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000016579  fseffllalhdsvrvpdtltflrdtpwergkqsgqfnnytqvytpgfpgagnsinpqlsvwdwnlrysnkqilqfrnp
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000003600  ..............................................................................
ENSBTAP00000003532  rrygdieeappppllpdwcfedd.......................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000052724  tslkpaeilyltvaydwflfghmlvdrlskgeeifffcfnflkhiiseefsalktqrrkslpardagftvedicml..
ENSBTAP00000044476  pirknwdssvsr..................................................................
ENSBTAP00000015397  ..............................................................................
ENSBTAP00000021830  qllaldrrlr....................................................................
ENSBTAP00000005170  aqlcqlndrlvkegk...............................................................
ENSBTAP00000015397  yfrq..........................................................................
ENSBTAP00000008825  v.............................................................................
ENSBTAP00000054725  v.............................................................................
ENSBTAP00000018411  esqv..........................................................................
ENSBTAP00000053215  esqvl.........................................................................
ENSBTAP00000000929  kriksq........................................................................
ENSBTAP00000027120  etq...........................................................................
ENSBTAP00000013570  erqlfgkst.....................................................................
ENSBTAP00000040594  aqlcqlndrlvkegk...............................................................
ENSBTAP00000027029  yeseil........................................................................
ENSBTAP00000010955  erslql........................................................................
ENSBTAP00000002933  mrlrfkdsnghr..................................................................
ENSBTAP00000012499  ..............................................................................
ENSBTAP00000018426  lt............................................................................
ENSBTAP00000002265  eedln.........................................................................
ENSBTAP00000035646  dkstsskfqgietpsqnrfvgyf.......................................................
ENSBTAP00000048125  mrlrfrd.......................................................................
ENSBTAP00000029212  ertlg.........................................................................
ENSBTAP00000003800  qlreldrqlvqqr.................................................................
ENSBTAP00000006022  ertlg.........................................................................
ENSBTAP00000003801  rqlqvldnrl....................................................................
ENSBTAP00000025062  lseyegil......................................................................
ENSBTAP00000031268  lcrldqqlnsnq..................................................................
ENSBTAP00000014625  gilla.........................................................................
ENSBTAP00000056281  kqrlrfkdpha...................................................................
ENSBTAP00000039071  eel...........................................................................
ENSBTAP00000002365  yefklfsknt....................................................................
ENSBTAP00000054687  yeaiyl........................................................................
ENSBTAP00000031268  rqlqvldnrl....................................................................
ENSBTAP00000027915  q.............................................................................
ENSBTAP00000011856  ..............................................................................
ENSBTAP00000007630  ..............................................................................
ENSBTAP00000023205  hyefqlfgrn....................................................................
ENSBTAP00000006274  ..............................................................................
ENSBTAP00000011408  qlrelneklmeer.................................................................
ENSBTAP00000011320  ..............................................................................
ENSBTAP00000039412  ..............................................................................
ENSBTAP00000028997  qam...........................................................................
ENSBTAP00000003229  gqpsqrryvhyfsgllsgsi..........................................................
ENSBTAP00000012722  aldrfamkkfyddklaalmqpsqkryvqflsgllsg..........................................
ENSBTAP00000011320  fhr...........................................................................
ENSBTAP00000012447  ekvv..........................................................................
ENSBTAP00000041263  ..............................................................................
ENSBTAP00000025537  ppgiwpshkryieymcd.............................................................
ENSBTAP00000041032  ..............................................................................
ENSBTAP00000009070  tmrkfcedkvaaelqpsqrryityfsgllsgsi.............................................
ENSBTAP00000020200  ..............................................................................
ENSBTAP00000055811  rslk..........................................................................
ENSBTAP00000041416  rslk..........................................................................


                                                                                                    
                                                                                                    
d1wcha_               ..............................................................................
ENSBTAP00000022028  cnseqqrgkenlprrtvslwsyinsqledftnplygsysnhvlypvasmrhlelwvgyyvrwnp..............
ENSBTAP00000018789  yncesarekqkvtertvslwslinsnkdkfknpfytkeinrvlypvasmrhlelwvnyyirwnp..............
ENSBTAP00000012726  cnceqqrlkedvstktvslwsyinsqldefsnpffvnyenhvlypvaslshlelwvnyyvrwnp..............
ENSBTAP00000048361  lcnnakergekhtqertcsvwsllragnkafknllyssqseavlypvchvrnlmlwsavylpc...............
ENSBTAP00000004052  ncqkereelklkektyslwpfllddqkkylnplyssqsqksavlepntvsfnfkfwrnmyhqfd..............
ENSBTAP00000030174  lannpcerekrniykrtcsvwallragnknfhnflytpgsemvlhpvchvralhlwtavylpa...............
ENSBTAP00000048722  sqkerqelkiqertyslwahlwknradylnplfradhsqtrgvlhlptapcnfmykfwngmynrf.............
ENSBTAP00000046933  flgncqkdrddlriyekthsvwpflvqrkpdfrnplykgftmygvlnpstvpy.........................
ENSBTAP00000004852  mlfehayasqfgtflgnnesercklklqqktmslwswvnrpselskftnplfeannlviwpsvapqslqlwegiflrw
ENSBTAP00000019137  hayaspfgtflcnnekerclcevrtrthslwsglsqpkeqrklrnplyvpnplaiwpsaepqslrlwqglflrgt...
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000028448  ..............................................................................
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000006948  hnqyptefefnlyylkflafhyvsnrfktflldsdyerlehgtlfddkgdkhakkgiciwecidrmhkrspiffnyly
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000053189  hnqyptefefnlyylkflafhyvsnrfktflldsdyerlehgtlfddkgdkhakkgiciwecidrmhkrspiffnyly
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000034314  ..............................................................................
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000022588  ..............................................................................
ENSBTAP00000020345  ..............................................................................
ENSBTAP00000013433  ..............................................................................
ENSBTAP00000015189  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000050372  ..............................................................................
ENSBTAP00000002653  ..............................................................................
ENSBTAP00000027046  ..............................................................................
ENSBTAP00000042388  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000024046  ..............................................................................
ENSBTAP00000008678  ..............................................................................
ENSBTAP00000003163  ..............................................................................
ENSBTAP00000025085  ..............................................................................
ENSBTAP00000030443  ..............................................................................
ENSBTAP00000042825  ..............................................................................
ENSBTAP00000019901  ..............................................................................
ENSBTAP00000045240  ..............................................................................
ENSBTAP00000013969  ..............................................................................
ENSBTAP00000033929  ..............................................................................
ENSBTAP00000055241  ..............................................................................
ENSBTAP00000004985  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000019887  ..............................................................................
ENSBTAP00000026136  ..............................................................................
ENSBTAP00000019182  lkfpsvwdwslqftpkdrtlfhnpfyigkstpcvqngsvksfkrtkksysstlrgmpaslkngiiseeelrprrnsli
ENSBTAP00000018336  ..............................................................................
ENSBTAP00000020359  ..............................................................................
ENSBTAP00000024750  ..............................................................................
ENSBTAP00000028717  ..............................................................................
ENSBTAP00000026996  ..............................................................................
ENSBTAP00000015484  ..............................................................................
ENSBTAP00000003923  ..............................................................................
ENSBTAP00000050785  ..............................................................................
ENSBTAP00000053528  lnlltvwdwsvqfepkaqtlltnplyvekpklekvqrkgthfkhqrqlslpltqsksspkrgffreetdhliknllgk
ENSBTAP00000053345  ..............................................................................
ENSBTAP00000053498  ..............................................................................
ENSBTAP00000000401  ..............................................................................
ENSBTAP00000017076  ..............................................................................
ENSBTAP00000013320  ..............................................................................
ENSBTAP00000016579  gydpehcpdswlprqqpsfmvpgppssvwlfsrgsltplnqlcpwrdspsllavssrwlprpaissesladqewglps
ENSBTAP00000029213  ..............................................................................
ENSBTAP00000054347  ..............................................................................
ENSBTAP00000053776  ..............................................................................
ENSBTAP00000003600  ..............................................................................
ENSBTAP00000003532  ..............................................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000052724  ..............................................................................
ENSBTAP00000044476  ..............................................................................
ENSBTAP00000015397  ..............................................................................
ENSBTAP00000021830  ..............................................................................
ENSBTAP00000005170  ..............................................................................
ENSBTAP00000015397  ..............................................................................
ENSBTAP00000008825  ..............................................................................
ENSBTAP00000054725  ..............................................................................
ENSBTAP00000018411  ..............................................................................
ENSBTAP00000053215  ..............................................................................
ENSBTAP00000000929  ..............................................................................
ENSBTAP00000027120  ..............................................................................
ENSBTAP00000013570  ..............................................................................
ENSBTAP00000040594  ..............................................................................
ENSBTAP00000027029  ..............................................................................
ENSBTAP00000010955  ..............................................................................
ENSBTAP00000002933  ..............................................................................
ENSBTAP00000012499  ..............................................................................
ENSBTAP00000018426  ..............................................................................
ENSBTAP00000002265  ..............................................................................
ENSBTAP00000035646  ..............................................................................
ENSBTAP00000048125  ..............................................................................
ENSBTAP00000029212  ..............................................................................
ENSBTAP00000003800  ..............................................................................
ENSBTAP00000006022  ..............................................................................
ENSBTAP00000003801  ..............................................................................
ENSBTAP00000025062  ..............................................................................
ENSBTAP00000031268  ..............................................................................
ENSBTAP00000014625  ..............................................................................
ENSBTAP00000056281  ..............................................................................
ENSBTAP00000039071  ..............................................................................
ENSBTAP00000002365  ..............................................................................
ENSBTAP00000054687  ..............................................................................
ENSBTAP00000031268  ..............................................................................
ENSBTAP00000027915  ..............................................................................
ENSBTAP00000011856  ..............................................................................
ENSBTAP00000007630  ..............................................................................
ENSBTAP00000023205  ..............................................................................
ENSBTAP00000006274  ..............................................................................
ENSBTAP00000011408  ..............................................................................
ENSBTAP00000011320  ..............................................................................
ENSBTAP00000039412  ..............................................................................
ENSBTAP00000028997  ..............................................................................
ENSBTAP00000003229  ..............................................................................
ENSBTAP00000012722  ..............................................................................
ENSBTAP00000011320  ..............................................................................
ENSBTAP00000012447  ..............................................................................
ENSBTAP00000041263  ..............................................................................
ENSBTAP00000025537  ..............................................................................
ENSBTAP00000041032  ..............................................................................
ENSBTAP00000009070  ..............................................................................
ENSBTAP00000020200  ..............................................................................
ENSBTAP00000055811  ..............................................................................
ENSBTAP00000041416  ..............................................................................


                                                                               
                                                                               
d1wcha_               .........................................................
ENSBTAP00000022028  .........................................................
ENSBTAP00000018789  .........................................................
ENSBTAP00000012726  .........................................................
ENSBTAP00000048361  .........................................................
ENSBTAP00000004052  .........................................................
ENSBTAP00000030174  .........................................................
ENSBTAP00000048722  .........................................................
ENSBTAP00000046933  .........................................................
ENSBTAP00000004852  nr.......................................................
ENSBTAP00000019137  .........................................................
ENSBTAP00000042388  .........................................................
ENSBTAP00000024046  .........................................................
ENSBTAP00000028448  .........................................................
ENSBTAP00000013433  .........................................................
ENSBTAP00000015189  .........................................................
ENSBTAP00000006948  spveiealkpnvnvsslkkwdyyieetl.............................
ENSBTAP00000003163  .........................................................
ENSBTAP00000053189  spveiealkpnvnvsslkkwdyyieetl.............................
ENSBTAP00000053498  .........................................................
ENSBTAP00000034314  .........................................................
ENSBTAP00000029213  .........................................................
ENSBTAP00000054347  .........................................................
ENSBTAP00000022588  .........................................................
ENSBTAP00000020345  .........................................................
ENSBTAP00000013433  .........................................................
ENSBTAP00000015189  .........................................................
ENSBTAP00000000401  .........................................................
ENSBTAP00000050372  .........................................................
ENSBTAP00000002653  .........................................................
ENSBTAP00000027046  .........................................................
ENSBTAP00000042388  .........................................................
ENSBTAP00000053776  .........................................................
ENSBTAP00000053345  .........................................................
ENSBTAP00000013320  .........................................................
ENSBTAP00000024046  .........................................................
ENSBTAP00000008678  .........................................................
ENSBTAP00000003163  .........................................................
ENSBTAP00000025085  .........................................................
ENSBTAP00000030443  .........................................................
ENSBTAP00000042825  .........................................................
ENSBTAP00000019901  .........................................................
ENSBTAP00000045240  .........................................................
ENSBTAP00000013969  .........................................................
ENSBTAP00000033929  .........................................................
ENSBTAP00000055241  .........................................................
ENSBTAP00000004985  .........................................................
ENSBTAP00000017076  .........................................................
ENSBTAP00000019887  .........................................................
ENSBTAP00000026136  .........................................................
ENSBTAP00000019182  lqvkpapletrdsqdwgaerffqerasrpadlhgtilphlsgahiklwklcyfrwvp
ENSBTAP00000018336  .........................................................
ENSBTAP00000020359  .........................................................
ENSBTAP00000024750  .........................................................
ENSBTAP00000028717  .........................................................
ENSBTAP00000026996  .........................................................
ENSBTAP00000015484  .........................................................
ENSBTAP00000003923  .........................................................
ENSBTAP00000050785  .........................................................
ENSBTAP00000053528  risklinsseelqdgfrefydgwhsrppsyqglllphlegpeikvwaqrylrwip..
ENSBTAP00000053345  .........................................................
ENSBTAP00000053498  .........................................................
ENSBTAP00000000401  .........................................................
ENSBTAP00000017076  .........................................................
ENSBTAP00000013320  .........................................................
ENSBTAP00000016579  hwgacplppglllpgclgpqirlwrrcylr...........................
ENSBTAP00000029213  .........................................................
ENSBTAP00000054347  .........................................................
ENSBTAP00000053776  .........................................................
ENSBTAP00000003600  .........................................................
ENSBTAP00000003532  .........................................................
ENSBTAP00000008825  .........................................................
ENSBTAP00000054725  .........................................................
ENSBTAP00000052724  .........................................................
ENSBTAP00000044476  .........................................................
ENSBTAP00000015397  .........................................................
ENSBTAP00000021830  .........................................................
ENSBTAP00000005170  .........................................................
ENSBTAP00000015397  .........................................................
ENSBTAP00000008825  .........................................................
ENSBTAP00000054725  .........................................................
ENSBTAP00000018411  .........................................................
ENSBTAP00000053215  .........................................................
ENSBTAP00000000929  .........................................................
ENSBTAP00000027120  .........................................................
ENSBTAP00000013570  .........................................................
ENSBTAP00000040594  .........................................................
ENSBTAP00000027029  .........................................................
ENSBTAP00000010955  .........................................................
ENSBTAP00000002933  .........................................................
ENSBTAP00000012499  .........................................................
ENSBTAP00000018426  .........................................................
ENSBTAP00000002265  .........................................................
ENSBTAP00000035646  .........................................................
ENSBTAP00000048125  .........................................................
ENSBTAP00000029212  .........................................................
ENSBTAP00000003800  .........................................................
ENSBTAP00000006022  .........................................................
ENSBTAP00000003801  .........................................................
ENSBTAP00000025062  .........................................................
ENSBTAP00000031268  .........................................................
ENSBTAP00000014625  .........................................................
ENSBTAP00000056281  .........................................................
ENSBTAP00000039071  .........................................................
ENSBTAP00000002365  .........................................................
ENSBTAP00000054687  .........................................................
ENSBTAP00000031268  .........................................................
ENSBTAP00000027915  .........................................................
ENSBTAP00000011856  .........................................................
ENSBTAP00000007630  .........................................................
ENSBTAP00000023205  .........................................................
ENSBTAP00000006274  .........................................................
ENSBTAP00000011408  .........................................................
ENSBTAP00000011320  .........................................................
ENSBTAP00000039412  .........................................................
ENSBTAP00000028997  .........................................................
ENSBTAP00000003229  .........................................................
ENSBTAP00000012722  .........................................................
ENSBTAP00000011320  .........................................................
ENSBTAP00000012447  .........................................................
ENSBTAP00000041263  .........................................................
ENSBTAP00000025537  .........................................................
ENSBTAP00000041032  .........................................................
ENSBTAP00000009070  .........................................................
ENSBTAP00000020200  .........................................................
ENSBTAP00000055811  .........................................................
ENSBTAP00000041416  .........................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0050432 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Mycoplasma leachii 99/014/6
NoYes   Mycoplasma mycoides subsp. capri LC str. 95010
NoYes   Mycoplasma capricolum subsp. capricolum ATCC 27343
NoYes   Mycoplasma putrefaciens KS1
NoYes   Conexibacter woesei DSM 14684
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium variabile DSM 44702
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Intrasporangium calvum DSM 43043
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Anaerolinea thermophila UNI-1
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus albus 7
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium saccharolyticum WM1
NoYes   [Ruminococcus] obeum
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus faecalis 62
NoYes   Oenococcus oeni PSU-1
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus sanfranciscensis TMW 1.1304
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Flexibacter litoralis DSM 6794
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Solitalea canadensis DSM 3403
NoYes   Gramella forsetii KT0803
NoYes   Zobellia galactanivorans
NoYes   Cellulophaga algicola DSM 14237
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Fretibacterium fastidiosum
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Treponema primitia ZAS-2
NoYes   Spirochaeta africana DSM 8902
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Persephonella marina EX-H1
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Campylobacter curvus 525.92
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Neisseria meningitidis alpha14
NoYes   Neisseria meningitidis FAM18
NoYes   Neisseria lactamica 020-06
NoYes   Neisseria gonorrhoeae NCCP11945
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylobacillus flagellatus KT
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB59
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Candidatus Liberibacter asiaticus str. psy62
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Bartonella tribocorum CIP 105476
NoYes   Bartonella henselae str. Houston-1
NoYes   Bartonella grahamii as4aup
NoYes   Bartonella quintana str. Toulouse
NoYes   Bartonella bacilliformis KC583
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Methylomonas methanica MC09
NoYes   Rhodanobacter denitrificans
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Cronobacter turicensis z3032
NoYes   Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
NoYes   Shigella sonnei Ss046
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter asburiae LF7a
NoYes   Citrobacter rodentium ICC168
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Psychrobacter sp. G
NoYes   Psychrobacter sp. PRwf-1
NoYes   Psychrobacter arcticus 273-4
NoYes   Psychrobacter cryohalolentis K5
NoYes   Moraxella catarrhalis RH4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Acinetobacter sp. ADP1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Thioalkalimicrobium cyclicum ALM1
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Cenarchaeum symbiosum A
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Candidatus Korarchaeum cryptofilum OPF8
NoYes   Acidilobus saccharovorans 345-15
NoYes   Pyrolobus fumarii 1A
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Thermogladius cellulolyticus 1633
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Thermosphaera aggregans DSM 11486
NoYes   Staphylothermus hellenicus DSM 12710
NoYes   Staphylothermus marinus F1
NoYes   Desulfurococcus fermentans DSM 16532
NoYes   Desulfurococcus kamchatkensis 1221n
NoYes   Desulfurococcus mucosus DSM 2162
NoYes   Metallosphaera cuprina Ar-4
NoYes   Metallosphaera sedula DSM 5348
NoYes   Acidianus hospitalis W1
NoYes   Sulfolobus tokodaii str. 7
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   Thermofilum sp. 1910b
NoYes   Thermofilum pendens Hrk 5
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Vulcanisaeta distributa DSM 14429
NoYes   Caldivirga maquilingensis IC-167
NoYes   Pyrobaculum sp. 1860
NoYes   Pyrobaculum calidifontis JCM 11548
NoYes   Pyrobaculum arsenaticum DSM 13514
NoYes   Pyrobaculum oguniense TE7
NoYes   Thermoproteus neutrophilus V24Sta
NoYes   Pyrobaculum aerophilum str. IM2
NoYes   Pyrobaculum islandicum DSM 4184
NoYes   Thermoproteus uzoniensis 768-20
NoYes   Thermoproteus tenax Kra 1
NoYes   Methanocella paludicola SANAE
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanoculleus bourgensis MS2
NoYes   Methanoculleus marisnigri JR1
NoYes   Thermococcus sp. 4557
NoYes   Thermococcus onnurineus NA1
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus sibiricus MM 739
NoYes   Thermococcus barophilus MP
NoYes   Pyrococcus sp. ST04
NoYes   Pyrococcus yayanosii CH1
NoYes   Pyrococcus horikoshii OT3
NoYes   Pyrococcus abyssi GE5
NoYes   Pyrococcus furiosus COM1
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Methanotorris igneus Kol 5
NoYes   Methanocaldococcus sp. FS406-22
NoYes   Methanocaldococcus jannaschii DSM 2661
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Cyanobium gracile PCC 6307
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Synechococcus sp. PCC 7002
NoYes   Synechococcus elongatus PCC 6301
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Mesoplasma florum W37
NoYes   Spiroplasma syrphidicola EA-1
NoYes   Spiroplasma diminutum CUAS-1
NoYes   Spiroplasma chrysopicola DF-1
NoYes   Spiroplasma taiwanense CT-1
NoYes   Spiroplasma apis B31
NoYes   Mycoplasma leachii PG50
NoYes   Mycoplasma putrefaciens Mput9231
NoYes   Adlercreutzia equolifaciens DSM 19450
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes   Mycobacterium tuberculosis EAI5/NITR206
NoYes   Mycobacterium tuberculosis EAI5
NoYes   Mycobacterium tuberculosis CAS/NITR204
NoYes   Mycobacterium tuberculosis str. Beijing/NITR203
NoYes   Mycobacterium tuberculosis UT205
NoYes   Mycobacterium tuberculosis RGTB327
NoYes   Mycobacterium tuberculosis CTRI-2
NoYes   Mycobacterium tuberculosis str. Erdman = ATCC 35801
NoYes   Mycobacterium tuberculosis KZN 605
NoYes   Mycobacterium tuberculosis KZN 4207
NoYes   Mycobacterium tuberculosis CCDC5180
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis H37Ra
NoYes   Mycobacterium tuberculosis str. Haarlem/NITR202
NoYes   Mycobacterium tuberculosis str. Haarlem
NoYes   Mycobacterium tuberculosis F11
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Mycobacterium tuberculosis CDC1551
NoYes   Mycobacterium bovis AF2122/97
NoYes   Mycobacterium bovis BCG str. Korea 1168P
NoYes   Mycobacterium bovis BCG str. Mexico
NoYes   Mycobacterium bovis BCG str. Tokyo 172
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Mycobacterium smegmatis JS623
NoYes   Corynebacterium terpenotabidum Y-11
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Leifsonia xyli subsp. cynodontis DSM 46306
NoYes   Clavibacter michiganensis subsp. sepedonicus
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   Bifidobacterium animalis subsp. animalis ATCC 25527
NoYes   Bifidobacterium animalis subsp. lactis Bl12
NoYes   Bifidobacterium animalis subsp. lactis B420
NoYes   Bifidobacterium animalis subsp. lactis ATCC 27673
NoYes   Bifidobacterium animalis subsp. lactis BLC1
NoYes   Bifidobacterium animalis subsp. lactis CNCM I-2494
NoYes   Bifidobacterium animalis subsp. lactis Bi-07
NoYes   Bifidobacterium animalis subsp. lactis V9
NoYes   Bifidobacterium animalis subsp. lactis DSM 10140
NoYes   Bifidobacterium animalis subsp. lactis BB-12
NoYes   Bifidobacterium animalis subsp. lactis AD011
NoYes   Bifidobacterium asteroides PRL2011
NoYes   Chthonomonas calidirosea T49
NoYes   Erysipelothrix rhusiopathiae SY1027
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Ruminococcus champanellensis 18P13
NoYes   Sulfobacillus acidophilus TPY
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium autoethanogenum DSM 10061
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Clostridium pasteurianum BC1
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum BKT015925
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Thermacetogenium phaeum DSM 12270
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Melissococcus plutonius ATCC 35311
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus casseliflavus EC20
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis D32
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Lactobacillus paracasei subsp. paracasei 8700:2
NoYes   Lactobacillus casei LOCK919
NoYes   Lactobacillus casei W56
NoYes   Lactobacillus casei LC2W
NoYes   Lactobacillus casei BD-II
NoYes   Lactobacillus casei BL23
NoYes   Lactobacillus casei str. Zhang
NoYes   Lactobacillus rhamnosus LOCK908
NoYes   Lactobacillus rhamnosus LOCK900
NoYes   Lactobacillus rhamnosus ATCC 8530
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus johnsonii N6.2
NoYes   Lactobacillus johnsonii DPC 6026
NoYes   Lactobacillus johnsonii NCC 533
NoYes   Lactobacillus salivarius UCC118
NoYes   Lactobacillus fermentum F-6
NoYes   Lactobacillus fermentum CECT 5716
NoYes   Lactobacillus amylovorus GRL 1112
NoYes   Lactobacillus reuteri TD1
NoYes   Lactobacillus reuteri I5007
NoYes   Lactobacillus reuteri JCM 1112
NoYes   Lactobacillus reuteri SD2112
NoYes   Lactobacillus plantarum 16
NoYes   Lactobacillus plantarum ZJ316
NoYes   Lactobacillus plantarum subsp. plantarum ST-III
NoYes   Lactobacillus plantarum subsp. plantarum P-8
NoYes   Lactobacillus plantarum WCFS1
NoYes   Lactobacillus helveticus R0052
NoYes   Lactobacillus helveticus H10
NoYes   Lactobacillus helveticus CNRZ32
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ND02
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
NoYes   Lactobacillus delbrueckii subsp. bulgaricus 2038
NoYes   Lactobacillus brevis KB290
NoYes   Lactobacillus acidophilus La-14
NoYes   Lactobacillus acidophilus NCFM
NoYes   Pediococcus pentosaceus SL4
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis IO-1
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. lactis Il1403
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Streptococcus pneumoniae INV200
NoYes   Streptococcus pneumoniae CGSP14
NoYes   Streptococcus pneumoniae 70585
NoYes   Streptococcus suis D9
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes N53-1
NoYes   Listeria monocytogenes La111
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar konkukian str. 97-27
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus biovar anthracis str. CI
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus F837/76
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus E33L
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Bacillus anthracis str. H9401
NoYes   Bacillus anthracis str. CDC 684
NoYes   Bacillus anthracis str. 'Ames Ancestor'
NoYes   Bacillus anthracis str. Sterne
NoYes   Bacillus anthracis str. Ames
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
NoYes   Brachyspira pilosicoli WesB
NoYes   Brachyspira pilosicoli B2904
NoYes   Brachyspira pilosicoli P43/6/78
NoYes   Acidithiobacillus ferrooxidans ATCC 23270
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Desulfocapsa sulfexigens DSM 10523
NoYes   Desulfobacula toluolica Tol2
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio vulgaris RCH1
NoYes   Desulfovibrio vulgaris str. 'Miyazaki F'
NoYes   Desulfovibrio vulgaris str. Hildenborough
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis G2136
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis M01-240355
NoYes   Neisseria meningitidis 8013
NoYes   Neisseria meningitidis 053442
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Neisseria gonorrhoeae TCDC-NG08107
NoYes   Neisseria gonorrhoeae FA 1090
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum PSI07
NoYes   Ralstonia solanacearum CMR15
NoYes   Ralstonia solanacearum GMI1000
NoYes   Polynucleobacter necessarius subsp. necessarius STIR1
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei MSHR346
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Alicycliphilus denitrificans BC
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Nitrosomonas sp. AL212
NoYes   Caulobacter crescentus CB15
NoYes   Zymomonas mobilis subsp. mobilis ATCC 29191
NoYes   Zymomonas mobilis subsp. mobilis CP4
NoYes   Zymomonas mobilis subsp. mobilis ATCC 10988
NoYes   Zymomonas mobilis subsp. mobilis ZM4
NoYes   Zymomonas mobilis subsp. pomaceae ATCC 29192
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Leisingera methylohalidivorans DSM 14336
NoYes   Octadecabacter antarcticus 307
NoYes   Octadecabacter arcticus 238
NoYes   Rhodobacter sphaeroides KD131
NoYes   Rhodobacter sphaeroides ATCC 17025
NoYes   Rhodobacter sphaeroides 2.4.1
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Candidatus Endolissoclinum faulkneri L2
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Gluconobacter oxydans H24
NoYes   Acetobacter pasteurianus 386B
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Brucella ceti TE10759-12
NoYes   Brucella ceti TE28753-12
NoYes   Brucella canis HSK A52141
NoYes   Brucella suis VBI22
NoYes   Brucella suis 1330
NoYes   Brucella suis 1330
NoYes   Brucella melitensis NI
NoYes   Brucella melitensis M5-90
NoYes   Brucella melitensis M28
NoYes   Brucella melitensis bv. 1 str. 16M
NoYes   Brucella abortus A13334
NoYes   Brucella melitensis biovar Abortus 2308
NoYes   Brucella abortus bv. 1 str. 9-941
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhizobium tropici CIAT 899
NoYes   Rhizobium leguminosarum bv. trifolii WSM2304
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Liberibacter crescens BT-1
NoYes   Candidatus Liberibacter solanacearum CLso-ZC1
NoYes   Candidatus Liberibacter americanus str. Sao Paulo
NoYes   Candidatus Liberibacter asiaticus str. gxpsy
NoYes   Mesorhizobium australicum WSM2073
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Hyphomicrobium denitrificans 1NES1
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Bartonella vinsonii subsp. berkhoffii str. Winnie
NoYes   Bartonella quintana RM-11
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Mannheimia haemolytica USMARC_2286
NoYes   Mannheimia haemolytica M42548
NoYes   Mannheimia haemolytica D174
NoYes   Mannheimia haemolytica D171
NoYes   Mannheimia haemolytica D153
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-183
NoYes   Mannheimia haemolytica USDA-ARS-USMARC-185
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio fischeri ES114
NoYes   Vibrio sp. EJY3
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Vibrio vulnificus CMCP6
NoYes   Vibrio vulnificus YJ016
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Idiomarina loihiensis GSL 199
NoYes   Shewanella sp. W3-18-1
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Shewanella putrefaciens 200
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Alcanivorax dieselolei B5
NoYes   Thalassolituus oleivorans MIL-1
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Xylella fastidiosa subsp. fastidiosa GB514
NoYes   Xylella fastidiosa Temecula1
NoYes   Xylella fastidiosa 9a5c
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Legionella pneumophila str. Paris
NoYes   Legionella pneumophila str. Lens
NoYes   Legionella pneumophila subsp. pneumophila LPE509
NoYes   Legionella pneumophila subsp. pneumophila str. Thunder Bay
NoYes   Legionella pneumophila subsp. pneumophila str. Philadelphia 1
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila
NoYes   Legionella pneumophila subsp. pneumophila ATCC 43290
NoYes   Legionella pneumophila 2300/99 Alcoy
NoYes   Proteus mirabilis BB2000
NoYes   Morganella morganii subsp. morganii KT
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Dickeya dadantii Ech586
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis PA13
NoYes   Pantoea ananatis AJ13355
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Erwinia amylovora CFBP1430
NoYes   Raoultella ornithinolytica B6
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella dysenteriae 1617
NoYes   Shigella boydii Sb227
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Pullorum str. S06004
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli P12b
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Pseudomonas denitrificans ATCC 13867
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas poae RE*1-1-14
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa<