SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


S-adenosyl-L-methionine-dependent methyltransferases alignments

These alignments are sequences aligned to the 0035026 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1af7a2 ............................................................................................
d1booa_ nfgkkpayttsngsmyigdslellesfpeesislvmtsppfalqrkkeygnleqheyvdwflsfak..........................
d1dcta_ mnli........................................................................................
d1dl5a1 mreklfwilkkygvsdhiakafleipreefltksyplsyvyedivlvsyddgeeystssqpslma...........................
d1dusa_ fsekpttksdvkivedilrgkklkfktdsgvfsygkvdkgtkilvenvvvd.........................................
d1eg2a_ gttrhvydvcdcldtlaklpddsvqliicdppynimladwddhmdyigwakrwlaeaervlsptgsiaifgglqyqgeagsgdlisiishmr
d1ej0a_ glrsrawfkldeiqqs............................................................................
d1fbna_ medikikeifeniyevdlgdglkriatksivkgkkvydekiikigdeeyriwnpnksklaaaiikgl.........................
d1fp1d2 rgylasfttflcypallqvwmnfkeavvdedidlfknvhgvtkyefmgkdkkmnqifnksmvdvcatemkrm....................
d1fp2a2 lclapmvecvldptlsgsyhelkkwiyeedltlfgvtlgsgfwdfldknpeyntsfndamasdsklinlalrdcdfvfd.............
d1g55a_ e...........................................................................................
d1g60a_ mleinkihqmncfdfldqvenksvqlavidppynlskadwdsfdshneflaftyrwidkvldkldkdgslyifntpfncaficqylvskgmi
d1hnna_ avasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgev...........................................
d1i4wa_ pipgikdisklkffygfkylwnptvynkifdkldltktykhpeelkvldlypgvgiqsaifynkycprqysllekrsslykflnakfegspl
d1i9ga_ tgpfsigervqltdakgrrytmsltpgaefhthrgsiahdavigleqgsvvkssngalflvlrpllvdyvmsmprgpqviypkdaaqivhe.
d1im8a_ fifdenvaevfpdmiqrsvpgysniitaigmlaer.........................................................
d1ixka_ lspsmldkllrlgysklfadryfqlwgerairiaeamekplprcfrvntlkisvqdlvkrlnkkgfqfkrvpwakegfcltrepfsitstpe
d1jg1a_ ekelyekwmrtvemlkaegiirskeveraflkyprylsvedkykkyahideplpipagqtvsaphmvaim......................
d1jqea_ gkyvesfrrflnhstehqcmqefmdkklpg..............................................................
d1jsxa_ mlnklslllkdagisltdhqknqliayvnmlhkwnkaynltsvr................................................
d1kpia_ qlkppveavrshydksneffklwldpsmtyscayferpdmtleeaqyak...........................................
d1kr5a_ ashselihnlrkngiiktdkvfevmlatdrshyakcnpymdspqsigfqatisap.....................................
d1l3ia_ mipddefiknpsvpgptamevrclimc.................................................................
d1l9ka_ etlgekwksrlnalgksefqiykksgiqevdrtlakegikrgetdhhavsrgsakl....................................
d1m6ex_ mdvrqvlhmkggagensyamnsfiqrqvisitkpiteaaitalysgdtvt..........................................
d1m6ya2 rkys........................................................................................
d1ne2a_ mgikndleirlqklqqqgnfknyleqyptdastaayfliei...................................................
d1nkva_ priftisesehrihnpfteekya.....................................................................
d1nv8a_ rkiwslirdcsgklegvtetsvlevllivsrvlgirkedlflkdlgvspteekrilelvekrasgyplhyilgekefmglsflveegvfvp.
d1nw3a_ lelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidydtksfesmqrlcdkynraidsihqlwkgttqpm
d1o54a_ hhhvgkvadtlkpgdrvllsfedeseflvdlekdkklhthlgiidlnevfekgpgeiirtsagkkgyilipslideimnmkrrtqivypkds
d1o9ga_ sayrhavermdssdlacgvvlhsapgypafpvrlatei......................................................
d1oria_ syahfgiheemlkdevrtltyrn.....................................................................
d1p91a_ sfscplchqplsreknsyicpqrhqfdmakegyvnllpvqhkrsrdpgdsaemmqarra.................................
d1pjza_ hqsevnkdl...................................................................................
d1q0sa_ mlgaiaytgnkqsllpe...........................................................................
d1qama_ qnfitskhnidkimtn............................................................................
d1qyra_ qnflndqfvidsivsainpqkgqamveig...............................................................
d1qzza2 hpaqqrawldlngavshadlaftglldvvrtgrpayagrygrpfwedlsadvaladsfdalmscdedlayeapad.................
d1r74a_ yrtrslgvaaeglpdqyadgeaarvwqlyigdtrsrtae.....................................................
d1ri5a_ sktinirnannf................................................................................
d1rjda_ eriiqqtdydalscklaaisvgylpssglqrlsvdlskkytewhrsylitlkkfsrrafgkvdkamrssfpvmnygtylrtvgidaailef.
d1sqga2 hpswllkrlqkaypeqwqsiveannqrppmwlrinrthhsrdswlalldeagmkgfphadypdavrletpapvhalpgfedgwvtvqdasaq
d1suia1 ksllqsdalyqyiletsv..........................................................................
d1t43a_ eyqhwlreaisqlqasesprrdaeillehvtgrgrtfilafgetqltdeqcqqldalltrrrdgepiahltgvrefwslplfvspatliprp
d1u2za_ sstfvdwngpclrlqyplfdieylrsheiysgtpiqsislrtnspqptsltsdndtssvttaklqsilfsnymeeykvdfkrstaiynpmse
d1ufka_ mwvyrlkgtlealdpilpglfdggarglweregevwaffpapvdlpyegvweevgdedwleawrrdlkpalappfvvlapwhtwegaeiplv
d1uira_ mdygmyffehvtpyetlvrrmerviasgktpfqdyflfeskgfgkvlildkdvqsterdeyiyhetlvh.......................
d1uwva2 eretprcphfgvcggcqqqhasvdlqqrsksaalarlmkhdvseviadvpwgyrrrarlslnylpktqqlqmgfrkagssdivdvkqcpila
d1v39a_ mdvvsldkpfmyfeeidneldyepesanevakklpyqgqlklllgelfflsklqrh....................................
d1vbfa_ asekeeilrkiktqelaeafnkvdrslflpenlkdyayahthealpilpginttalnlgifmlde...........................
d1ve3a1 gfkeyyrvfptytdinsqey........................................................................
d1vl5a_ gsdlaklmqiaal...............................................................................
d1vlma_ hmwhiferfvneyerwflvhrfayl...................................................................
d1ws6a1 vvrilggkargvalkvpasarpspvrlrka..............................................................
d1wy7a1 rkkelaialsklkgfknpkvwleqyrtpgnaasellwl......................................................
d1wzna1 myelytllaeyydtiyr...........................................................................
d1xdza_ nmnieeftsglaekgislsprqleqfelyydmlvewnekinltsitekkevylkhfydsi................................
d1xtpa_ gpgsmpskeassrnlpisgrdtngktyrstdemwkaeltgdlydpekgwygkaleywrtvpatvsgvlggmdhvhdvdiegsrn........
d1xvaa_ vdsvyrtrslgvaaegipdqyadgeaarvwqlyigdtrsrtae.................................................
d1xxla_ hhhslglmiktaecr.............................................................................
d1y8ca_ ncynkfahiydkliradvdykkwsdfiiekcvennlvfddy...................................................
d1yb2a1 pvilvsedeygkfdestnsilvkgkmhhlgisrviepgdelivsgksfivsdfspmyfgrvirrntqiiseidasy................
d1yzha1 gatelleanpqyvvlnpleakakwrdlfgndnpih.........................................................
d1zkda1 idqtalateikrlikaagpmpvwrymelclghpehgyyvtrdplgregdfttspeisqmfgellgl..........................
d1zq9a1 qhilknpliinsiidk............................................................................
d1zx0a1 pifapgencspawgaapaaydaadthlrilgkpvmer.......................................................
d2a14a1 ftggdeyqkhflprdylatyysfdgspspeaemlkfnleclhktfgpgglqgdtlidigsgptiyqvlaacdsfqditlsdftdrnreelek
d2ar0a1 ndlvaklwklcdnlrdggvsyqnyvnelasllflkmcketgqeaeylpegyrwddlksrigqeqlqfyrkmlvhlgeddkklvqavfhnvst
d2as0a2 inkdlfkrrikkaneyrkkvlkytnvyrmvygeadylpglivdrfndiaslqissagmerfkldvaeaimevepgietvfekntgrsrrreg
d2avda1 qcllppedsrlwqyllsrsmrehpalrslrlltleqpqgdsmmtceqaq...........................................
d2avna1 mklrswefydriaraydsmyetpkwkl.................................................................
d2b25a1 rpfqagelilaetgegetkfkklfrlnnfgllnsnwgavpfgkivgkfpgqilrssfgkqymlrrpaledyvvlmkrgtait..........
d2b2ca1 klhkgwftefspddlekmngasdeeptkvlksdgqemggawpgqafslqvkkvlfhekskyqdvlvfesttygnvlvldgivqaterdefsy
d2b78a2 lnvtyfiklfqwskdkrknfahsklttayrlfnqdgdsfggvtidcygdfvlfswynsfvyqirdeivaafrqvypnflgayekirfkgidn
d2b9ea1 qlprfvrvntlktcsddvvdyfkrqgfsyqgrasslddlralkgkhflldplmpellvfpaqtdlhehplyraghlilqdrasc........
d2bm8a1 ndysrqnfqdlnlfrglgedpayhppvltdrprdwpldrwaeaprdlgysdfspyqwrglrmlkdp..........................
d2bzga1 evqknqvltleewqdkwvngktafhqeqghqllkkh........................................................
d2cl5a1 dtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimd...........................................
d2cmha_ mwitqeitpylrkeytieaklldvrsehnileifkskdfgeiamlnrqllfknflhiesellahmggctkkelkevlivdgfdlelahqlfk
d2dpma_ tlqpftkwtggkrqllpvirelipktynryfepfvgggalffdlapkdavindfnaelincyqqikdnpqelieilkvhqeynskeyyldlr
d2dula1 lievqegkakilipkaesiydspvfynprmalnrdivv......................................................
d2eg5c_ gdtsyaknsaynqlvlakvkpv......................................................................
d2ex4a1 tseviedekqfyskaktywkqipptvdgmlggyghissidinssrkf.............................................
d2f8la1 aneatqelfqvldntaiilqneleisyleavyetgenlfqkevlqkeelssekqlklqasyesielenfsneeirkglqlallkgmkhgiqv
d2fhpa1 mrvisgeyggrrlkaldgdntrpttdkvke..............................................................
d2frna1 peelvkllpkrwvrigdvlllplrpelepykhriaevyaevlgvktvlrkghihgetrkpdyellygsdtvtvhvengikykldvakimfsp
d2g1pa_ knraflkwaggkypllddikrhlpkgeclvepfvgagsvflntdfsryiladinsdlislynivkmrtdeyvqaarelfvpetncaevyyqf
d2gb4a_ daevqknqvltledwkekwvtrhisfhqeqghqllkkh......................................................
d2gh1a1 ylkntrd.....................................................................................
d2gtia1 slenvvynlvnaghfdgragelpcavigekviakiqnedvvvfknntpfptnvavelfakrsirphpelklfrnlnidvcwshvlwdyakds
d2h00a1 vslnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedl.........................................
d2h1ra_ hllknpgildkiiyaakik.........................................................................
d2i62d_ ftskdtylshfnprdylekyysfgsrhcaeneilrhllknlfkifclgavkgellidigsgptiyqllsacesfteiivsdytdqnlwelqk
d2i6ga1 mtvrdenyftekygltrthsdv......................................................................
d2ibta1 vetppe......................................................................................
d2ifta1 gevriiaglwrgrklpvlnseglrptgdr...............................................................
d2igta1 mqrtgelpaehvpvilessgagdfhlidsgnglkleqygdyrvvrpeaqalwrplvpdrvwqnadaiftgdtdedgmgrwrfpkealgetwp
d2nyua_ sy..........................................................................................
d2o57a1 sktvkdnaeiyyddddsdrfyfhvwggedihvglykepvdqdeireaslrtdewlase..................................
d2okca1 qsltkkvwnlattlagqgigftdyitqltyllflkmdaenvemfgeesaiptgyqwadliafdgldlvkqyeetlkllseldnligtiytka
d2oo3a1 hagnfadvikhitltrllaylthkdkplfylethsgrgiydlkdkqslkteeykeginpvwldrenlpslfleyisvikqinlnstlsyypg
d2oyra1 mkiclidetgagdgalsvlaarwglehdednlmalvltpehlelrkrdepklggifvdfvggamahrrkfgggrgeavakavgikgdylpd.
d2p7ia1 nfdfdvmh....................................................................................
d2pbfb_ ennhksllenlkrrgiiddddvyntmlqvdrgkyikeipyidtpvyishgvtisaphmhals..............................
d2plwa_ yrsraayklieldnky............................................................................
d2py6a1 dplamndsflaaadalavdpmfgipanvreviarrgnatrlvilgtkgfgahlmnvrherpceviaavddfryhsgelyyglpiistdrfte
d2qyoa2 lclapmvecvldptlstsfhnlkkwvyeedltlfavnlgcdlweflnknpeyntlyndalasdskminlamkdcnlvfeg............
d2uyoa1 vgttavmvaaaraaetdrpdalirdpyakllvtntgagalweamldpsm...........................................
d2yvla_ nsfkegeyvlirfgekkflrkllpkqslsvkksvlkfdevigkpegvkingfevyrptleeiillgferktqiiypkdsfyial........
d2yxda_ mipdeefirregvpitkeeiravsigk.................................................................
d2zsua_ mrdmefiewyprgygvafkvkrkileeqseyqkievyetegfgkllaidgtvqlvtegeksyheplvhpa......................
d3a4ta_ kmqfirvntlkinpevlkkrlenkgvvlektfldyafevkkspfsigstpeylfgyympqsissm...........................
d3a7ea_ dtkeqrilnhvlqhaepgnaqsvleaidtyceqkewamnvgdkkgkiv............................................
d3c3ya_ gllqseelcqyilrtsvypreagflkelreaneshpdsymstsplag.............................................
d3d2la_ qfayvydelmqdv...............................................................................
d3doua1 qlrsraaf....................................................................................
d3e05c_ aqypvigidddefatakklitkqevravtlsk............................................................
d3fuxa_ aspqsvrallerhglfadkrfgqnflvseahlrriv........................................................
d3hh9b_ qwhetlhdqfgqyfavdnvlyhektdhqdliifenaafgrvmaldgvvqtterdefiyhemmth............................
d3lhdd_ miregdkvvlvdprgkrylitvskrdfhtdlgilkleeiigrnfgeaikshkghefkilrprivdyldkmkrgpqivhpkd...........
d3njrb1 sqvpgrpesafahdgqitkspmralt..................................................................
d3p71t_ dendegvrgtcedaslckrfavsigywhdpyiqhfvrlskerkapeinrgyfarvhgvsqlikaflrktechcqivnlgagmdttfwrlkde
d3p9kb2 dgvsmaalalmnqdkvlmeswyylkdavldggipfnkaygmsafeyhgtdprfnrvfnegmknhsiiitkkl....................
d3pt9a3 ikl.........................................................................................
d3qv2a_ qkqv........................................................................................
d3r0qg_ dyaqyfctysflyhqkdmls........................................................................
d3r9xb_ lvsegvlk....................................................................................
d3tqsd_ qhflhds.....................................................................................
d4blwa_ mlsyrhsfhagnhadvlkhtvqsliieslkekdkpflyldthagagryqlgsehaertgeylegiariwqqddlpaeleayinvvkhfnrsg
d4c06a_ qlyyecysdvsvheemiadqvrteayrlgi..............................................................
d4h0nc_ s...........................................................................................
d4jxja_ nfifdgslcdkivrasgle.........................................................................
d4o29a1 makrlveelerdgivkservkralltvpreefvlpeyrmmayedrplplfagatisa...................................
d4oa5e_ slskqdeylnklfavdtegalkahktapselrmaqlgtvegq..................................................
d4uoec_ kkwfsefsimwpgqafslkikkilyetkskyqnvlvfesttygkvlvldgviqltekdefayhemmthvpm.....................
d4ymhc_ lgsilpfneetadrvsayceknshgipdalvehwewtrtrfpdadkmssr..........................................
d5bp7b1 dipriftitesahrihnpitpeklttlga...............................................................
d5c0og_ gplllkdrkgraylvfpkeggvfhhhkgsvphealleagpggvvrthlgeelsvhrptleeyllhmkrsatptapkdasamvt.........
d5fuba1 dawqddeyfgnygtlrlhlemls.....................................................................
d5h02a_ npievresdgytneyvsgfvdkwdelidwesraesegdtii...................................................
d5heka_ miqiyhadafeiikdfyqqnlkvdaiitdppynisvknnfptlksakrqgidfgewdknfkllewiaryaplvnpngcmvifcsyrfisyia
d5lhma1 ltqsvlqyirdssvrdndilrdlreetsklplrtmqippeqgq.................................................
d5n5da1 meqerwnsvdvyfssllvkedealskaaqahrefdlpdlavsapqgk.............................................
d6mhta_ mieikdkq....................................................................................


                                                                                                    
                                                                                                    
d1af7a2 ............................................................................................
d1booa_ ............................................................................................
d1dcta_ ............................................................................................
d1dl5a1 ............................................................................................
d1dusa_ ............................................................................................
d1eg2a_ qnskmllanliiwnypngmsaqrffanrheeiawfaktkkyffdldavrepydeetkaaymkdkrlnpesvekgrnptnvwrmsrlngnsle
d1ej0a_ ............................................................................................
d1fbna_ ............................................................................................
d1fp1d2 ............................................................................................
d1fp2a2 ............................................................................................
d1g55a_ ............................................................................................
d1g60a_ fqnwitwdkrdgmgsakrrfstgqetilffsksknhtfnydevrvpyestdrikhasekgilkngkrwfpnpngrlcgevwhfssqrhkekv
d1hnna_ ............................................................................................
d1i4wa_ qilkrdpydwstysnlideerifvpevqssdhindkfltvanvtgegseg..........................................
d1i9ga_ ............................................................................................
d1im8a_ ............................................................................................
d1ixka_ fltgliyiqeass...............................................................................
d1jg1a_ ............................................................................................
d1jqea_ ............................................................................................
d1jsxa_ ............................................................................................
d1kpia_ ............................................................................................
d1kr5a_ ............................................................................................
d1l3ia_ ............................................................................................
d1l9ka_ ............................................................................................
d1m6ex_ ............................................................................................
d1m6ya2 ............................................................................................
d1ne2a_ ............................................................................................
d1nkva_ ............................................................................................
d1nv8a_ ............................................................................................
d1nw3a_ klntrpstgllrhilqqvynhsvtdpeklnnyepfspevyg...................................................
d1o54a_ sf..........................................................................................
d1o9ga_ ............................................................................................
d1oria_ ............................................................................................
d1p91a_ ............................................................................................
d1pjza_ ............................................................................................
d1q0sa_ ............................................................................................
d1qama_ ............................................................................................
d1qyra_ ............................................................................................
d1qzza2 ............................................................................................
d1r74a_ ............................................................................................
d1ri5a_ ............................................................................................
d1rjda_ ............................................................................................
d1sqga2 gcmtw.......................................................................................
d1suia1 ............................................................................................
d1t43a_ dt..........................................................................................
d1u2za_ igklieysclvflpspyaeqlketilpdlnasfdnsdtkgfvnainlynkmireiprqriidhletidkiprsfihdflhivytrsihpqan
d1ufka_ iepgmafgtghhettrla..........................................................................
d1uira_ ............................................................................................
d1uwva2 pqleallpkvraclgslqamrhlghvelvqatsgtlmilrhtaplssadreklerfshsegldlylapdseiletvsgempwydsnglrltf
d1v39a_ ............................................................................................
d1vbfa_ ............................................................................................
d1ve3a1 ............................................................................................
d1vl5a_ ............................................................................................
d1vlma_ ............................................................................................
d1ws6a1 ............................................................................................
d1wy7a1 ............................................................................................
d1wzna1 ............................................................................................
d1xdza_ ............................................................................................
d1xtpa_ ............................................................................................
d1xvaa_ ............................................................................................
d1xxla_ ............................................................................................
d1y8ca_ ............................................................................................
d1yb2a1 ............................................................................................
d1yzha1 ............................................................................................
d1zkda1 ............................................................................................
d1zq9a1 ............................................................................................
d1zx0a1 ............................................................................................
d2a14a1 wlkkepgaydwtpavkfacelegnsgrweekeeklraavkrvlkcdvhlgnplapavlpladcvltllamecac..................
d2ar0a1 titepkqitalvsnmdsldwyngahgksrddfgdmyegllqknanetksgagqyftprpliktiihllkpqprevvqdpaagtagflieadr
d2as0a2 lpeiervllgkekyrtiiqegrakfivdmrgqk...........................................................
d2avda1 ............................................................................................
d2avna1 ............................................................................................
d2b25a1 ............................................................................................
d2b2ca1 qe..........................................................................................
d2b78a2 vsahlygqeapeqflilengisynvflndglmtgifldqrq...................................................
d2b9ea1 ............................................................................................
d2bm8a1 ............................................................................................
d2bzga1 ............................................................................................
d2cl5a1 ............................................................................................
d2cmha_ ............................................................................................
d2dpma_ sadrderidmmsevqraarilymlrvnfnglyrvnsknqfnvpygryknpkivdeelisaisvyinn.........................
d2dula1 ............................................................................................
d2eg5c_ ............................................................................................
d2ex4a1 ............................................................................................
d2f8la1 nhqmtpdsigfiv...............................................................................
d2fhpa1 ............................................................................................
d2frna1 anvkervrm...................................................................................
d2g1pa_ reefnksqdpfrravlflylnrygynglcrynlrgefn......................................................
d2gb4a_ ............................................................................................
d2gh1a1 ............................................................................................
d2gtia1 vfcsstykv...................................................................................
d2h00a1 ............................................................................................
d2h1ra_ ............................................................................................
d2i62d_ wlkkepgafdwspvvtyvcdlegnrmkgpekeeklrraikqvlkcdvtqsqplggvslppadcllstlcldaac..................
d2i6ga1 ............................................................................................
d2ibta1 ............................................................................................
d2ifta1 ............................................................................................
d2igta1 lsllgveflgrftafrhvgvfp......................................................................
d2nyua_ ............................................................................................
d2o57a1 ............................................................................................
d2okca1 qnkidkpvylkkvitmideeqwlimdgdvkgaiyesilekngqdkksgagqy........................................
d2oo3a1 spyfainqlrsqdrlylcelhpteynfllklphfnk........................................................
d2oyra1 ............................................................................................
d2p7ia1 ............................................................................................
d2pbfb_ ............................................................................................
d2plwa_ ............................................................................................
d2py6a1 lathdrdlvalntcrydgpkrffdqicrthgiphlnfeqavrafglqgnvdyrvddwgadivrnipafqtlaqrladdysvqtlyavlnfhl
d2qyoa2 ............................................................................................
d2uyoa1 ............................................................................................
d2yvla_ ............................................................................................
d2yxda_ ............................................................................................
d2zsua_ ............................................................................................
d3a4ta_ ............................................................................................
d3a7ea_ ............................................................................................
d3c3ya_ ............................................................................................
d3d2la_ ............................................................................................
d3doua1 ............................................................................................
d3e05c_ ............................................................................................
d3fuxa_ ............................................................................................
d3hh9b_ ............................................................................................
d3lhdd_ ............................................................................................
d3njrb1 ............................................................................................
d3p71t_ dllsskyfevdfpmivtrklhsikckpplsspilelhsedtlqmdghildskryavigadlrdlseleeklkkcnmntqlptlliaecvlvy
d3p9kb2 ............................................................................................
d3pt9a3 ............................................................................................
d3qv2a_ ............................................................................................
d3r0qg_ ............................................................................................
d3r9xb_ ............................................................................................
d3tqsd_ ............................................................................................
d4blwa_ qlryypgspliarlllreqdslqlte..................................................................
d4c06a_ ............................................................................................
d4h0nc_ ............................................................................................
d4jxja_ ............................................................................................
d4o29a1 ............................................................................................
d4oa5e_ ............................................................................................
d4uoec_ ............................................................................................
d4ymhc_ ............................................................................................
d5bp7b1 ............................................................................................
d5c0og_ ............................................................................................
d5fuba1 ............................................................................................
d5h02a_ ............................................................................................
d5heka_ dfleengfvvkdfiqwvknnpmprnihrryvqdtefalwavkkkakwvfnkpknekylrplilkspvvsglektkhptqksla.........
d5lhma1 ............................................................................................
d5n5da1 ............................................................................................
d6mhta_ ............................................................................................


                                                                                                    
                                                                                                    
d1af7a2 ............................................................................................
d1booa_ ............................................................................................
d1dcta_ ............................................................................................
d1dl5a1 ............................................................................................
d1dusa_ ............................................................................................
d1eg2a_ rvghptqkpa..................................................................................
d1ej0a_ ............................................................................................
d1fbna_ ............................................................................................
d1fp1d2 ............................................................................................
d1fp2a2 ............................................................................................
d1g55a_ ............................................................................................
d1g60a_ ngktvklthitpkpr.............................................................................
d1hnna_ ............................................................................................
d1i4wa_ ............................................................................................
d1i9ga_ ............................................................................................
d1im8a_ ............................................................................................
d1ixka_ ............................................................................................
d1jg1a_ ............................................................................................
d1jqea_ ............................................................................................
d1jsxa_ ............................................................................................
d1kpia_ ............................................................................................
d1kr5a_ ............................................................................................
d1l3ia_ ............................................................................................
d1l9ka_ ............................................................................................
d1m6ex_ ............................................................................................
d1m6ya2 ............................................................................................
d1ne2a_ ............................................................................................
d1nkva_ ............................................................................................
d1nv8a_ ............................................................................................
d1nw3a_ ............................................................................................
d1o54a_ ............................................................................................
d1o9ga_ ............................................................................................
d1oria_ ............................................................................................
d1p91a_ ............................................................................................
d1pjza_ ............................................................................................
d1q0sa_ ............................................................................................
d1qama_ ............................................................................................
d1qyra_ ............................................................................................
d1qzza2 ............................................................................................
d1r74a_ ............................................................................................
d1ri5a_ ............................................................................................
d1rjda_ ............................................................................................
d1sqga2 ............................................................................................
d1suia1 ............................................................................................
d1t43a_ ............................................................................................
d1u2za_ klkhykafsnyvygellp..........................................................................
d1ufka_ ............................................................................................
d1uira_ ............................................................................................
d1uwva2 sprdfiqvnagv................................................................................
d1v39a_ ............................................................................................
d1vbfa_ ............................................................................................
d1ve3a1 ............................................................................................
d1vl5a_ ............................................................................................
d1vlma_ ............................................................................................
d1ws6a1 ............................................................................................
d1wy7a1 ............................................................................................
d1wzna1 ............................................................................................
d1xdza_ ............................................................................................
d1xtpa_ ............................................................................................
d1xvaa_ ............................................................................................
d1xxla_ ............................................................................................
d1y8ca_ ............................................................................................
d1yb2a1 ............................................................................................
d1yzha1 ............................................................................................
d1zkda1 ............................................................................................
d1zq9a1 ............................................................................................
d1zx0a1 ............................................................................................
d2a14a1 ............................................................................................
d2ar0a1 yvksqtndlddldgdtqdfqihrafiglelvpgtrrlalmncllhdiegnldhggairlgntlgsdgenlpkahivatnppfgsaagtnitr
d2as0a2 ............................................................................................
d2avda1 ............................................................................................
d2avna1 ............................................................................................
d2b25a1 ............................................................................................
d2b2ca1 ............................................................................................
d2b78a2 ............................................................................................
d2b9ea1 ............................................................................................
d2bm8a1 ............................................................................................
d2bzga1 ............................................................................................
d2cl5a1 ............................................................................................
d2cmha_ ............................................................................................
d2dpma_ ............................................................................................
d2dula1 ............................................................................................
d2eg5c_ ............................................................................................
d2ex4a1 ............................................................................................
d2f8la1 ............................................................................................
d2fhpa1 ............................................................................................
d2frna1 ............................................................................................
d2g1pa_ ............................................................................................
d2gb4a_ ............................................................................................
d2gh1a1 ............................................................................................
d2gtia1 ............................................................................................
d2h00a1 ............................................................................................
d2h1ra_ ............................................................................................
d2i62d_ ............................................................................................
d2i6ga1 ............................................................................................
d2ibta1 ............................................................................................
d2ifta1 ............................................................................................
d2igta1 ............................................................................................
d2nyua_ ............................................................................................
d2o57a1 ............................................................................................
d2okca1 ............................................................................................
d2oo3a1 ............................................................................................
d2oyra1 ............................................................................................
d2p7ia1 ............................................................................................
d2pbfb_ ............................................................................................
d2plwa_ ............................................................................................
d2py6a1 tcepeyyheverpystlyfrsg......................................................................
d2qyoa2 ............................................................................................
d2uyoa1 ............................................................................................
d2yvla_ ............................................................................................
d2yxda_ ............................................................................................
d2zsua_ ............................................................................................
d3a4ta_ ............................................................................................
d3a7ea_ ............................................................................................
d3c3ya_ ............................................................................................
d3d2la_ ............................................................................................
d3doua1 ............................................................................................
d3e05c_ ............................................................................................
d3fuxa_ ............................................................................................
d3hh9b_ ............................................................................................
d3lhdd_ ............................................................................................
d3njrb1 ............................................................................................
d3p71t_ mtpeqsanllk.................................................................................
d3p9kb2 ............................................................................................
d3pt9a3 ............................................................................................
d3qv2a_ ............................................................................................
d3r0qg_ ............................................................................................
d3r9xb_ ............................................................................................
d3tqsd_ ............................................................................................
d4blwa_ ............................................................................................
d4c06a_ ............................................................................................
d4h0nc_ ............................................................................................
d4jxja_ ............................................................................................
d4o29a1 ............................................................................................
d4oa5e_ ............................................................................................
d4uoec_ ............................................................................................
d4ymhc_ ............................................................................................
d5bp7b1 ............................................................................................
d5c0og_ ............................................................................................
d5fuba1 ............................................................................................
d5h02a_ ............................................................................................
d5heka_ ............................................................................................
d5lhma1 ............................................................................................
d5n5da1 ............................................................................................
d6mhta_ ............................................................................................


                            10        20                             30        40        50         
                             |         |                              |         |         |         
d1af7a2 ............NLTAFFREAHHFPILAEHARRRH.....................GEYRVWSAAASTGEEPYSIAITLADALG..MAP...
d1booa_ ............-----------------------.....................----------------------------..---...
d1dcta_ ............-----------------------.....................------SLFSGAG----------GLDLG..FQK...
d1dl5a1 ............-----------------LFMEWVgld..................KGMRVLEIGGGTGYNAAVMSRVV-----..--G...
d1dusa_ ............-----------------------.....................KDDDILDLGCGYG----------VIGIA..LAD...
d1eg2a_ ............-------------AVIERLVRALsh...................PGSTVLDFFAGSG----------VTARV..AIQ...
d1ej0a_ ............----------------------Dklfk.................PGMTVVDLGAAPGGWSQYVVTQI-----..--G...
d1fbna_ ............----------------------Kvmpik................RDSKILYLGASAGTTPSHVADIA-----..---...
d1fp1d2 ............----------------------Leiytgfe..............GISTLVDVGGGSG--------RNLELII..SKY...
d1fp2a2 ............-----------------------.....................GLESIVDVGGGTGTTAKIICETF-----..---...
d1g55a_ ............-----------------------.....................-PLRVLELYSGVG----------GMHHA..LREsci
d1g60a_ ............-------------DLIERIIRASsn...................PNDLVLDCFMGSG----------TTAIV..AKK...
d1hnna_ ............-----------------------.....................SGRTLIDIGSGPT--VYQLLSAC-----..--S...
d1i4wa_ ............-----------------------.....................----------------L-----------..---...
d1i9ga_ ............----------------------Gdif..................PGARVLEAGAGSGALTLSLLRAV-----..--G...
d1im8a_ ............----------------------Fvt...................ADSNVYDLGCSRGAATLSARRN------..INQ...
d1ixka_ ............-----------------MYPPVAldpk.................PGEIVADMAAAPGGKTSYLAQLM-----..--R...
d1jg1a_ ............-------------------LEIAnlk..................PGMNILEVGTGSGWNAALISEI------..---...
d1jqea_ ............----------------------Iigrigdtk.............SEIKILSIGGGAGEIDLQILSKVQAQYP..--G...
d1jsxa_ ............---------DPNEMLVRHILDSIvvapyl...............QGERFIDVGTGPG--------LPGIPLS..IVR...
d1kpia_ ............---------------RKLALDKLnle..................PGMTLLDIGCGWG----------STMRHa.VAE...
d1kr5a_ ............-------------HMHAYALELLfdqlh................EGAKALDVGSGSGILTACFARMV-----..--G...
d1l3ia_ ............------------------LAEPG.....................KNDVAVDVGCGTG----------GVTLE..LAG...
d1l9ka_ ............----------------RWFVERNlvt..................PEGKVVDLGCGRGGWSYY----------..---...
d1m6ex_ ............-----------------------.....................TRLAIADLGCSSGPNALFAVTELIKTVE..ELRkkm
d1m6ya2 ............--------QRHIPVMVREVIEFLkpe..................DEKIILDCTVGEGGHSRAILEHC-----..---...
d1ne2a_ ............----------------------Yndgni................GGRSVIDAGTGNG----------ILACGs.YLL...
d1nkva_ ............--------------------TLGrvlrmk...............PGTRILDLGSGSG----------EMLCT..WARd..
d1nv8a_ ............--------RPETEELVELALELIrky..................GIKTVADIGTGSG----------AIGVS..VAKf..
d1nw3a_ ............--------ETSFDLVAQMIDEIKmt...................DDDLFVDLGSGVGQVVLQVAAAT-----..---...
d1o54a_ ............---------------IAMMLDVK.....................EGDRIIDTGVGSGAMCAVLARAV-----..--G...
d1o9ga_ ............---------------FQRALARLpgd..................GPVTLWDPCCGSG--------YLLTVLG..LLH...
d1oria_ ............----------------------Smfhnrhlf.............KDKVVLDVGSGTG----------ILCMF..AAKa..
d1p91a_ ............-----FLDAGHYQPLRDAIVAQLrerldd...............KATAVLDIGCGEG--------YYTHAFA..DAL...
d1pjza_ ............---------------QQYWSS-Lnvv..................PGARVLVPLCGKS----------QDMSW..LSG...
d1q0sa_ ............----------------------Lkshfp................KYNRFVDLFCG------------GLSVS..L-N...
d1qama_ ............----------------------Irln..................EHDNIFEIGSGKG----------HFTLE..LVQ...
d1qyra_ ............-----------------------.....................---------PGLA----------ALTEP..VGE...
d1qzza2 ............----------------------Aydws.................AVRHVLDVGGGNG--------GMLAAIA..LRA...
d1r74a_ ............--------------YKAWLLGLLrqh..................GCQRVLDVACGTG----------VDSIM..LVE...
d1ri5a_ ............--------------IKACLIRLYtk...................RGDSVLDLGCGKG----------GDLLK..YER...
d1rjda_ ............----------------------Lvan..................EKVQVVNLGCGSD---------------..---...
d1sqga2 ............----------------------Lapq..................NGEHILDLCAAPGGKTTHILEVA-----..---...
d1suia1 ............----FPREHEAMKELREVTAKHPwnimttsadegqflsmllkliNAKNTMEIGVYTGYSLLATAL-------..AIP...
d1t43a_ ............------------ECLVEQALARLpe...................QPCRILDLGTGTG--------AIALALA..SER...
d1u2za_ ............------------N---------Flsdvyqqcqlk..........KGDTFMDLGSGVGNCVVQAALECGCALS..F-G...
d1ufka_ ............---------------LKALARHLr....................PGDKVLDLGTGSG----------VLAIA..AEK...
d1uira_ ............--------------------PAMlthp.................EPKRVLIVGGGEG--------ATLREVL..KHP...
d1uwva2 ............-----------NQKMVARALEWLdvq..................PEDRVLDLFCGMG----------NFTLP..LAT...
d1v39a_ ............----------------------Gil...................DGATVVYIGSAPG---------------..---...
d1vbfa_ ............----------------------Ldlh..................KGQKVLEIGTGIG----------YYTAL..IAE...
d1ve3a1 ............------------RSRIETLEPLLmkymk................KRGKVLDLACGVG----------GFSFL..LED...
d1vl5a_ ............----------------------K.....................GNEEVLDVATGGG----------HVANA..FAP...
d1vlma_ ............----------------------Selqavkcll............PEGRGVEIGVGTGRFAVPLKIKI-----..---...
d1ws6a1 ............------------------LFDYLrlryp................RRGRFLDPFAGSG----------AVGLE..AAS...
d1wy7a1 ............----------------------Ayslgdi...............EGKVVADLGAGTG----------VLSYGa.LLL...
d1wzna1 ............------RRIERVKAEIDFVEEIFkedakr...............EVRRVLDLACGTG----------IPTLE..LAE...
d1xdza_ ............--------------TAAFYVDFN.....................QVNTICDVGAGAGFPSLPIKICF-----..---...
d1xtpa_ ............-----------------FIASLPgh...................GTSRALDCGAGIG----------RITKNl.LTK...
d1xvaa_ ............--------------YKAWLLGLLrqh..................GCHRVLDVACGTG----------VDSIM..LVE...
d1xxla_ ............-----------------------.....................AEHRVLDIGAGAG----------HTALA..FSP...
d1y8ca_ ............-----------------------.....................-----LDLACGTG----------NLTEN..LCP...
d1yb2a1 ............----------------------Iimrcglr..............PGMDILEVGVGSGNMSSYILYAL-----..--N...
d1yzha1 ............-----------------------.....................-----VEVGSGKG--------AFVSGMA..KQN...
d1zkda1 ............----------------------Wsasvwkaadep..........QTLRLIEIGPGRGTMMADALRALRVLPI..L-Y...
d1zq9a1 ............----------------------Aalr..................PTDVVLEVGPGTG----------NMTVK..LLE...
d1zx0a1 ............-----------WETPYMHALAAAass..................KGGRVLEVGFGMA----------IAASK..VQEa..
d2a14a1 ............-----------------------.....................----------------------------..---...
d2ar0a1 tfvhptsnkqlc-----------------------.....................----------------------------..---...
d2as0a2 ............--TGFFLDQRENRLALEK----Wvq...................PGDRVLDVFTYTGGFAIHAAIAG-----..---...
d2avda1 ............--------------LLANLARLI.....................QAKKALDLGTFTGYSALALALAL-----..--P...
d2avna1 ............--------------YHRLIGSFLeeylk................NPCRVLDLGGGTG----------KWSLF..LQE...
d2b25a1 ............-----------FPKDINMILSMMdin..................PGDTVLEAGSGSGGMSLFLSKAV-----..--G...
d2b2ca1 ............------------------MLAHLpmfahp...............DPKRVLIIGGGDG--------GILREVL..KHE...
d2b78a2 ............--------------VRNELINGSa....................AGKTVLNLFSYTA----------AFSVAa.AMG...
d2b9ea1 ............--------------LPAMLLDPP.....................PGSHVIDACAAPGNKTSHLAALL-----..--K...
d2bm8a1 ............---------DTQAVYHDMLWEL-.....................RPRTIVELGVYNG---GSLAWF-RDLTK..IMG...
d2bzga1 ............---------------LDT----Flkgk.................SGLRVFFPLCGKA----------VEMKW..FAD...
d2cl5a1 ............-----------------AVIREY.....................SPSLVLELGAYCGYSAVRMARLL-----..--Q...
d2cmha_ ............-----------------------.....................----------------------------..---...
d2dpma_ ............-----------------------.....................----------------------------..---...
d2dula1 ............-----------------VLLNIL.....................NPKIVLDALSATG--------IRGIRFA..LET...
d2eg5c_ ............----------------------Leqcvrellranlpnin.....KCIKVADLGCASG---------------..---...
d2ex4a1 ............--------------LQRFLREGPnkt..................GTSCALDCGAGIG----------RITKRl.LLP...
d2f8la1 ............------------AYLLEKVIQKK.....................KNVSILDPACGTANLLTTVINQL---EL..KGD...
d2fhpa1 ............-------------SIFNMIGPYF.....................DGGMALDLYSGSG----------GLAIE..AVS...
d2frna1 ............----------------------Akvak.................PDELVVDMFAGIG----------HLSLP..IAVy..
d2g1pa_ ............-----------------------.....................----------------------------..---...
d2gb4a_ ............----------------------Ldtflkgq..............SGLRVFFPLCGKA----------IEMKW..FAD...
d2gh1a1 ............----LYYNDDYVSFLVNTVWKIT.....................KPVHIVDYGCGYGYLGLVLMP-------..LLP...
d2gtia1 ............-----------------------.....................----------------------------..---...
d2h00a1 ............----------------------Ighqdsdks.............TLRRGIDIGTGAS--------CIYPLLG..ATL...
d2h1ra_ ............-----------------------.....................SSDIVLEIGCGTG----------NLTVK..LLP...
d2i62d_ ............-----------------------.....................----------------------------..---...
d2i6ga1 ............----------------------Laaakvv...............APGRTLDLGCGNG----------RNSLY..LAA...
d2ibta1 ............--------------VVDFMVSLAeap..................RGGRVLEPACAHG--------PFLRAFRe.AHG...
d2ifta1 ............----------VKETLFNWLMPYI.....................HQSECLDGFAGSG----------SLGFEa.LSR...
d2igta1 ............------EQIVHWEWLKNAVETAD.....................RPLKVLNLFGYTG----------VASLV..AAA...
d2nyua_ ............------RSRSAFKLLEVNERHQIlr...................PGLRVLDCGAAPGAWSQVAVQKVNAAGTd.PSS...
d2o57a1 ............----------------------Lamtgvlq..............RQAKGLDLGAGYG----------GAARF..LVRk..
d2okca1 ............-----FTPRPLIQAMVDCINPQM.....................-GETVCDPACGTGGFLLTAYDYMKGQSA..SKEkrd
d2oo3a1 ............-----------------------.....................----------------------------..---...
d2oyra1 ............-----------------------.....................----VVDATAGLG----------RDAFV..LAS...
d2p7ia1 ............------------PFMVRAFTPFF.....................RPGNLLELGSFKG----------DFTSR..LQE...
d2pbfb_ ............---------------LKR----Linvlk................PGSRAIDVGSGSGYLTVCMAIKM---NV..LEN...
d2plwa_ ............----------------------Lflk..................KNKIILDIGCYPGSWCQVILERT-----..-KN...
d2py6a1 ............----------------------Llrfs.................DSEKMVDCGASIGES---LAGLIGVT--..-KG...
d2qyoa2 ............-----------------------.....................-LESIVDVGGGNGTTGKIICETF-----..---...
d2uyoa1 ............-----------------------.....................----------------------------..---...
d2yvla_ ............----------------------Klnln.................KEKRVLEFGTGSG----------ALLAV..LSE...
d2yxda_ ............----------------------Lnln..................KDDVVVDVGCGSG----------GMTVE..IAK...
d2zsua_ ............----------------------Mlahp.................NPRRVLIIGGGDG--------GAIREVL..KHE...
d3a4ta_ ............------------------IPP-Ivlnpr................EDDFILDMCAAPGGKTTHLAQLM-----..--K...
d3a7ea_ ............----------------DAVIQEH.....................QPSVLLELGAYCGYSAVRMARLL-----..--S...
d3c3ya_ ............-------------QLMSFVLKLV.....................NAKKTIEVGVFTGYSLLLTAL-------..SIP...
d3d2la_ ............----------PYPEWVAWVLEQVe....................PGKRIADIGCGTG----------TATLL..L-A...
d3doua1 ............--------------KLEFLLDRYrvvr.................KGDAVIEIGSSPG----------GWTQV..LNS...
d3e05c_ ............----------------------Lrlq..................DDLVMWDIGAGSASVSIEASNLM-----..---...
d3fuxa_ ............----------------EAARPF-.....................-TGPVFEVGPGLG----------ALTRA..LLE...
d3hh9b_ ............------------------VPL-Lahg..................HAKHVLIIGGGDG--------AMLREVT..RHK...
d3lhdd_ ............----------------------Aalivayagis...........PGDFIVEAGVGSGALTLFLANIV-----..--G...
d3njrb1 ............-------------------LAALapr..................RGELLWDIGGGSG----------SVSVE..WCL...
d3p71t_ ............-----------------------.....................----------------------------..---...
d3p9kb2 ............-------------------LELYhgfe.................GLGTLVDVGGGVGATVAAIA--------..AHY...
d3pt9a3 ............-----------------------.....................PKLRTLDVFSGCG--------GLSEGFH..QAG...
d3qv2a_ ............-----------------------.....................---NVIEFFSGIG--------GLRSSYErsSIN...
d3r0qg_ ............-------DRVRMDAYFNAVFQNKhhf..................EGKTVLDVGTGSG----------ILAIW..SAQa..
d3r9xb_ ............-----------------KIAEELnie..................EGNTVVEVGGGTG----------NLTKVl.LQH...
d3tqsd_ ............---------FVLQ----KIVSAIhpq..................KTDTLVEIGPGRG----------ALTDY..LLT...
d4blwa_ ............-----------------------.....................----------------------------..---...
d4c06a_ ............----------------------Lknwaal...............RGKTVLDVGAGTG----------ILSIF..CAQa..
d4h0nc_ ............-----------------------.....................--HKILELYSGIG----------GMHCA..WKEsgl
d4jxja_ ............-----------------------.....................ENSNVLEIGPGTG----------GLTRSi.LHK...
d4o29a1 ............------------PHMVAMMCELIepr..................PGMKILEVGTGSGYHAAVCAEAI-----..--E...
d4oa5e_ ............--------------MLQLLIRMA.....................GIHSIVEVGTCVGFSAICMAHAL-----..--P...
d4uoec_ ............----------------------Tvsk..................EPKNVLVVGGGDG----------GIIRE..LCKyk.
d4ymhc_ ............----------------------Lqgswmiftardr.........KPKRILEIGCYSG----------YSALA..WYEgtr
d5bp7b1 ............----------------------Alrle.................PGTRVLDLGSGSG----------EMLCT..WARd..
d5c0og_ ............------------------LLDLA.....................PGMRVLEAGTGSGGLTLFLARAV-----..--G...
d5fuba1 ............-------DKPRTETYRQVILSNSaal..................REKVVLDLGCGTG--------VISLFCA..LLA...
d5h02a_ ............--------------------NILker..................GVKKVLDVATGTG----------FNSVR..LLQ...
d5heka_ ............--------------LMEKIISIHtn...................PNDIVLDPFMGSG----------TTGLA..CKN...
d5lhma1 ............--------------LLSLLVRLI.....................GARKTLEVGVFTGYSTLCTALAL-----..--P...
d5n5da1 ............------------------LLHLLarlr.................QARRILEIGTFGGYSSIWLARAL-----..--P...
d6mhta_ ............----------------------L.....................TGLRFIDLFAGLG----------GFRLA..LES...


                    60         70          80        90       100       110            120          
                     |          |           |         |         |         |              |          
d1af7a2 .....GR.W..KVF.ASDIDTEVLEKARSGIYRL..SELKTLSPQQLQRYFMRGTGPHEGLVRVRQE.LANYV.EFSS...VNLLEKQYN..
d1booa_ .....--.-..---.-------------------..-------------------------------.-----.----...---------..
d1dcta_ .....AG.F..RIIcANEYDKSIWKTYESN----..-------------------------------.--HSA.KLIK...GDISKISSD..
d1dl5a1 .....EK.G..LVV.SVEYSRKICEIAKRNVERL..GI-----------------------------.--ENV.IFVC...GDGYYGVPE..
d1dusa_ .....EV.K..STT.MADINRRAIKLAKENIKLN..NLD------------------NYDIRV----.-----.--VH...SDLYENVK-..
d1eg2a_ .....EG.R..NSI.CTDAAPVFKEYYQKQLTF-..-------------------------------.-----.----...---------..
d1ej0a_ .....GK.G..RII.ACDL------------LPM..DPI----------------------------.--VGV.DFLQ...GDFRDELVMka
d1fbna_ .....DK.G..IVY.AIEYAPRIMRELLDACAER..-------------------------------.--ENI.IPIL...GDANKPQEYan
d1fp1d2 .....PL.I..KGI.NFDL-PQVIENAPPL----..-------------------------------.--SGI.EHVG...GDMFASV--..
d1fp2a2 .....PK.L..KCI.VFDR-PQVVENLSGS----..-------------------------------.--NNL.TYVG...GDMFTSI--..
d1g55a_ .....PA.Q..VVA.AIDVNTVANEVYKYNFPHT..QLLA---------------------------.----K.TIEG...ITLEEFD--..
d1g60a_ .....LG.R..NFI.GCDMNAEYVNQAN------..-------------------------------.-----.----...---------..
d1hnna_ .....HF.E..DIT.MTDFLEVNRQELGRWLQEE..PGAFNWSMYSQHACLIEG---KGECWQDKERqLRARVkRVLP...IDVHQPQPLga
d1i4wa_ .....--.-..---.-------------------..-------------------------------.-----.----...---------..
d1i9ga_ .....PA.G..QVI.SYEQRADHAEHARRNVSGC..YGQPP--------------------------.--DNW.RLVV...SDLADSELP..
d1im8a_ .....PN.V..KII.GIDNSQPMVERCRQHIAAY..HSE----------------------------.--IPV.EILC...NDIRHVE--..
d1ixka_ .....ND.G..VIY.AFDVDENRLRETRLNLSRL..GVL----------------------------.--NVI.LFHS...SSLHI-GEL..
d1jg1a_ .....VK.T..DVY.TIERIPELVEFAKRNLERA..GV-----------------------------.--KNV.HVIL...GDGSKGFPP..
d1jqea_ .....VC.I..NNE.VVEPSAEQIAKYKELVAKI..SNL----------------------------.--ENV.KFAW...HKETSSEYQsr
d1jsxa_ .....PE.A..HFT.LLDSLGKRVRFLRQVQHEL..KL-----------------------------.--ENI.EPVQ...SRVEEFPSE..
d1kpia_ .....YD.V..NVI.GLTLSENQYAHDKAMFDEV..DSP----------------------------.--RRK.EVRI...QGWEEFD--..
d1kr5a_ .....CT.G..KVI.GIDHIKELVDDSVNNVRKD..DPT----------LLSS--------------.--GRV.QLVV...GDGRMGYAE..
d1l3ia_ .....RV.R..RVY.AIDRNPEAISTTEMNLQRH..GLG----------------------------.--DNV.TLME...GDAPEALCK..
d1l9ka_ .....--.-..---.-------------------..-------------------------------.-----.----...---------..
d1m6ex_ grensPE.Y..QIF.LNDLPGNDFNAIFRSLPIE..NDV----------------------------.--DGV.CFINgvpGSFYGRLFP..
d1m6ya2 .....PG.C..RII.GIDVDSEVLRIAEEKLKEF..S------------------------------.--DRV.SLFK...VSYREADFLlk
d1ne2a_ .....GA.E..SVT.AFDIDPDAIETAKRNC---..-------------------------------.--GGV.NFMV...ADVSEIS--..
d1nkva_ .....HG.I..TGT.GIDMSSLFTAQAKRRAEEL..GVS----------------------------.--ERV.HFIH...NDAAGYVAN..
d1nv8a_ .....SD.A..IVF.ATDVSSKAVEIARKNAERH..GVS----------------------------.--DRF.FVRK...GEFLEPFKE..
d1nw3a_ .....NC.K..HHY.GVEKADIPAKYAETMDREF..RK----------------------WMKWYGK.KHAEY.TLER...GDFLSEEWRe.
d1o54a_ .....SS.G..KVF.AYEKREEFAKLAESNLTKW..GLI----------------------------.--ERV.TIKV...RDISEGFDE..
d1o9ga_ .....RR.SlrQVI.ASDVDPAPLELAAKNLALL..S------------------------------.-----.----...---------..
d1oria_ .....GA.R..KVI.GIEC-SSISDYAVKIVKAN..KLD----------------------------.--HVV.TIIK...GKVEEVELP..
d1p91a_ .....PE.I..TTF.GLDVSKVAIKAAAKRY---..-------------------------------.--PQV.TFCV...ASSHRLPFS..
d1pjza_ .....QG.Y..HVV.GAELSEAAVERYFTERGEQ..PH---ITSQGDFKVYAA--------------.--PGI.EIWC...GDFFALTAR..
d1q0sa_ .....VN.G..PVL.ANDIQEPIIEMYKRLI---..-------------------------------.-----.----...---------..
d1qama_ .....RC.N..FVT.AIEIDHKLCKTTENKLVDH..-------------------------------.--DNF.QVLN...KDILQFKFP..
d1qyra_ .....RL.D..QLT.VIELDRDLAARLQTHPF--..-------------------------------.LGPKL.TIYQ...QDAMTFNFG..
d1qzza2 .....PH.L..RGT.LVEL-AGPAERARRRFADA..GLA----------------------------.--DRV.TVAE...GDFFKPLPV..
d1r74a_ .....EG.F..SVT.SVDASDKMLKYALKERWNR..RHEPAF-------------------------.--DKW.VIEE...ANWMTLDKDvp
d1ri5a_ .....AGiG..EYY.GVDIAEVSINDARVRARNM..KRR----------------------------.--FKV.FFRA...QDSYGRHMD..
d1rjda_ .....--.-..---.-------------------..-------------------------------.-----.----...---------..
d1sqga2 .....PE.A..QVV.AVDIDEQRLSRVYDNLKRL..G------------------------------.--MKA.TVKQ...GDGRYPSQWc.
d1suia1 .....ED.G..KIL.AMDINKENYELGLPVIKKA..GVD----------------------------.--HKI.DFRE...GPALPVLDEmi
d1t43a_ .....PD.C..EII.AVDRMPDAVSLAQRNAQHL..AI-----------------------------.--KNI.HILQ...SDWFSALAG..
d1u2za_ .....CE.I..MDD.ASDLTILQYEELKKRCKLY..GMRL---------------------------.--NNV.EFSL...KKSFVDNNRva
d1ufka_ .....LG.G..KAL.GVDIDPMVLPQAEANAKRN..GV-----------------------------.---RP.RFLE...GSLEAALPF..
d1uira_ .....TV.E..KAV.MVDIDGELVEVAKRHM---..-------PEWHQGAFDD--------------.--PRA.VLVI...DDARAYLER..
d1uwva2 .....QA.A..SVV.GVEGVPALVEKGQQNARLN..GL-----------------------------.--QNV.TFYH...ENLEEDVTKqp
d1v39a_ .....--.-..---.------THIRYLRDHFYNL..GVI----------------------------.----I.KWML...IDGRHHDPI..
d1vbfa_ .....IV.D..KVV.SVEINEKMYNYASKLLSYY..-------------------------------.--NNI.KLIL...GDGTLGYEE..
d1ve3a1 .....YG.F..EVV.GVDISEDMIRKAREYAKSR..E------------------------------.--SNV.EFIV...GDARKLSFE..
d1vl5a_ .....FV.K..KVV.AFDLTEDILKVARAFIEGN..GH-----------------------------.--QQV.EYVQ...GDAEQMPFT..
d1vlma_ .....--.-..---.GVEPSERMAEIARKRG---..-------------------------------.----V.FVLK...GTAENLPLK..
d1ws6a1 .....EG.W..EAV.LVEKDPEAVRLLKENVRRT..GLG----------------------------.--ARV.VALP...---------..
d1wy7a1 .....GA.K..EVI.CVEVDKEAVDVLIENLGEF..K------------------------------.--GKF.KVFI...GDVSEFN--..
d1wzna1 .....RG.Y..EVV.GLDLHEEMLRVARRKAKER..NL-----------------------------.---KI.EFLQ...GDVLEIAFK..
d1xdza_ .....PH.L..HVT.IVDSLNKRITFLEKLSEAL..QL-----------------------------.--ENT.TFCH...DRAETFGQRkd
d1xtpa_ .....LY.A..TTD.LLEPVKHMLEEAKRELAGM..-------------------------------.--PVG.KFIL...ASMETATLP..
d1xvaa_ .....EG.F..SVT.SVDASDKMLKYALKERWNR..RKEP---------------------------.AFDKW.VIEE...ANWLTLDKDvp
d1xxla_ .....YV.Q..ECI.GVDATKEMVEVASSFAQEK..GV-----------------------------.--ENV.RFQQ...GTAESLPFP..
d1y8ca_ .....KF.K..NTW.AVDLSQEMLSEAENKFRSQ..GLK----------------------------.----P.RLAC...QDISNLNIN..
d1yb2a1 .....GK.G..TLT.VVERDEDNLKKAMDNLSEF..YDI----------------------------.--GNV.RTSR...SDIADFISD..
d1yzha1 .....PD.I..NYI.GIDIQKSVLSYALDKVLEV..GV-----------------------------.--PNI.KLLW...VDGSDLTDYf.
d1zkda1 .....QS.L..SVH.LVEINPVLRQKQQTLLAGI..-------------------------------.----R.NIHW...HDSFEDVPE..
d1zq9a1 .....KA.K..KVV.ACELDPRLVAELHKRVQGT..PVA----------------------------.--SKL.QVLV...GDVLKTDLP..
d1zx0a1 .....PI.D..EHW.IIECNDGVFQRLRDWAPRQ..T------------------------------.--HKV.IPLK...GLWEDVAPTl.
d2a14a1 .....--.-..---.-------------------..-------------------------------.-----.----...---------..
d2ar0a1 .....--.-..---.-------------------..-------------------------------.-----.----...---------..
d2as0a2 .....-A.D..EVI.GIDKSPRAIETAKENAKLN..GVE----------------------------.--DRM.KFIV...GSAFEEMEKlq
d2avda1 .....AD.G..RVV.TCEVDAQPPELGRPLWRQA..EAE----------------------------.--HKI.DLRL...KPALETLDEll
d2avna1 .....RG.F..EVV.LVDPSKEMLEVAREK----..-------------------------------.--GVK.NVVE...AKAEDLPFP..
d2b25a1 .....SQ.G..RVI.SFEVRKDHHDLAKKNYKHW..R--------------------DSWKLSHVEE.WPDNV.DFIH...KDISGATEDi.
d2b2ca1 .....SV.E..KVT.MCEIDEMVIDVAKKFLPGM..SCG-----------FSH--------------.--PKL.DLFC...GDGFEFLKN..
d2b78a2 .....GA.M..ATT.SVDLAKRSRALSLAHFEAN..HLDM---------------------------.--ANH.QLVV...MDVFDYFKYar
d2b9ea1 .....NQ.G..KIF.AFDLDAKRLASMATLLARA..GV-----------------------------.--SCC.ELAE...EDFLAVSPS..
d2bm8a1 .....ID.C..QVI.GIDRDLSRCQIPASDM---..-------------------------------.--ENI.TLHQ...GDCSDLTTFeh
d2bzga1 .....RG.H..SVV.GVEISELGIQEFFTEQNLS..YSEEPITEIPGTKVFKS--------------.SSGNI.SLYC...CSIFDLPRT..
d2cl5a1 .....PG.A..RLL.TMEMNPDYAAITQQMLNFA..GLQ----------------------------.--DKV.TILN...GASQDLIPQ..
d2cmha_ .....YD.T..HID.FVQADEKILDSFISFFPHF..H-----------------------------E.VKNNK.NFTH...AKQLLDLDI..
d2dpma_ .....--.-..---.-------------------..-------------------------------.--NQL.EIKV...GDFEKAIVD..
d2dula1 .....PA.E..EVW.LNDISEDAYELMKRNVMLNfdG----------------ELRESKGRAILKGE.--KTI.VINH...DDANRLMAE..
d2eg5c_ .....PN.T..LLT.VRDIVQSIDKVGQEKKNEL..ER-----------------------------.--PTI.QIFL...NDL------..
d2ex4a1 .....LF.R..EVD.MVDITEDFLVQAKTYLGEE..GK-----------------------------.--RVR.NYFC...CGLQDFTPE..
d2f8la1 .....VD.V..HAS.GVDVDDLLISLALVGADLQ..R------------------------------.--QKM.TLLH...QDGLANLLV..
d2fhpa1 .....RG.Md.KSI.CIEKNFAALKVIKENIAIT..KEP----------------------------.--EKF.EVRK...MDANRALEQfy
d2frna1 .....GK.A..KVI.AIEKDPYTFKFLVENIHLN..KVE----------------------------.--DRM.SAYN...MDNRDFPGE..
d2g1pa_ .....--.-..---.-------------------..-------------------------------.-----.----...---------..
d2gb4a_ .....RG.H..TVV.GVEISEIGIREFFAEQNLS..YTEEPLAEI--------------AGAKVFKS.SSGSI.SLYC...CSIFDLPRA..
d2gh1a1 .....EG.S..KYT.GIDSGETLLAEARELFRLL..PYD----------------------------.----S.EFLE...GDATEIELN..
d2gtia1 .....--.-..---.-------------------..-------------------------------.-----.----...---------..
d2h00a1 .....NG.W..YFL.ATEVDDMCFNYAKKNVEQN..NLS----------------------------.--DLI.KVVK...---------..
d2h1ra_ .....LA.K..KVI.TIDIDSRMISEVKKRCLYE..GY-----------------------------.--NNL.EVYE...GDAIKTVFP..
d2i62d_ .....--.-..---.-------------------..-------------------------------.-----.----...---------..
d2i6ga1 .....NG.Y..DVT.AWDKNPASMANLERIKAAE..GL-----------------------------.--DNL.QTDL...VDLNTLTFD..
d2ibta1 .....TA.Y..RFV.GVEIDPKALDLP-------..-------------------------------.--PWA.EGIL...ADFLLWEPG..
d2ifta1 .....QA.K..KVT.FLELDKTVANQLKKNLQTL..KCS--------------------------SE.QAEVI.NQSS...LDFLKQPQN..
d2igta1 .....AG.A..EVT.HVDASKKAIGWAKENQVLA..GLEQ---------------------------.--API.RWIC...EDAMKFIQRee
d2nyua_ .....PV.G..FVL.GVDL---------LHIFPL..-------------------------------.--EGA.TFLCp..ADVTDPRTSqr
d2o57a1 .....FG.V..SID.CLNIAPVQNKRNEEYNNQA..GLA----------------------------.--DNI.TVKY...GSFLEIPCE..
d2okca1 ...flRD.K..ALH.GVDNTPLVVTLASMNLYLH..GIGT---------------------------.--DRS.PIVC...EDSLEKEPS..
d2oo3a1 .....--.-..---.-------------------..-------------------------------.---K-.----...---------..
d2oyra1 .....VG.C..RVR.MLERNPVVAALLDDGLAR-..---------------------GYADAEIGGW.LQERL.QLIH...ASSLTALTD..
d2p7ia1 .....HF.N..DIT.CVEASEEAISHAQGRLK--..-------------------------------.--DGI.TYIH...SRFEDAQLP..
d2pbfb_ .....KN.S..YVI.GLERVKDLVNFSLENIKRD..KPE-----------LLKI-------------.--DNF.KIIH...KNIYQVNEEek
d2plwa_ .....YK.N..KII.GIDK---------------..-------------------------------.-----.----...---------..
d2py6a1 .....KF.E..RVW.MIEPDRINLQTLQNVLRRY..-------------------------------.-----.----...---------..
d2qyoa2 .....PK.L..TCV.VFDR-PKVVENLCGS----..-------------------------------.--NNL.TYVG...GDMFISV--..
d2uyoa1 .....-V.A..KVE.AIDA------EAAAMVEHM..RSYQAVRTNFFDTYFNN--------------.-----.----...---------..
d2yvla_ .....VA.G..EVW.TFEAVEEFYKTAQKNLKKF..NLG----------------------------.--KNV.KFFN...VDFKDAEVP..
d2yxda_ .....RC.K..FVY.AIDYLDGAIEVTKQNLAKF..NI-----------------------------.--KNC.QIIK...GRAEDVLD-..
d2zsua_ .....EV.E..EVI.MVEIDKKVIEISAKYIGID..GGI---------------------LEKMLSD.KHEKG.KLII...GDGVKFIEE..
d3a4ta_ .....NK.G..TIV.AVEISKTRTKALKSNINRM..GVL----------------------------.---NT.IIIN...ADMRKYKDYll
d3a7ea_ .....PG.A..RLI.TIEINPDCAAITQRMVDFA..GVK----------------------------.--DKV.TLVV...GASQDIIPQ..
d3c3ya_ .....DD.G..KIT.AIDFDREAYEIGLPFIRKA..GVE----------------------------.--HKI.NFIE...SDAMLALDNll
d3d2la_ .....DH.Y..EVT.GVDLSEEMLEIAQEKAMET..N------------------------------.--RHV.DFWV...QDMRELELP..
d3doua1 .....LA.R..KII.SIDL------------QEM..EEI----------------------------.--AGV.RFIR...CDIFKETIF..
d3e05c_ .....PN.G..RIF.ALERNPQYLGFIRDNLKKF..VA-----------------------------.--RNV.TLVE...AFAPEGLDD..
d3fuxa_ .....AG.A..EVT.AIEKDLRLRPVLEETLSGL..P------------------------------.----V.RLVF...QDALLYPWE..
d3hh9b_ .....NV.E..SIT.MVEIDAGVVSFCRQYLPNH..NAG------------------SYDD------.--PRF.KLVI...DDGVNFVNQ..
d3lhdd_ .....PE.G..RVV.SYEIREDFAKLAWENIKWA..GFD----------------------------.--DRV.TIKL...KDIYEGIEE..
d3njrb1 .....AG.G..RAI.TIEPRADRIENIQKNIDTY..GLS----------------------------.--PRM.RAVQ...GTAPAALAD..
d3p71t_ .....--.-..---.-------------------..-------------------------------.-----.----...---------..
d3p9kb2 .....PT.I..KGV.NFDL-PHVISEAPQF----..-------------------------------.--PGV.THVG...GDMFKEV--..
d3pt9a3 .....IS.E..TLW.AIEMWDPAAQAFRLN----..-------------------------------.-----.----...---------..
d3qv2a_ .....IN.A..TFI.PFDINEIANKIYSKNFKEE..-------------------------------.-----.----...---------..
d3r0qg_ .....GA.R..KVY.AVEA-TKMADHARALVKAN..NLD----------------------------.--HIV.EVIE...GSVEDISLP..
d3r9xb_ .....PL.K..KLY.VIELDREMVENLKSIGD--..-------------------------------.--ERL.EVIN...EDASKFPF-..
d3tqsd_ .....EC.D..NLA.LVEIDRDLVAFLQKKYNQQ..-------------------------------.--KNI.TIYQ...NDALQFDFS..
d4blwa_ .....--.-..---.---L---------------..-------------------------------.-----.----...---------..
d4c06a_ .....GA.R..RVY.AVEA-SAIWQQAREVVRLN..GLE----------------------------.--DRV.HVLP...GPVETVELP..
d4h0nc_ .....DG.E..IVA.AVDINTVANSVYKHNFPET..NLL------------------NRNIQQLTPQ.VI---.----...---------..
d4jxja_ .....NP.K..LLT.VIETDERCIPLLNEIKQYH..-------------------------------.--PNL.NIIK...QDALKLKLS..
d4o29a1 .....KK.G..RIY.TIEIVKELAVFAAQNLERL..GYW----------------------------.--GVV.EVYH...GDGKKGLEK..
d4oa5e_ .....SK.G..HIY.TIEKDYENVVTANQNIVNC..KLE----------------------------.--DKI.TVLH...GEALAQLNTlk
d4uoec_ .....SV.E..NID.ICEIDETVIEVSKIYFKNI..SCGYE--------------------------.-DKRV.NVFI...EDASKFLEN..
d4ymhc_ ....dTK.A..EIV.TLEYSPKMIAASREAFKKY..GVG----------------------------.--DRV.KLIE...GPAENTLKT..
d5bp7b1 .....HG.I..IGT.GIDMSQLFTAQAKLRAEEL..GVA----------------------------.--DRV.TFIH...GDASGYVSD..
d5c0og_ .....EK.G..LVE.SYEARPHHLAQAERNVRAF..WQV----------------------------.--ENV.RFHL...GKLEEAELE..
d5fuba1 .....KP.A..GVY.AVEA-SSMAEHTEELVKQN..GCD----------------------------.--GVV.TVFQ...ERAENLTLP..
d5h02a_ .....AG.F..DVV.SADGSAEMLVKAFDNARDH..GYL----------------------------.----M.RTVQ...ADWRWMNKD..
d5heka_ .....LE.R..NFI.GIESEKEYFQTAKKRL---..-------------------------------.-----.----...---------..
d5lhma1 .....AD.G..RVI.ACDLSEEWVSIARRYWQRA..GVA----------------------------.--DRI.EVRL...GDAHHSLEAlv
d5n5da1 .....PD.G..RLV.TIEWERSFAESAASRLAEA..GVA----------------------------.--HLV.EQHV...GRALDILPTld
d6mhta_ .....CG.Ae.CVY.SNEWDKYAQEVYEMNFG--..-------------------------------.-----.----...---------..


            130            140                                      150                   160       
              |              |                                        |                     |       
d1af7a2 .....VPGPFDAIF..CR...NVMIYFDK...............................TTQED.....ILRRFV.......PLLKPDGLL
d1booa_ .....---------..--...--------...............................-----.....---VVN.......KKLKPDGSF
d1dcta_ .....EFPKCDGII..GG...PPCQSWSEggslrgid.......................D----.....------.......---------
d1dl5a1 .....-FSPYDVIF..VT...--------...............................VGVDE.....VPETWF.......TQLKEGGRV
d1dusa_ .....-DRKYNKII..TN...PPI-RAGK...............................EVLHR.....IIEEGK.......ELLKDNGEI
d1eg2a_ .....---------..--...--------...............................-----.....------.......---------
d1ej0a_ llervGDSKVQVVM..SD...MA-----Pnmsgtpavdipram.................YLVEL.....ALEMCR.......DVLAPGGSF
d1fbna_ .....IVEKVDVIY..ED...V----AQP...............................NQAEI.....LIKNAK.......WFLKKGGYG
d1fp1d2 .....--PQGDAMI..LK...AVCHNWSD...............................EKCIE.....FLSNCH.......KALSPNGKV
d1fp2a2 .....--PNADAVL..LK...YILHNWTD...............................KDCLR.....ILKKCK.......EAVTNDG--
d1g55a_ .....-RLSFDMIL..MS...PPCQPFTR...............................-----.....------.......---------
d1g60a_ .....---------..--...--------...............................-----.....------.......---------
d1hnna_ ..gspAPLPADALV..SA...FCLEAVSPdl.............................ASFQR.....ALDHIT.......TLLRPGGHL
d1i4wa_ .....---------..--...--------...............................-----.....------.......---------
d1i9ga_ .....-DGSVDRAV..LD...MLA-PW--...............................----E.....VLDAVS.......RLLVAGGVL
d1im8a_ .....-IKNASMVI..LN...FTLQFLPP...............................EDRIA.....LLTKIY.......EGLNPNGVL
d1ixka_ .....-NVEFDKIL..LD...APCTGSGTihknperkwnrtmddikfcq...........GLQMR.....LLEKGL.......EVLKPGGIL
d1jg1a_ .....-KAPYDVII..VT...--------...............................AGAPK.....IPEPLI.......EQLKIGGKL
d1jqea_ mlekkELQKWDFIH..MI...QMLYYV--...............................KDIPA.....TLKFFH.......SLLGTNAKM
d1jsxa_ .....--PPFDGVI..SR...AF------...............................ASLND.....MVSWCH.......HL-------
d1kpia_ .....--EPVDRIV..SL...GAFEHFADgagdagf........................ERYDT.....FFKKFY.......NLTPDDGRM
d1kr5a_ .....-EAPYDAIH..VG...--------...............................AAAPV.....VPQALI.......DQLKPGGRL
d1l3ia_ .....-IPDIDIAV..VG...GSG-----...............................GELQE.....ILRIIK.......DKLKPGGRI
d1l9ka_ .....---------..--...--------...............................-----.....------.......---------
d1m6ex_ .....-RNTLHFIH..SS...YSLMWLSQvpigiesnkgniymantcpqsvlnayykqfqEDHAL.....FLRCRA.......QEVVPGGRM
d1m6ya2 ...tlGIEKVDGIL..MDl..GVSTYQ-Lkgexnrel.......................ENLKE.....FLKKAE.......DLLNPGGRI
d1ne2a_ .....--GKYDT--..--...--------...............................-----.....------.......---------
d1nkva_ .....--EKCDVAA..CV...GATWIAGG...............................FA--G.....AEELLA.......QSLKPGGIM
d1nv8a_ .....KFASIEMIL..SN...PPY-----...............................-----.....------.......---------
d1nw3a_ .....RIANTSVIF..VN...NFA--FGP...............................EV-DH.....QLKERF.......ANMKEGGRI
d1o54a_ .....--KDVDALF..LD...-----VPD...............................P--WN.....YIDKCW.......EALKGGGRF
d1o9ga_ .....---------..--...--------...............................-----.....------.......---------
d1oria_ .....-VEKVDIII..SE...WMGYCLFYe..............................SMLNT.....VLHARD.......KWLAPDGLI
d1p91a_ .....-DTSMDAII..RI...----YAPC...............................KA---.....--EELA.......RVVKPGGWV
d1pjza_ .....DIGHCAAFY..DR...AAMIALPA...............................DMRER.....YVQHLE.......ALM------
d1q0sa_ .....---------..--...--------...............................-----.....------.......---------
d1qama_ .....KNQS-----..--...--------...............................-----.....------.......---------
d1qyra_ .....---------..--...--------...............................-----.....------.......---------
d1qzza2 .....---TADVVL..LS...FVLLNWSD...............................EDALT.....ILRGCV.......RALEPGGRL
d1r74a_ ...qsAEGGFDAVI..CLg..NSFAHLPDckgdq..........................SEHRL.....ALKNIA.......SMVRAGGLL
d1ri5a_ .....LGKEFDVIS..SQ...FSFHYAFSts.............................ESLDI.....AQRNIA.......RHLRPGGYF
d1rjda_ .....---------..--...--------...............................-----.....------.......---------
d1sqga2 .....GEQQFDRIL..LD...APCSATGVirrhpdikwlrrdrdipela...........QLQSE.....ILDAIW.......PHLKTGGTL
d1suia1 .kdekNHGSYDFIF..VD...-----ADK...............................DNYLN.....YHKRLI.......DLVKVGGVI
d1t43a_ .....--QQFAMIV..SN...PPYIDEQDphlqqgdvrfepltalvaadsgm........ADIVH.....IIEQSR.......NALVSGGFL
d1u2za_ ....eLIPQCDVIL..VN...NFLF--DE...............................D----.....------.......---------
d1ufka_ .....--GPFDLLV..AN...-----LYA...............................ELHAA.....LAPRYR.......EALVPGGRA
d1uira_ .....TEERYDVVI..IDltdPVGEDNPArl.............................LYTVE.....FYRLVK.......AHLNPGGVM
d1uwva2 ....wAKNGFDKVL..LD...P-------...............................-----.....------.......---------
d1v39a_ .....LNGLRDVTL..VT...RF------...............................-VDEE.....YLRSIK.......KQLHPSKII
d1vbfa_ .....-EKPYDRVV..VW...--------...............................ATAPT.....LLCKPY.......EQLKEGGIM
d1ve3a1 .....-DKTFDYVI..FI...DSIVHFEP...............................LELNQ.....VFKEVR.......RVLKPSGKF
d1vl5a_ .....-DERFHIVT..CR...IAAHHFPN...............................PA--S.....FVSEAY.......RVLKKGGQL
d1vlma_ .....-DESFDFAL..MV...TTICFVDD...............................PE--R.....ALKEAY.......RILKKGGYL
d1ws6a1 .....---------..--...--------...............................-----.....------.......---------
d1wy7a1 .....--SRVDIVI..MN...PPFG----...............................-----.....------.......---------
d1wzna1 .....--NEFDAVT..MFf..STIMYFDE...............................EDLRK.....LFSKVA.......EALKPGGVF
d1xdza_ .....VRESYDIVT..AR...AV------...............................ARLSV.....LSELCL.......PLVKKNGLF
d1xtpa_ .....-PNTYDLIV..IQ...WTAIYLTD...............................ADFVK.....FFKHCQ.......QALTPNGYI
d1xvaa_ .....AGDGFDAVI..CLg..NSFAHLPDskgdq..........................SEHRL.....ALKNIA.......SMVRPGGLL
d1xxla_ .....-DDSFDIIT..CR...YAAHHF--...............................SDVRK.....AVREVA.......RVLKQDGRF
d1y8ca_ .....--RKFDLIT..CCld.STNYIIDS...............................DDLKK.....YFKAVS.......NHLKEGGVF
d1yb2a1 .....--QMYDAVI..AD...-----IPD...............................PW--N.....HVQKIA.......SMMKPGSVA
d1yzha1 .....EDGEIDRLY..LN...-----FSDpwpkkrhekrr....................LTYKT.....FLDTFK.......RILPENGEI
d1zkda1 .....---------..--...--------...............................-----.....------.......---------
d1zq9a1 .....---FFDTCV..AN...LPYQISSP...............................-----.....------.......---------
d1zx0a1 .....PDGHFDGIL..YD...TYP--LSE...............................ETWHThqfnfIKNHAF.......RLLKPGGVL
d2a14a1 .....---------..--...-----CSL...............................DAYRA.....ALCNLA.......SLLKPGGHL
d2ar0a1 .....---------..--...--------...............................-----.....FMQHII.......ETLHPGGRA
d2as0a2 ....kKGEKFDIVV..LD...PPAFVQHE...............................KDLKA.....GLRAYFnvnfaglNLVKDGGIL
d2avda1 ..aagEAGTFDVAV..VD...-----ADK...............................ENCSA.....YYERCL.......QLLRPGGIL
d2avna1 .....-SGAFEAVL..ALg..DVLSYV--...............................ENKDK.....AFSEIR.......RVLVPDGLL
d2b25a1 .....KSLTFDAVA..LD...MLNPHV--...............................-----.....TLPVFY.......PHLKHGGVC
d2b2ca1 .....HKNEFDVII..TDss.DPVGPAES...............................LFGQS.....YYELLR.......DALKEDGIL
d2b78a2 ....rHHLTYDIII..ID...PPSFARNKkevfsvs........................KDYHK.....LIRQGL.......EILSENGLI
d2b9ea1 .....-DPRYHEV-..--...--------...............................-----.....------.......---------
d2bm8a1 ....lREMAHPLIF..ID...NAH-----...............................ANTFN.....IMKWAV.......DHLLEEGDY
d2bzga1 .....NIGKFDMIW..DR...GALVAINP...............................GDRKC.....YADTMF.......SLL------
d2cl5a1 .....LKKKYDVDT..LD...MVF-----...............................-----.....------.......---------
d2cmha_ .....--KKYDLIF..CL...Q------E...............................PD-IH.....RIDGLK.......RMLKEDGVF
d2dpma_ .....-VRTGDFVY..FD...PPYIPLSEtsaftsythegfsf.................ADQVR.....LRDAFK.......RLSDTGAYV
d2dula1 .....RHRYFHFID..LD...PFGSPM--...............................----E.....FLDTAL.......RSAKRRGIL
d2eg5c_ .....---------..--...--------...............................-----.....------.......---------
d2ex4a1 .....-PDSYDVIW..IQ...WVIGHLTD...............................QHLAE.....FLRRCK.......GSLRPNGII
d2f8la1 .....--DPVDVVI..SD...LPVGYYPDdenaktfelcreeghs...............FAHFL.....FIEQGM.......RYTKPGGYL
d2fhpa1 ....eEKLQFDLVL..LD...PP------...............................YAKQE.....I-----.......---------
d2frna1 .....--NIADRIL..MG...YVV-----...............................-RTHE.....FIPKAL.......SIAK-----
d2g1pa_ .....------V--..--...--------...............................-----.....------.......---------
d2gb4a_ .....NIGKFDRIW..DR...GALVAINP...............................GDHDR.....YADIIL.......SLLRK----
d2gh1a1 .....--DKYDIAI..CH...AFLLHMTT...............................PE--T.....MLQKMI.......HSVKKGGKI
d2gtia1 .....---------..--...--C-----...............................-----.....------.......---------
d2h00a1 .....---------..--...--------...............................-----.....------.......---------
d2h1ra_ .....---KFDVCT..AN...--------...............................-----.....------.......---------
d2i62d_ .....---------..--...-------Pdl.............................PAYRT.....ALRNLG.......SLLKPGGFL
d2i6ga1 .....--GEYDFIL..ST...VVMMFLEA...............................QTIPG.....LIANMQ.......RCTKPGGYN
d2ibta1 .....--EAFDLIL..GN...PPYGIVGEaskypihvfkavkdlykkafstwkgky....NLYGA.....FLEKAV.......RLLKPGGVL
d2ifta1 .....-QPHFDVVF..LD...PPFH-FNL...............................AEQAI.....SLLCEN.......NWLKPNALI
d2igta1 ....rRGSTYDIIL..TD...PPKF----...............................-----.....------.......---------
d2nyua_ ilevlPGRRADVIL..SD...MA-----Pnatgfrdldhdrli.................SLCLT.....LLSVTP.......DILQPGGTF
d2o57a1 .....-DNSYDFIW..SQ...DAFLHSPD...............................KL--K.....VFQECA.......RVLKPRGVM
d2okca1 .....--TLVDVIL..AN...PPFGTRPAgsvdinrpdfyvetk................NNQLN.....FLQHMM.......LMLKTGGRA
d2oo3a1 .....---------..--...--------...............................-----.....------.......---------
d2oyra1 .....ITPRPQVVY..LD...PMFPHKQK...............................SAL--.....------.......---------
d2p7ia1 .....--RRYDNIV..LT...HVLEHIDD...............................PV--A.....LLKRINd......DWLAEGGRL
d2pbfb_ ....kELGLFDAIH..VG...--------...............................ASASE.....LPEILV.......DLLAENGKL
d2plwa_ .....---------..--...--------...............................-----.....------.......---------
d2py6a1 .....---------..--...--------...............................-----.....------.......---------
d2qyoa2 .....--PKADAVL..LK...AVLHDWTD...............................KDCIK.....ILKKCK.......EAVTSDG--
d2uyoa1 .....---------..--...--------...............................-----.....------.......---------
d2yvla_ .....-EGIFHAAF..VDvr.EPWHYLEK...............................-----.....------.......---------
d2yxda_ .....---------..--...--------...............................-----.....------.......---------
d2zsua_ .....-NSGFDVII..VDst.DPVGPAEM...............................LFSEE.....FYKNAY.......RALNDPGIY
d3a4ta_ ....kNEIFFDKIL..LD...APCSG--Niikdknrnvseedikycs.............LRQKE.....LIDIGI.......DLLKKDGEL
d3a7ea_ .....LKKKYDVDT..LD...MVF-----...............................-----.....------.......---------
d3c3ya_ .qgqeSEGSYDFGF..VD...-----ADK...............................PNYIK.....YHERLM.......KLVKVGGIV
d3d2la_ .....--EPVDAITilCD...SLNYLQTE...............................ADVKQ.....TFDSAA.......RLLTDGGKL
d3doua1 .....--DDIDRAL..RE...EGIEKVDDvvsdamakvsgipsrdhavsy..........QIGQR.....VMEIAV.......RYLRNGGNV
d3e05c_ .....-LPDPDRVF..IG...-----GSG...............................GMLEE.....IIDAVD.......RRLKSEGVI
d3fuxa_ .....-EVPQGSLL..VA...NLPYHIAT...............................PLVTR.....L-----.......---------
d3hh9b_ .....TSQTFDVII..SDct.DPIGPGES...............................LFTSA.....FYEGCK.......RCLNPGGIF
d3lhdd_ .....--ENVDHVI..LD...-----LPQ...............................PE--R.....VVEHAA.......KALKPGGFF
d3njrb1 .....-LPLPEA--..--...-VFI--GG...............................GGSQA.....LYDRLW.......EWLAPGTRI
d3p71t_ .....---------..--...--------...............................-----.....---W--.......---------
d3p9kb2 .....--PSGDTIL..MK...WILHDWSD...............................QHCAT.....LLKNCY.......DALPAHGKV
d3pt9a3 .....---------..--...--------...............................-----.....------.......---------
d3qv2a_ .....---------..--...--------...............................-----.....------.......---------
d3r0qg_ .....--EKVDVII..SE...WMGYFLLR...............................ESMFDs....VISARD.......RWLKPTGVM
d3r9xb_ .....---------..--...--------...............................-----.....------.......---------
d3tqsd_ .....---------..--...--------...............................-----.....------.......---------
d4blwa_ .....---------..--...--------...............................-----.....------.......---------
d4c06a_ .....--ERVDAIV..SE...WMGYGLLHe..............................SMLSS.....VLHART.......KWLKEGGLL
d4h0nc_ .....KKWNVDTIL..--...--------...............................-----.....------.......---------
d4jxja_ .....DLNTNKITI..IS...NLPYHIGT...............................ELVIR.....WLKE--.......---------
d4o29a1 .....-HAPFDAII..VT...--------...............................AAADV.....IPPALI.......RQLKDGGVM
d4oa5e_ .....EMAPFDMIF..ID...-----ANK...............................SSYLA.....YLNWAK.......MYIRKGGLI
d4uoec_ .....VTNTYDVII..VDss.DPIGPAET...............................LFNQN.....FYEKIY.......NALKPNGYC
d4ymhc_ .....LEGEFDLIF..VD...-----ANK...............................DGY--.....------.......---------
d5bp7b1 .....--DKAGVAA..CV...GATWIG--...............................GGVAG.....TIELLA.......RSLRPGGII
d5c0og_ .....-EAAYDGVA..LD...LM-EP---...............................---WK.....VLEKAA.......LALKPDRFL
d5fuba1 .....--TKVDVLV..SEwmgNCLL--FE...............................YMLES.....VLLARD.......RWLKKGGMM
d5h02a_ .....IHDKFDAIV..CLgn.SFTHLFDE...............................GDRRK.....ALAEFY.......ALLKHDGVL
d5heka_ .....---------..--...--------...............................-----.....------.......---------
d5lhma1 ..gseHRGTFDLAF..ID...-----ADK...............................ESYDF.....YYEHAL.......RLVRPGGLI
d5n5da1 ...rpGTAPFDMVF..VD...-----ANK...............................PDIPE.....YFTWAL.......KLSRPGAVV
d6mhta_ .....---------..--...--------...............................-----.....------.......---------


        170       180       190                                                                     
          |         |         |                                                                     
d1af7a2 FAGHSENFSNLVREFSLRGQTVY---als...............................................................
d1booa_ VVDFG---------------------gaymkgvparsiynfrvlirmidevgfflaedfywfnpsklpspiewvnkrkirvkdavntvwwfs
d1dcta_ --------------------------prgklfyeyirilkqkkpifflaenvkgmmaqrhnkavqefiqefdnagydvhiillnandygvaq
d1dl5a1 IVP-----------------------inlklsrrqpaflfkkkdpylvgnykletrfitaggnlg...........................
d1dusa_ WVV-----------------------iqtkqgakslakymkdvfgnvetvtikggyrvlkskkl............................
d1eg2a_ --------------------------lqddglidkarsyeivegaanfgaalqr......................................
d1ej0a_ VVKVFQGEGFD---------------eylreirslftkvkvrkpdssrarsrevyivatgrkp.............................
d1fbna_ MI------------------------aikarsidvtkdpkeifkeqkeileaggfkivdevdiepfekdhvmfvgiwegk............
d1fp1d2 IIVE----------------------filpeepntseesklvstldnlmfitvggrertekqyeklsklsgfskfqvacrafnslgvmefyk
d1fp2a2 --------------------------krgkvtiidmvidkkkdenqvtqikllmdvnmaclngkerneeewkklfieagfqhykispltgfl
d1g55a_ --------------------------igrqgdmtdsrtnsflhildilprlqklpkyillenvkgfevsstrdlliqtiencgfqyqeflls
d1g60a_ --------------------------fvlnq.............................................................
d1hnna_ LLIG----------------------aleeswylagearltvvpvseeevrealvrsgykvrdlrtyimpahlqtgvddvkgvffawaqkvg
d1i4wa_ --------------------------imqwlscignknwlyrfgkvkmllwmpsttarkllarpgmhsrskcsvvreaftdtkliaisdane
d1i9ga_ MVYVATVT------------------qlsrivealrakqcwteprawetlqrgwnvvglavrpqhsmrghtaflvatrrlapgava......
d1im8a_ VLSEKF--------------------rfedtkinhllidlhhqfkrangyselevsqkrtalenvmrtdsiethkvrlknvgfsqvelwfqc
d1ixka_ VYSTCSLEPEENEFVIQ---------waldnfdvellplkygepaltnpfgielseeiknarrlypdvhetsgffiakirkl..........
d1jg1a_ IIPVGSYHLW----------------qellevrktkdgikiknhggvafvpligeygwk.................................
d1jqea_ LIIVVSGSSGWDKLWKK---------ygsrfpqddlcqyitsddltqmldnlglkyecydllstmdisdcfidgnengdllwdfltetcnfn
d1jsxa_ --------------------------pgeqgrfyalkgqmpedeiallpeeyqvesvvklqvpaldgerhlvvikanki.............
d1kpia_ LLHTITIPDKE---------------eaqelgltspmsllrfikfilteifpggrlprisqvdyyssnagwkveryhriganyvptlnawad
d1kr5a_ ILP-----------------------vgpaggnqmleqydklqdgsikmkplmgviyvpltdkekqwsr.......................
d1l3ia_ IVTA----------------------illetkfeameclrdlgfdvnitelniargraldrgtmmvsrnpvaliytgv..............
d1l9ka_ --------------------------cgglknvrevkgltkggpgheepipmstygwnlvrlqsgvdvffippercdtllcdigesspnptv
d1m6ex_ VLTILG--------------------rrsedrasteccliwqllamalnqmvseglieeekmdkfnipqytpspteveaeilkegsflidhi
d1m6ya2 VVISFH--------------------sledrivketfrnskklriltekpvrpseeeirenprarsgrlraaeri.................
d1ne2a_ --------------------------wimnppfgsvvkhsdrafidkafetsmwiysignakardflrrefsargdvfreekvyitvpriyr
d1nkva_ LIGEPYWR------------------qlpateeiaqacgvsstsdfltlpglvgafddlgydvvemvladqegwdryeaakwltmrrwlean
d1nv8a_ --------------------------vkssahlpkdvlfeppealfggedgldfyreffgrydtsgkivlmeigedqveelkkivsdtvflk
d1nw3a_ VSSKPFA-------------------plnfrinsrnlsdigtimrvvelsplkgsvswtgkpvsyylhtidrtilenyfsslknp.......
d1o54a_ ATVCPTTNQVQ---------------etlkklqelpfirievweslfrpykpvperlrpvdrmvahtaymifatkvcrree...........
d1o9ga_ --------------------------pagltarelerreqserfgkpsyleaaqaarrlrerltaeggalpcairtadvfdpralsavlags
d1oria_ FPD-----------------------ratlyvtaiedrqykdykihwwenvygfdmscikdvaikeplvdvvdpkqlvtnaclikevdiytv
d1p91a_ ITATPGPR------------------hlmelkgliynevhlhaphaeqlegftlqqsaelcypmrlrgdeavallqmtpfawrakpevwqtl
d1pjza_ --------------------------pqacsgllitleydqallegppfsvpqtwlhrvmsgnwevtkvggqdtlhssarglkaglermdeh
d1q0sa_ --------------------------nvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirindkgnfttpfgk
d1qama_ --------------------------ykifgnipynistdiirkivfdsiadeiyliveygfakrllntkrslalflmaevdisilsmvpre
d1qyra_ --------------------------elaekmgqplrvfgnlpynistplmfhlfsytdaiadmhfmlqkevvnrlvagpnskaygrlsvma
d1qzza2 LVL-----------------------dradvegdgadrffstlldlrmltfmggrvrtrdevvdlagsaglalasertsgsttlpfdfsile
d1r74a_ VIDHRNYDHILSTGCAP---------pgkniyyksdltkdvttsvlivnnkahmvtldytvqvpgagqdgspglskfrlsyyphclasftel
d1ri5a_ IMTVPSRDVILER-------------ykqgrmsndfykielekmedvpmesvreyrftlldsvnncieyfvdftrmvdgfkrlglslverkg
d1rjda_ --------------------------lrmlpllqmfphlayvdidynesvelknsilreseilrislglskedtakspflidqgryklaacd
d1sqga2 VYATCSVLPEENS-------------lqikaflqrtadaelcetgtpeqpgkqnlpgaeegdgffyaklik.....................
d1suia1 GYDNTLWNG-----------------svvappdaplrkyvryyrdfvlelnkalavdprieicmlpvgdgiticrrik..............
d1t43a_ LLEHGWQQGEAVR-------------qafilagyhdvetcrdygdnervtlgry......................................
d1u2za_ --------------------------lnkkvekilqtakvgckiislkslrsltyqinfynvenifnrlkvqrydlkedsvswthsggeyyi
d1ufka_ LLTG----------------------ilkdraplvreamagagfrpleeaaegewvllaygr..............................
d1uira_ GMQTGMILLTHHRVHPVVHRT-----vreafryvrsyknhipgfflnfgfllasdafdpaafsegviearirernlalrhltapyleamfvl
d1uwva2 --------------------------aragaagvmqqiiklepirivyvscnpatlardseallkagytiarlamldmfphtghlesmvlfs
d1v39a_ LIS-----------------------dvrskrggnepstadllsnyalqnvmisilnpvasslkwrcpfpdqwikdfyiphgnkmlqpfaps
d1vbfa_ IL------------------------pigvgrvqklykvikkgnspslenlgevmfgrigglygfyddyddiefrvnklerqiksil.....
d1ve3a1 IMYF----------------------tdlrellprlkeslvvgqkywiskvipdqeertvviefkseqdsfrvrfnvwgktgvellaklyft
d1vl5a_ LLVDNS--------------------apendafdvfynyvekerdyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdrmnvtte
d1vlma_ IVGIVDRESFLGREYE----------knkeksvfyknarffsteelmdlmrkagfeefkvvqtlfkhpselseiepvkegygegafvvirgt
d1ws6a1 --------------------------vevflpeakaqgerftvafmappyamdlaalfgellasglveagglyvlqhpkdlylplgerrvyg
d1wy7a1 --------------------------sqrkhadrpfllkafeisdvvysihlakpevrrfiekfswehgfvvthrlttkieiplqfffhrkk
d1wzna1 ITDFPCWFYGGRD-------------gpvvwneqkgeeklvimdwrevepavqklrfkrlvqilrpngevkaflvddelniytprevrllae
d1xdza_ VA------------------------lkaasaeeelnagkkaittlggelenihsfklpieesdrnimvirkikntpkkyprkpgtpnkspi
d1xtpa_ FFKENC--------------------stgdrflvdkedssltrsdihykrlfnesgvrvvkeafqeewptdlfplkmyalk...........
d1xvaa_ VIDHRNYDYILSTGCAP---------pgkniyyksdltkdittsvltvnnkahmvtldytvqvpgagrdgapgfskfrlsyyphclasftel
d1xxla_ LLVDHY--------------------apedpvldefvnhlnrlrdpshvresslsewqamfsanqlayqdiqkwnlpiqydswikrggtpad
d1y8ca_ IFDINS--------------------yyklsqvlgnndfnydddevfyywenqfeddlvsmyisffvrdgefykrfdeeheeraykeediek
d1yb2a1 TFYLPNFDQ-----------------sektvlslsasgmhhletvelmkrrilvregatrpasddlthtafitfaikksgmvyri.......
d1yzha1 HF------------------------ktdnrglfeyslvsfsqygmklngvwldlhasdfegnvmteyeqkfsnkgqviyrveaef......
d1zkda1 --------------------------gpavilaneyfdvlpihqaikretgwhervieigasgelvfgvaadpipgfeallpplarlsppga
d1zq9a1 --------------------------fvfklllhrpffrcailmfqrefalrlvakpgdklycrlsintqllarvdhlmkvgknnfrpppkv
d1zx0a1 TYCNLTSWGE----------------lmkskysditimfeetqvpalleagfrrenirtevmalvppadcryyafpqmitplvtkg......
d2a14a1 VTTVTLRLP-----------------symvgkrefscvalekgeveqavldagfdieqllhspqsysvtnaanngvccivarkkp.......
d2ar0a1 AVVVPDNVL-----------------feggkgtdirrdlmdkchlhtilrlptgifyaqgvktnvlfftkgtvanpnqdknctddvwvydlr
d2as0a2 VTCSCSQH------------------vdlqmfkdmiiaagakagkflkmlepyrtqapdhpilmaskdteylkclflyvedmr.........
d2avda1 AVLR----------------------vlwrgkvlqppkgdvaaecvrnlnerirrdvrvyisllplgdgltlafki................
d2avna1 IATVDNFYTFL---------------qqmiekdawdqitrflktqttsvgttlfsfnsyafkpedldslegfetvdirgigvmeypderise
d2b25a1 AVYVVNIT------------------qvielldgirtcelalscekisevivrdwlvclakqkngilaqkveskintdvqldsqekigvkge
d2b2ca1 S-------------------------sqgesvwlhlpliahlvafnrkifpavtyaqsivstypsgsmgylicaknanrdvttpartltaeq
d2b78a2 IASTNAANMTVSQF------------kkqiekgfgkqkhtyldlqqlpsdfavnvqdessnylkvftikv......................
d2b9ea1 --------------------------hyilldpscsgsgmpsrqleepgagtpspvrlhalagfqqralchaltfpslqrlvystcslcqee
d2bm8a1 FI------------------------iedmipywyryapqlfseylgafrdvlsmdmlyanassqldrgvlrrva.................
d2bzga1 --------------------------gkkfqyllcvlsydptkhpgppfyvphaeierlfgkicnirclekvdafeerhkswgidclfekly
d2cl5a1 --------------------------ldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdflayvrgsssfecthyssyleymkvvd
d2cmha_ ISVA----------------------khpllehvsmqnalknmggvfsvampfvaplrilsnkgyiyasfkthplkdlmtpkiealtsvryy
d2dpma_ MLSNSSS-------------------alveelykdfnihyveatrtngaksssrgkiseiivtnyek.........................
d2dula1 GV------------------------tatdgaplcgahpraclrkylavplrgelchevgtrilvgviaryaakydlgidvilayykdhyfr
d2eg5c_ --------------------------fpndfnsvfkllpsfyrklekengrkigscligampgsfysrlfpeesmhflhscyclqwlsqvps
d2ex4a1 VIK-----------------------dnmaqegvilddvdssvcrdldvvrriicsaglsllaeerqenlpdeiyhvysfalr.........
d2f8la1 FFLVPDAMFGTSDF------------akvdkfikknghiegiiklpetlfkseqarksililekadvdvkppkevllanlssltdpsvtapi
d2fhpa1 --------------------------vsqlekmlerqlltneavivcetdktvklpetigtlkktretvygitqvtiyrq............
d2frna1 --------------------------dgaiihyhntvpeklmprepfetfkritkeygydveklnelkikryapgvwhvvldlrvfks....
d2g1pa_ --------------------------pfgrykkpyfpeaelyhfaekaqnaffycesyadsmaraddssvvycdppyaplsatanftayhtn
d2gb4a_ --------------------------efqylvavlsydptkhagppfyvpsaelkrlfgtkcsmqcleevdaleerhkawgldylfeklyll
d2gh1a1 ICFEPHWISNM---------------asylldgekqsefiqlgvlqklfesdtqrngkdgnigmkipiylselgvkniecrvsdkvnfldsn
d2gtia1 --------------------------kytdlqcieslnvlfdgrdngaleafkkcrngvyinttkikslsmikgpqradlngvvvekvgdsd
d2h00a1 --------------------------vpqktllmdalkeeseiiydfcmcnppffanqleakgvnsrnprrpppssvntggiteimaeggel
d2h1ra_ --------------------------ipykissplifklishrplfkcavlmfqkefaermlanvgdsnysrltinvklfckvtkvcnvnrs
d2i62d_ VMVDA---------------------lkssyymigeqkfsslplgwetvrdaveeagytieqfevisqnyssttsnneglfslvgrkpgrs.
d2i6ga1 LI------------------------vaamdtpdfpctvgfpfafkegelrryyegwdmlkynedvgelhrtdengnriklrfatmlarkta
d2ibta1 VFVVPATWL-----------------vledfallreflaregktsvyylgevfpqkkvsavvirfqksgkglslwdtqesesgftpilwaey
d2ifta1 YVET----------------------ekdkplitpenwtllkekttgivsyrlyqn....................................
d2igta1 --------------------------grgthgevwqlfdhlplmldicreilspkalglvltaysirasfysmhelmretmrgaggvvasge
d2nyua_ LCKTWAG-------------------sqsrrlqrrlteefqnvriikpeasrkessevyflatqyhg.........................
d2o57a1 AITDPMKE------------------dgidkssiqpildriklhdmgslglyrslakecglvtlrtfsrpdslvhhyskvkaelikrsseia
d2okca1 AVVLPDNVLFEAG-------------agetirkrllqdfnlhtilrlptgifyaqgvkanvlffskgqptkeiwfydyrtdikhtlatnkle
d2oo3a1 --------------------------vyvnhtdgvsklnallpppekrglifidpsyerkeeykeipyaiknayskfstglycvwypvvnka
d2oyra1 --------------------------vkkemrvfqslvgpdldadglleparllatkrvvvkrpdyapplanvatpnavvtkghrfdiyagt
d2p7ia1 FLVCPNAN------------------avsrqiavkmgiishnsavteaefahghrctyaldtlerdasraglqvtyrsgiffkalanfqwdq
d2pbfb_ IIPI----------------------eedytqvlyeitkkngkiikdrlfdvcfvslkkn................................
d2plwa_ --------------------------kimdpipnvyfiqgeigkdnmnnikninyidnmnnnsvdyklkeilqdkkidiilsdaavpcignk
d2py6a1 --------------------------tdtnfasritvhgcgagentirvpfnhegghggfvkpadadhepadlidvrpiddiiddaptfikm
d2qyoa2 --------------------------krgkvividmvinekkdenqltqikllmnvtiscvngkerneeewkklfieagfqdykispftglm
d2uyoa1 --------------------------avidgirqfvilasgldsrayrldwptgttvyeidqpkvlayksttlaehgvtptadrrevpidlr
d2yvla_ --------------------------vhkslmegapvgfllptanqvikllesienyfgnlevveilhrhyktiserfrpedqmvahtaylv
d2yxda_ --------------------------klefnkafiggtkniekiieildkkkinhivantivlenaakiinefesrgynvdavnvfisyakk
d2zsua_ VTQAGSVYLFTDEFLTAY--------rkmrkvfdkvyyysfpvigyaspwaflvgvkgsidfmkvdaekgkklgleyydpdkhetlfqmpry
d3a4ta_ VYSTCSMEVEENEEVI----------kyilqkrndveliiikanefkginikegyikgtlrvfppnepffiaklrki...............
d3a7ea_ --------------------------ldhwkdrylpdtllleecgllrkgtvlladnvicpgapdflahvrgsscfecthyqsfleyrevvd
d3c3ya_ AYDNTLWG------------------gtvaqpesevpdfmkenreavielnkllaadprieivhlplgdgitfcrrly..............
d3d2la_ LFDVHSPY------------------kmetlfngktyathaeqssyiwfadpgeeplsvvheltffiegedgrydrvdethhqrtyppeqyi
d3doua1 LL------------------------kqfqgdmtndfiaiwrknfssykiskppasrgssseiyimffgfka....................
d3e05c_ VLNAVT--------------------ldtltkavefledhgymvevacvnvaktkglteykmfeshnpvyiitawk................
d3fuxa_ --------------------------lktgrfarlvflvqkevaermtarpktpaygvltlrvahhavaerlfdlppgaffpppkvwsslvr
d3hh9b_ VAQN----------------------gvcflqqeeaidshrklshyfsdvgfyqaaiptyyggimtfawatdndalrhlsteiiqarflasg
d3lhdd_ VAYTPCSNQVMRLHEKLRE-------fkdyfmkprtinvlvfdqevkkecmrprttalvhtgyitfarri......................
d3njrb1 V-------------------------anavtlesetlltqlharhggqllridiaqaeplgrmrgwsasrpqlqwsgqr.............
d3p71t_ --------------------------aansferamfinyeqvnmgdrfgqimienlrrrqcdlagvetckslesqkerllsngwetasavdm
d3p9kb2 VLVQC---------------------ilpvnpeanpssqgvfhvdmimlahnpggreryerefqalargagftgvkstyiyanawaieftk.
d3pt9a3 --------------------------npgttvftedcnvllklvmagevtnslgqrlpqkgdvemlcggppcqgfsgmnrfnsrtyskfkns
d3qv2a_ --------------------------vqvknldsisikqieslncntwfmsppcqpynnsimskhkdindpraksvlhlyrdilpylinkpk
d3r0qg_ YPSHAR--------------------mwlapiksniadrkrndfdgamadwhnfsdeiksyygvdmgvltkpfaeeqekyyiqtamwndlnp
d3r9xb_ --------------------------cslgkelkvvgnlpynvasliientvynkdcvplavfmvqkevaeklqgkkdtgwlsvfvrtfydv
d3tqsd_ --------------------------svktdkplrvvgnlpynistpllfhlfsqihciedmhfmlqkevvrritaevgshdygrlsvmaqy
d4blwa_ --------------------------hpsdypllrsefqkdsrarvekadgfqqlkaklppvsrrglilidppyemktdyqavvsgiaegyk
d4c06a_ LPASAE--------------------lfvapisdqmlewrlgfwsqvkqhygvdmscmesfatrclmghseivvqdlsgedvlarpqrfaql
d4h0nc_ --------------------------msppcqpftrngkylddndprtnsflyligildqldnvdyilmenvkgfenstvrnlfidklkecn
d4jxja_ --------------------------sslvasmtlmlqkevvericakpstkaygrlsvicsliatvekcfdvaptafypppkvysaivklt
d4o29a1 VIPVEERLGQVL--------------ykvvkrgdkiekkaityvmfvplr..........................................
d4oa5e_ VADNTFLFGSVF--------------dehptekvssnahasmrafndelankekylstiiptsegmmvsiklt...................
d4uoec_ VAQCE---------------------slwihvgtiknmigyakklfkkveyanisiptypcgcigilccsktdtgltkpnkkleskefadlk
d4ymhc_ --------------------------agyvktildqgllsangiilcdnvfargltigpdcapwlndhvrpywngcgqaldkfsaglmedpr
d5bp7b1 LIGEPYWR------------------qvpptedvargclanstsdflmlpellasfgrlgydvvemvladqdgwdryeaakwltmrrwlean
d5c0og_ VAYLPNIT------------------qvlelvraaeahpfrlervlevgwrewevrlpvahprfqqvghtaflvalrrwka...........
d5fuba1 WPSSAC--------------------ltivpcqafsdyrqkvefwenpyglnfsylqslaqkeflskpkfshhlqpedclstpadvitldmv
d5h02a_ LLDQRNYDAILDDGYSSK--------hahyycgdtvsvypehvdeglarfkyefsdgsvynlnmfplrkdytrqllhevgfqeintlgdfke
d5heka_ --------------------------nlf...............................................................
d5lhma1 ILDNTLWSGKV---------------adpsvvgdpetdslrrinaklltdervdlsmlpiadgltlarkr......................
d5n5da1 VVDNV---------------------vlggavtdpdhpdagvqgvrrfhemlagrsdvtatsiqtvgtkgydgftlalvtg...........
d6mhta_ --------------------------ekpegditqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen


                                                                                                    
                                                                                                    
d1af7a2 ............................................................................................
d1booa_ ktewpksditkvlapysdrmkkliedpdkfytpktrpsghdigksfskdnggsippnllqisnsesngqylancklmgikahparfpaklpe
d1dcta_ drkrvfyigfrkelninylppiphlikptfkdviwdlkdnpipaldknktngnkciypnheyfigsystifmsrnrvrqwnepaftvqasgr
d1dl5a1 ............................................................................................
d1dusa_ ............................................................................................
d1eg2a_ ............................................................................................
d1ej0a_ ............................................................................................
d1fbna_ ............................................................................................
d1fp1d2 ............................................................................................
d1fp2a2 slieiyp.....................................................................................
d1g55a_ ptslgipnsrlryfliaklqseplpfqapgqvlmefpkieihrknqqdsdlsvkmlkdfleddtdvnqyllppksllryallldivqptcrr
d1g60a_ ............................................................................................
d1hnna_ l...........................................................................................
d1i4wa_ lkgfdsqcieewdpilfsaaeiwptkgkpialvemdpidfdfdvdnwdyvtrhlmilkrtplntvmdslghggqqyfnsritdkdllkkcpi
d1i9ga_ ............................................................................................
d1im8a_ fnfgsmiavk..................................................................................
d1ixka_ ............................................................................................
d1jg1a_ ............................................................................................
d1jqea_ atappdlraelgkdlqepefsakkegkvlfnntlsfiviea...................................................
d1jsxa_ ............................................................................................
d1kpia_ alqahkdeaialkgqetcdiymhylrgcsdlfrdkytdvcqftlvk..............................................
d1kr5a_ ............................................................................................
d1l3ia_ ............................................................................................
d1l9ka_ eagrtlrvlnlvenwlsnntqfcvkvlnpymssviekmealqrkhggalvrnplsrnsthemywvsnasgnivssvnmisrmlinrftmrhk
d1m6ex_ easeiywssctkdgdgggsveeegynvarcmravaepllldhfgeaiiedvfhryklliiermskektkfinvivslirksd..........
d1m6ya2 ............................................................................................
d1ne2a_ hhsydrarieavifgvrnhsf.......................................................................
d1nkva_ pdddfaaevraelniapkryvtyarecfgwgvfaliar......................................................
d1nv8a_ dsagkyrflllnrrss............................................................................
d1nw3a_ ............................................................................................
d1o54a_ ............................................................................................
d1o9ga_ apdvvltdlpygerthwegqvpgqpvagllrslasalpahaviavtdrsrkipvapvkalerlkigtrsavmvraadvleagp.........
d1oria_ kvedltftspfclqvkrndyvhalvayfnieftrchkrtgfstspespythwkqtvfymedyltvktgeeifgtigmrpnaknnrdldftid
d1p91a_ aakevfdcqtdfnihlwqrsy.......................................................................
d1pjza_ vyvlerv.....................................................................................
d1q0sa_ rtinknsekqynhfkqncdkiifsslhfkdvkildgdfvyvdppylitvadynkfwsedeekdllnlldslndrgikfgqsnvlehhgkent
d1qama_ yfhpkpkvnsslirlnrkksrishkdkqkynyfvmkwvnkeykkiftknqfnnslkhagiddlnnisfeqflslfnsyklfnk.........
d1qyra_ qyycnvipvlevppsaftpppkvdsavvrlvphatmphpvkdvrvlsritteafnqrrktirnslgnlfsvevltgmgidpamraenisvaq
d1qzza2 ftavs.......................................................................................
d1r74a_ lqaafggkcqhsvlgdfkpykpgqtyipcyfihvlkrt......................................................
d1ri5a_ fidfyedegrrnpelskkmglgcltreesevvgiyevvvfrkl.................................................
d1rjda_ lnditettrlldvctkreiptivisecllcymhnnesqllintimskfshglwisydpiggsqpndrfgaimqsnlkesrnlemptlmtyns
d1sqga2 ............................................................................................
d1suia1 ............................................................................................
d1t43a_ ............................................................................................
d1u2za_ stvmedvdeslfspaargrrnrgtpvkyt...............................................................
d1ufka_ ............................................................................................
d1uira_ pkdllealeketmvstdqnpfyvtpegearqapy..........................................................
d1uwva2 rv..........................................................................................
d1v39a_ ysaemrllsiytgenmrltrvtksdavnyekkmyylnkivrnkvvvnfdypnqeydyfhmyfmlrtvycnktfpttkakvlflqqsifrfln
d1vbfa_ ............................................................................................
d1ve3a1 keaeekvgnysyltvynpk.........................................................................
d1vl5a_ kkqelsdfikskpteyyqkfkivvedgrvysfrgesilmkarkpt...............................................
d1vlma_ kk..........................................................................................
d1ws6a1 enaltlvev...................................................................................
d1wy7a1 leritvdiyrfskvi.............................................................................
d1wzna1 kyfekvkiygnlkrelspndmrywivgiaks.............................................................
d1xdza_ e...........................................................................................
d1xtpa_ ............................................................................................
d1xvaa_ vqeafggrcqhsvlgdfkpyrpgqayvpcyfihvlkktg.....................................................
d1xxla_ rekqiithlnhasdeardtfcitlnqngqpisfclkailiqgikreg.............................................
d1y8ca_ ylkhgqlnildkvdcysnkkvekfteritylvklgg........................................................
d1yb2a1 ............................................................................................
d1yzha1 ............................................................................................
d1zkda1 vfewrpdteilkiasrvrdqggaaliidyghlrsdvgdtfqaiashsyadplqhpgradltahvdfdalgraaesigarahgpvtqgaflkr
d1zq9a1 essvvriepknppppinfqewdglvritfvrknktlsaafkssavqqlleknyrihcsvhniiipedfsiadkiqqiltstgfsdkrarsmd
d1zx0a1 ............................................................................................
d2a14a1 ............................................................................................
d2ar0a1 tnmpsfgkrtpftdehlqpfervygedphglsprtegewsfnaeetevadseenkntdqhlatsrwrkfsrewirtaksdsldiswlkdkds
d2as0a2 ............................................................................................
d2avda1 ............................................................................................
d2avna1 reetifrleqelsrdrniiwkadhiffvlkkkr...........................................................
d2b25a1 lfqeddheeshsdfpygsfpyvarpvhwqpghtaflvklrkv..................................................
d2b2ca1 ikalnlrfynsevhkaafvlpqfvknale...............................................................
d2b78a2 ............................................................................................
d2b9ea1 nedvvrdalqqnpgafrlapalpawphrglstfpgaehclraspettlssgffvavierv................................
d2bm8a1 ............................................................................................
d2bzga1 lltek.......................................................................................
d2cl5a1 glekaiyqgps.................................................................................
d2cmha_ nedihraafalpknlqevfkdniks...................................................................
d2dpma_ ............................................................................................
d2dula1 afvklkdgarkgdetleklgyiyfddktgkfeleqgflptrpnaygpvwlgplkdekivskmvkeaeslslarkkqalkllkmidqeldipl
d2eg5c_ glvtelgigtnkgsiysskasrlpvqkayldqftkdfttflrihseelfshgrmlltcickgveldarnaidllemaindlvveghleeekl
d2ex4a1 ............................................................................................
d2f8la1 laeienwfk...................................................................................
d2fhpa1 ............................................................................................
d2frna1 ............................................................................................
d2g1pa_ sftleqqahlaeiaeglverhipvlisnhdtmltrewyqraklhvvkvrrsissnggtrkkvdellalykp.....................
d2gb4a_ tek.........................................................................................
d2gh1a1 mhhndkndlyqslkeegiagdpgdkqqfverliargltydnalaqyeaelrffkalhlhsslvyapnmkitfgeiec...............
d2gtia1 vefwfavrkdgddvifsrtgslepsh..................................................................
d2h00a1 efvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrtmrwalawsfyd..........................
d2h1ra_ sfnpppkvdsvivklipkessfltnfdewdnllricfsrkrktlhaifkrnavlnmlehnyknwctlnkqvpvnfpfkkycldvlehldmce
d2i62d_ ............................................................................................
d2i6ga1 ............................................................................................
d2ibta1 phwegeii....................................................................................
d2ifta1 ............................................................................................
d2igta1 lvireagldgktpgrvlstslfsrwepk................................................................
d2nyua_ ............................................................................................
d2o57a1 sfcspefqanmkrglehwieggragkltwggmlfrksdki....................................................
d2okca1 rhhlddfvscynnrveiydaennpqgrwrkypvdeiiardktslditwikpg........................................
d2oo3a1 wteqflrkmreissksvrielhlnplinegmtgcglwiinppytfpseiklvletlttyfnpgsssymiesgsklc................
d2oyra1 pv..........................................................................................
d2p7ia1 ilqtdilskeyldgcyqlgqqypdlcasifllcekg........................................................
d2pbfb_ ............................................................................................
d2plwa_ iddhlnsceltlsithfmeqyiniggtyivkmylgsqtnnlktylkgmfqlvhttkpkasrnesreiylvcknflgr...............
d2py6a1 diegselsalkgarraisehkpklaisayhrstdlldltnyilsirpdyqiglrhhtpdrwdtclyfy........................
d2qyoa2 slieiyp.....................................................................................
d2uyoa1 qdwppalrsagfdpsartawlaegllmylpataqdglfteigglsavgsriavetsplhgdewreqmqlrfrrvsdalgfeqavdvqeliyh
d2yvla_ fgrklkt.....................................................................................
d2yxda_ ipsghmflaknpitiikavr........................................................................
d2zsua_ ivqml.......................................................................................
d3a4ta_ ............................................................................................
d3a7ea_ glekaiykg...................................................................................
d3c3ya_ ............................................................................................
d3d2la_ twlreagfrvcavtgdfksdaptetaeriffvaeki........................................................
d3doua1 ............................................................................................
d3e05c_ ............................................................................................
d3fuxa_ ltptgalddpglfrlveaafgkrrktllnalaaagypkarveealralglpprvraeeldleafrrlregle....................
d3hh9b_ lkcryynpaihtaafalpqylqda....................................................................
d3lhdd_ ............................................................................................
d3njrb1 ............................................................................................
d3p71t_ melynrlpraevsrieslefldemelleqlmrhyclcwatkggnelglkeity.......................................
d3p9kb2 ............................................................................................
d3pt9a3 lvvsflsycdyyrprffllenvrnfvsyrrsmvlkltlrclvrmgyqctfgvlqagqygvaqtrrraiilaaapgeklplfpeplhvfapra
d3qv2a_ hifienvplfkeslvfkeiyniliknqyyikdiicspidigipnsrtryyvmarltpfkneiqlhqekesmisnyldnnvnesysipsdlil
d3r0qg_ qqiigtptivkemdcltasvseieevrsnvtsvinmehtrlcgfggwfdvqfsgrkedpaqqeielttapseqhcthwgqqvfimsnpinve
d3r9xb_ nyvmtvpprffvpppkvqsaviklvknekfpvkdlknykkfltkifqnrrkvlrkkipeellkeaginpdarveqlsledffklyrliedsg
d3tqsd_ fcdntylftvspqaftppprvesaiirliprhnftpvaknldqlshvvkeafsyrrktvgnalkklinpsqwplleinpqlrpqeltvedfv
d4blwa_ rfatgiyalwypvvlrqqikrmihdleatgirkilqielavlpdsdrrgmtasgmivinppwkleqqmnnvlpwlhsklvpagtghatvswi
d4c06a_ elaragleqeleagvggrfrcscygsaplhgfavwfqvtfpggdsekplvlstsplhpathwkqallylnepvpveqdtdisgeitllpspd
d4h0nc_ fiyqefllcpstvgvpnsrlryyctarrnnltwpfkrrdeiitrlpkdfgvphslesiieedvdekflvpekmlrcakvfdicyktskrscc
d4jxja_ plenipnsdliskvelitkmafagrrkmiksslknlapnisellaklnisdncraenltpndylslasli......................
d4o29a1 ............................................................................................
d4oa5e_ ............................................................................................
d4uoec_ yynyenhsaafklpafllkeieni....................................................................
d4ymhc_ idvlllpvfdgvtqirwkdg........................................................................
d5bp7b1 pddelakevraqltsepgryasytreylgwgvfalmpr......................................................
d5c0og_ ............................................................................................
d5fuba1 tiqvsdlerlkgeftftveksgmfhgftvwfsahfqcleedgpsielntgpyseithwkqtlfmldapvsveegdiiagsirlqrnpiwrrh
d5h02a_ tykedepdfflhvaekn...........................................................................
d5heka_ ............................................................................................
d5lhma1 ............................................................................................
d5n5da1 ............................................................................................
d6mhta_ vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnfqfpkpfelntfvkdlllpdsevehlvidrkdl


                                                                                                    
                                                                                                    
d1af7a2 ............................................................................................
d1booa_ ffirmltepddlvvdifggsnttglvaeresrkwisfemkpeyvaasafrfldnniseekitdiynrilngesldlnsi.............
d1dcta_ qcqlhpqapvmlkvsknlnkfvegkehlyrrltvrecarvqgfpddfifhyeslndgykmignavpvnlayeiaktiksal...........
d1dl5a1 ............................................................................................
d1dusa_ ............................................................................................
d1eg2a_ ............................................................................................
d1ej0a_ ............................................................................................
d1fbna_ ............................................................................................
d1fp1d2 ............................................................................................
d1fp2a2 ............................................................................................
d1g55a_ svcftkgygsyiegtgsvlqtaedvqveniyksltnlsqeeqitkllilklryftpkeianllgfppefgfpekitvkqryrllgnslnvhv
d1g60a_ ............................................................................................
d1hnna_ ............................................................................................
d1i4wa_ dltndefiyltklfmewpfkp.......................................................................
d1i9ga_ ............................................................................................
d1im8a_ ............................................................................................
d1ixka_ ............................................................................................
d1jg1a_ ............................................................................................
d1jqea_ ............................................................................................
d1jsxa_ ............................................................................................
d1kpia_ ............................................................................................
d1kr5a_ ............................................................................................
d1l3ia_ ............................................................................................
d1l9ka_ katyepdvdlgsgtrnigi.........................................................................
d1m6ex_ ............................................................................................
d1m6ya2 ............................................................................................
d1ne2a_ ............................................................................................
d1nkva_ ............................................................................................
d1nv8a_ ............................................................................................
d1nw3a_ ............................................................................................
d1o54a_ ............................................................................................
d1o9ga_ ............................................................................................
d1oria_ ldfkgqlcelscstdyrmr.........................................................................
d1p91a_ ............................................................................................
d1pjza_ ............................................................................................
d1q0sa_ llkewskkynvkhlnkkyvfniyhskekngtdevyifn......................................................
d1qama_ ............................................................................................
d1qyra_ ycqmanylaena................................................................................
d1qzza2 ............................................................................................
d1r74a_ ............................................................................................
d1ri5a_ ............................................................................................
d1rjda_ kekyasrwsaapnvivndmweifnaqipeserkrlrslqfldeleelkvmqthyilmkaqwh..............................
d1sqga2 ............................................................................................
d1suia1 ............................................................................................
d1t43a_ ............................................................................................
d1u2za_ ............................................................................................
d1ufka_ ............................................................................................
d1uira_ ............................................................................................
d1uwva2 ............................................................................................
d1v39a_ ip..........................................................................................
d1vbfa_ ............................................................................................
d1ve3a1 ............................................................................................
d1vl5a_ ............................................................................................
d1vlma_ ............................................................................................
d1ws6a1 ............................................................................................
d1wy7a1 ............................................................................................
d1wzna1 ............................................................................................
d1xdza_ ............................................................................................
d1xtpa_ ............................................................................................
d1xvaa_ ............................................................................................
d1xxla_ ............................................................................................
d1y8ca_ ............................................................................................
d1yb2a1 ............................................................................................
d1yzha1 ............................................................................................
d1zkda1 lgietralslmakatpqvsediagalqrltgegrgamgsmfkvigvsdpkietlvalsdd................................
d1zq9a1 iddfirllhgfnaegihfs.........................................................................
d1zx0a1 ............................................................................................
d2a14a1 ............................................................................................
d2ar0a1 idadslpepdvlaaeamgelvqalseldalmrelgasdeadlqrqlleeafggv......................................
d2as0a2 ............................................................................................
d2avda1 ............................................................................................
d2avna1 ............................................................................................
d2b25a1 ............................................................................................
d2b2ca1 ............................................................................................
d2b78a2 ............................................................................................
d2b9ea1 ............................................................................................
d2bm8a1 ............................................................................................
d2bzga1 ............................................................................................
d2cl5a1 ............................................................................................
d2cmha_ ............................................................................................
d2dpma_ ............................................................................................
d2dula1 fydthaigrrlkietkkveeiisalreqgyeatrthfsptgiktsapyevfietikr...................................
d2eg5c_ dsfnlpvyipsaeevkciveeegsfeilyletfkvlydagfsiddehikaeyvassvravyepilashfgeaiipdifhrfakhaakvlplg
d2ex4a1 ............................................................................................
d2f8la1 ............................................................................................
d2fhpa1 ............................................................................................
d2frna1 ............................................................................................
d2g1pa_ ............................................................................................
d2gb4a_ ............................................................................................
d2gh1a1 ............................................................................................
d2gtia1 ............................................................................................
d2h00a1 ............................................................................................
d2h1ra_ krsinldendflklllefnkkgihff..................................................................
d2i62d_ ............................................................................................
d2i6ga1 ............................................................................................
d2ibta1 ............................................................................................
d2ifta1 ............................................................................................
d2igta1 ............................................................................................
d2nyua_ ............................................................................................
d2o57a1 ............................................................................................
d2okca1 ............................................................................................
d2oo3a1 ............................................................................................
d2oyra1 ............................................................................................
d2p7ia1 ............................................................................................
d2pbfb_ ............................................................................................
d2plwa_ ............................................................................................
d2py6a1 ............................................................................................
d2qyoa2 ............................................................................................
d2uyoa1 denravvadwlnrhgwrataqsapdemrrvgrwgdgvpmaddkdafaefvtahrl.....................................
d2yvla_ ............................................................................................
d2yxda_ ............................................................................................
d2zsua_ ............................................................................................
d3a4ta_ ............................................................................................
d3a7ea_ ............................................................................................
d3c3ya_ ............................................................................................
d3d2la_ ............................................................................................
d3doua1 ............................................................................................
d3e05c_ ............................................................................................
d3fuxa_ ............................................................................................
d3hh9b_ ............................................................................................
d3lhdd_ ............................................................................................
d3njrb1 ............................................................................................
d3p71t_ ............................................................................................
d3p9kb2 ............................................................................................
d3pt9a3 cqlsvvvddkkfvsnitrlssgpfrtitvrdtmsdlpeiqngasnseipyngeplswfqrqlrgshyqpilrdhickdmsplvaarmrhipl
d3qv2a_ kkgmlfdivgkddkrtccftksytkivegtgsiycpiephfipvkkaedllnknlryftpneikkihgfssnfttqidgltdkqqyqclgns
d3r0qg_ egdnlnlgllmsrskenhrlmeielnceikeasgnpkesfkktyfie.............................................
d3r9xb_ ............................................................................................
d3tqsd_ kisniln.....................................................................................
d4blwa_ vpe.........................................................................................
d4c06a_ nprrlrillrykvgdheektkdfame..................................................................
d4h0nc_ ftkaythyadgtgsiftdkprevvqkcyaaaaqneiggekfvelfkelklryftpkevlmimcfpksynlptnismkqcyrllgnsvnvkvi
d4jxja_ ............................................................................................
d4o29a1 ............................................................................................
d4oa5e_ ............................................................................................
d4uoec_ ............................................................................................
d4ymhc_ ............................................................................................
d5bp7b1 ............................................................................................
d5c0og_ ............................................................................................
d5fuba1 lsitflwninstevstvktkcfpmwr..................................................................
d5h02a_ ............................................................................................
d5heka_ ............................................................................................
d5lhma1 ............................................................................................
d5n5da1 ............................................................................................
d6mhta_ vmtnqeieqttpktvrlgivgkggqgeriystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqaykqfgn


                                                                                                    
                                                                                                    
d1af7a2 ............................................................................................
d1booa_ ............................................................................................
d1dcta_ ............................................................................................
d1dl5a1 ............................................................................................
d1dusa_ ............................................................................................
d1eg2a_ ............................................................................................
d1ej0a_ ............................................................................................
d1fbna_ ............................................................................................
d1fp1d2 ............................................................................................
d1fp2a2 ............................................................................................
d1g55a_ vaklikilye..................................................................................
d1g60a_ ............................................................................................
d1hnna_ ............................................................................................
d1i4wa_ ............................................................................................
d1i9ga_ ............................................................................................
d1im8a_ ............................................................................................
d1ixka_ ............................................................................................
d1jg1a_ ............................................................................................
d1jqea_ ............................................................................................
d1jsxa_ ............................................................................................
d1kpia_ ............................................................................................
d1kr5a_ ............................................................................................
d1l3ia_ ............................................................................................
d1l9ka_ ............................................................................................
d1m6ex_ ............................................................................................
d1m6ya2 ............................................................................................
d1ne2a_ ............................................................................................
d1nkva_ ............................................................................................
d1nv8a_ ............................................................................................
d1nw3a_ ............................................................................................
d1o54a_ ............................................................................................
d1o9ga_ ............................................................................................
d1oria_ ............................................................................................
d1p91a_ ............................................................................................
d1pjza_ ............................................................................................
d1q0sa_ ............................................................................................
d1qama_ ............................................................................................
d1qyra_ ............................................................................................
d1qzza2 ............................................................................................
d1r74a_ ............................................................................................
d1ri5a_ ............................................................................................
d1rjda_ ............................................................................................
d1sqga2 ............................................................................................
d1suia1 ............................................................................................
d1t43a_ ............................................................................................
d1u2za_ ............................................................................................
d1ufka_ ............................................................................................
d1uira_ ............................................................................................
d1uwva2 ............................................................................................
d1v39a_ ............................................................................................
d1vbfa_ ............................................................................................
d1ve3a1 ............................................................................................
d1vl5a_ ............................................................................................
d1vlma_ ............................................................................................
d1ws6a1 ............................................................................................
d1wy7a1 ............................................................................................
d1wzna1 ............................................................................................
d1xdza_ ............................................................................................
d1xtpa_ ............................................................................................
d1xvaa_ ............................................................................................
d1xxla_ ............................................................................................
d1y8ca_ ............................................................................................
d1yb2a1 ............................................................................................
d1yzha1 ............................................................................................
d1zkda1 ............................................................................................
d1zq9a1 ............................................................................................
d1zx0a1 ............................................................................................
d2a14a1 ............................................................................................
d2ar0a1 ............................................................................................
d2as0a2 ............................................................................................
d2avda1 ............................................................................................
d2avna1 ............................................................................................
d2b25a1 ............................................................................................
d2b2ca1 ............................................................................................
d2b78a2 ............................................................................................
d2b9ea1 ............................................................................................
d2bm8a1 ............................................................................................
d2bzga1 ............................................................................................
d2cl5a1 ............................................................................................
d2cmha_ ............................................................................................
d2dpma_ ............................................................................................
d2dula1 ............................................................................................
d2eg5c_ kgfynnliislakkp.............................................................................
d2ex4a1 ............................................................................................
d2f8la1 ............................................................................................
d2fhpa1 ............................................................................................
d2frna1 ............................................................................................
d2g1pa_ ............................................................................................
d2gb4a_ ............................................................................................
d2gh1a1 ............................................................................................
d2gtia1 ............................................................................................
d2h00a1 ............................................................................................
d2h1ra_ ............................................................................................
d2i62d_ ............................................................................................
d2i6ga1 ............................................................................................
d2ibta1 ............................................................................................
d2ifta1 ............................................................................................
d2igta1 ............................................................................................
d2nyua_ ............................................................................................
d2o57a1 ............................................................................................
d2okca1 ............................................................................................
d2oo3a1 ............................................................................................
d2oyra1 ............................................................................................
d2p7ia1 ............................................................................................
d2pbfb_ ............................................................................................
d2plwa_ ............................................................................................
d2py6a1 ............................................................................................
d2qyoa2 ............................................................................................
d2uyoa1 ............................................................................................
d2yvla_ ............................................................................................
d2yxda_ ............................................................................................
d2zsua_ ............................................................................................
d3a4ta_ ............................................................................................
d3a7ea_ ............................................................................................
d3c3ya_ ............................................................................................
d3d2la_ ............................................................................................
d3doua1 ............................................................................................
d3e05c_ ............................................................................................
d3fuxa_ ............................................................................................
d3hh9b_ ............................................................................................
d3lhdd_ ............................................................................................
d3njrb1 ............................................................................................
d3p71t_ ............................................................................................
d3p9kb2 ............................................................................................
d3pt9a3 fpgsdwrdlpniqvrlgdgviahklqytfhdvkngysstgalrgvcscaegkacdpesrqfstlipwclphtgnrhnhwaglygrlewdgff
d3qv2a_ vscfviaqlmeylfddlke.........................................................................
d3r0qg_ ............................................................................................
d3r9xb_ ............................................................................................
d3tqsd_ ............................................................................................
d4blwa_ ............................................................................................
d4c06a_ ............................................................................................
d4h0nc_ sellkilfe...................................................................................
d4jxja_ ............................................................................................
d4o29a1 ............................................................................................
d4oa5e_ ............................................................................................
d4uoec_ ............................................................................................
d4ymhc_ ............................................................................................
d5bp7b1 ............................................................................................
d5c0og_ ............................................................................................
d5fuba1 ............................................................................................
d5h02a_ ............................................................................................
d5heka_ ............................................................................................
d5lhma1 ............................................................................................
d5n5da1 ............................................................................................
d6mhta_ svvinvlqyiaynigsslnfkpy.....................................................................


                                                                                   
                                                                                   
d1af7a2 ...........................................................................
d1booa_ ...........................................................................
d1dcta_ ...........................................................................
d1dl5a1 ...........................................................................
d1dusa_ ...........................................................................
d1eg2a_ ...........................................................................
d1ej0a_ ...........................................................................
d1fbna_ ...........................................................................
d1fp1d2 ...........................................................................
d1fp2a2 ...........................................................................
d1g55a_ ...........................................................................
d1g60a_ ...........................................................................
d1hnna_ ...........................................................................
d1i4wa_ ...........................................................................
d1i9ga_ ...........................................................................
d1im8a_ ...........................................................................
d1ixka_ ...........................................................................
d1jg1a_ ...........................................................................
d1jqea_ ...........................................................................
d1jsxa_ ...........................................................................
d1kpia_ ...........................................................................
d1kr5a_ ...........................................................................
d1l3ia_ ...........................................................................
d1l9ka_ ...........................................................................
d1m6ex_ ...........................................................................
d1m6ya2 ...........................................................................
d1ne2a_ ...........................................................................
d1nkva_ ...........................................................................
d1nv8a_ ...........................................................................
d1nw3a_ ...........................................................................
d1o54a_ ...........................................................................
d1o9ga_ ...........................................................................
d1oria_ ...........................................................................
d1p91a_ ...........................................................................
d1pjza_ ...........................................................................
d1q0sa_ ...........................................................................
d1qama_ ...........................................................................
d1qyra_ ...........................................................................
d1qzza2 ...........................................................................
d1r74a_ ...........................................................................
d1ri5a_ ...........................................................................
d1rjda_ ...........................................................................
d1sqga2 ...........................................................................
d1suia1 ...........................................................................
d1t43a_ ...........................................................................
d1u2za_ ...........................................................................
d1ufka_ ...........................................................................
d1uira_ ...........................................................................
d1uwva2 ...........................................................................
d1v39a_ ...........................................................................
d1vbfa_ ...........................................................................
d1ve3a1 ...........................................................................
d1vl5a_ ...........................................................................
d1vlma_ ...........................................................................
d1ws6a1 ...........................................................................
d1wy7a1 ...........................................................................
d1wzna1 ...........................................................................
d1xdza_ ...........................................................................
d1xtpa_ ...........................................................................
d1xvaa_ ...........................................................................
d1xxla_ ...........................................................................
d1y8ca_ ...........................................................................
d1yb2a1 ...........................................................................
d1yzha1 ...........................................................................
d1zkda1 ...........................................................................
d1zq9a1 ...........................................................................
d1zx0a1 ...........................................................................
d2a14a1 ...........................................................................
d2ar0a1 ...........................................................................
d2as0a2 ...........................................................................
d2avda1 ...........................................................................
d2avna1 ...........................................................................
d2b25a1 ...........................................................................
d2b2ca1 ...........................................................................
d2b78a2 ...........................................................................
d2b9ea1 ...........................................................................
d2bm8a1 ...........................................................................
d2bzga1 ...........................................................................
d2cl5a1 ...........................................................................
d2cmha_ ...........................................................................
d2dpma_ ...........................................................................
d2dula1 ...........................................................................
d2eg5c_ ...........................................................................
d2ex4a1 ...........................................................................
d2f8la1 ...........................................................................
d2fhpa1 ...........................................................................
d2frna1 ...........................................................................
d2g1pa_ ...........................................................................
d2gb4a_ ...........................................................................
d2gh1a1 ...........................................................................
d2gtia1 ...........................................................................
d2h00a1 ...........................................................................
d2h1ra_ ...........................................................................
d2i62d_ ...........................................................................
d2i6ga1 ...........................................................................
d2ibta1 ...........................................................................
d2ifta1 ...........................................................................
d2igta1 ...........................................................................
d2nyua_ ...........................................................................
d2o57a1 ...........................................................................
d2okca1 ...........................................................................
d2oo3a1 ...........................................................................
d2oyra1 ...........................................................................
d2p7ia1 ...........................................................................
d2pbfb_ ...........................................................................
d2plwa_ ...........................................................................
d2py6a1 ...........................................................................
d2qyoa2 ...........................................................................
d2uyoa1 ...........................................................................
d2yvla_ ...........................................................................
d2yxda_ ...........................................................................
d2zsua_ ...........................................................................
d3a4ta_ ...........................................................................
d3a7ea_ ...........................................................................
d3c3ya_ ...........................................................................
d3d2la_ ...........................................................................
d3doua1 ...........................................................................
d3e05c_ ...........................................................................
d3fuxa_ ...........................................................................
d3hh9b_ ...........................................................................
d3lhdd_ ...........................................................................
d3njrb1 ...........................................................................
d3p71t_ ...........................................................................
d3p9kb2 ...........................................................................
d3pt9a3 sttvtnpepmgkqgrvlhpeqhrvvsvrecarsqgfpdsyrffgnildrhrqvgnavppplakaigleiklclls
d3qv2a_ ...........................................................................
d3r0qg_ ...........................................................................
d3r9xb_ ...........................................................................
d3tqsd_ ...........................................................................
d4blwa_ ...........................................................................
d4c06a_ ...........................................................................
d4h0nc_ ...........................................................................
d4jxja_ ...........................................................................
d4o29a1 ...........................................................................
d4oa5e_ ...........................................................................
d4uoec_ ...........................................................................
d4ymhc_ ...........................................................................
d5bp7b1 ...........................................................................
d5c0og_ ...........................................................................
d5fuba1 ...........................................................................
d5h02a_ ...........................................................................
d5heka_ ...........................................................................
d5lhma1 ...........................................................................
d5n5da1 ...........................................................................
d6mhta_ ...........................................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0035026 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Candidatus Phytoplasma mali
NoYes   Aster yellows witches'-broom phytoplasma AYWB
NoYes   Onion yellows phytoplasma OY-M
NoYes   Mesoplasma florum L1
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma leachii 99/014/6
NoYes   Mycoplasma mycoides subsp. capri LC str. 95010
NoYes   Mycoplasma capricolum subsp. capricolum ATCC 27343
NoYes   Mycoplasma haemocanis str. Illinois
NoYes   Mycoplasma wenyonii str. Massachusetts
NoYes   Mycoplasma suis KI3806
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma conjunctivae HRC/581
NoYes   Mycoplasma haemofelis Ohio2
NoYes   Mycoplasma bovis HB0801
NoYes   Mycoplasma penetrans HF-2
NoYes   Mycoplasma putrefaciens KS1
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma arthritidis 158L3-1
NoYes   Mycoplasma agalactiae PG2
NoYes   Mycoplasma synoviae 53
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma pneumoniae 309
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma hyopneumoniae 168
NoYes   Mycoplasma hominis ATCC 23114
NoYes   Mycoplasma genitalium G37
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Tropheryma whipplei TW08/27
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Veillonella parvula DSM 2008
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Weissella koreensis KACC 15510
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus sanfranciscensis TMW 1.1304
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Candidatus Cardinium hertigii
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Candidatus Sulcia muelleri DMIN
NoYes   Candidatus Sulcia muelleri SMDSEM
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Blattabacterium sp. (Nauphoeta cinerea)
NoYes   Blattabacterium sp. (Blattella germanica) str. Bge
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Chlamydophila pecorum E58
NoYes   Chlamydia muridarum Nigg
NoYes   Chlamydophila pneumoniae TW-183
NoYes   Chlamydophila caviae GPIC
NoYes   Chlamydophila felis Fe/C-56
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Chlamydia trachomatis B/Jali20/OT
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Aminobacterium colombiense DSM 12261
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Flexistipes sinusarabici DSM 4947
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Thermovibrio ammonificans HB-1
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Thermocrinis albus DSM 14484
NoYes   Aquifex aeolicus VF5
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Elusimicrobium minutum Pei191
NoYes   uncultured Termite group 1 bacterium phylotype Rs-D17
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division WWE3 bacterium RAAC2_WWE3_1
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharibacteria bacterium RAAC3_TM7_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter mustelae 12198
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Neisseria meningitidis alpha14
NoYes   Neisseria meningitidis FAM18
NoYes   Neisseria lactamica 020-06
NoYes   Neisseria gonorrhoeae NCCP11945
NoYes   syncytium symbiont of Diaphorina citri
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   Candidatus Tremblaya princeps PCIT
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Candidatus Zinderia insecticola CARI
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Taylorella asinigenitalis MCE3
NoYes   Taylorella equigenitalis MCE9
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   alpha proteobacterium HIMB59
NoYes   Candidatus Pelagibacter sp. IMCC9063
NoYes   Candidatus Midichloria mitochondrii IricVA
NoYes   Neorickettsia sennetsu str. Miyayama
NoYes   Neorickettsia risticii str. Illinois
NoYes   Wolbachia endosymbiont of Culex quinquefasciatus Pel
NoYes   Wolbachia sp. wRi
NoYes   Ehrlichia chaffeensis str. Arkansas
NoYes   Ehrlichia canis str. Jake
NoYes   Ehrlichia ruminantium str. Gardel
NoYes   Anaplasma phagocytophilum HZ
NoYes   Anaplasma marginale str. Florida
NoYes   Anaplasma centrale str. Israel
NoYes   Orientia tsutsugamushi str. Boryong
NoYes   Rickettsia bellii OSU 85-389
NoYes   Rickettsia canadensis str. McKiel
NoYes   Rickettsia typhi str. Wilmington
NoYes   Rickettsia prowazekii str. BuV67-CWPP
NoYes   Rickettsia philipii str. 364D
NoYes   Rickettsia heilongjiangensis 054
NoYes   Rickettsia peacockii str. Rustic
NoYes   Rickettsia felis URRWXCal2
NoYes   Rickettsia slovaca 13-B
NoYes   Rickettsia parkeri str. Portsmouth
NoYes   Rickettsia massiliae MTU5
NoYes   Rickettsia japonica YH
NoYes   Rickettsia africae ESF-5
NoYes   Rickettsia rhipicephali str. 3-7-female6-CWPP
NoYes   Rickettsia montanensis str. OSU 85-930
NoYes   Candidatus Rickettsia amblyommii str. GAT-30V
NoYes   Rickettsia australis str. Cutlack
NoYes   Rickettsia akari str. Hartford
NoYes   Rickettsia rickettsii str. 'Sheila Smith'
NoYes   Rickettsia conorii str. Malish 7
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Candidatus Liberibacter asiaticus str. psy62
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Bartonella tribocorum CIP 105476
NoYes   Bartonella clarridgeiae 73
NoYes   Bartonella henselae str. Houston-1
NoYes   Bartonella grahamii as4aup
NoYes   Bartonella quintana str. Toulouse
NoYes   Bartonella bacilliformis KC583
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Haemophilus somnus 129PT
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus ducreyi 35000HP
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Haemophilus influenzae PittEE
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Candidatus Carsonella ruddii PV
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Dichelobacter nodosus VCS1703A
NoYes   Rhodanobacter denitrificans
NoYes   Frateuria aurantia DSM 6220
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Halothiobacillus neapolitanus c2
NoYes   Spiribacter sp. UAH-SP71
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Coxiella burnetii Dugway 5J108-111
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Baumannia cicadellinicola str. Hc (Homalodisca coagulata)
NoYes   gamma proteobacterium HdN1
NoYes   Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)
NoYes   Candidatus Vesicomyosocius okutanii HA
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia symbiotica str. 'Cinara cedri'
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Halyomorpha halys symbiont
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
NoYes   Buchnera aphidicola BCc
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Escherichia blattae DSM 4481
NoYes   Candidatus Moranella endobia PCIT
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Candidatus Riesia pediculicola USDA
NoYes   secondary endosymbiont of Ctenarytaina eucalypti
NoYes   Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
NoYes   Candidatus Blochmannia floridanus
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Psychrobacter sp. G
NoYes   Psychrobacter sp. PRwf-1
NoYes   Psychrobacter arcticus 273-4
NoYes   Psychrobacter cryohalolentis K5
NoYes   Moraxella catarrhalis RH4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Acinetobacter sp. ADP1
NoYes   Methylophaga sp. JAM1
NoYes   Cycloclasticus sp. P1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Thioalkalimicrobium cyclicum ALM1
NoYes   Francisella noatunensis subsp. orientalis str. Toba 04
NoYes   Francisella sp. TX077308
NoYes   Francisella philomiragia subsp. philomiragia ATCC 25017
NoYes   Francisella tularensis subsp. tularensis WY96-3418
NoYes   Francisella cf. novicida 3523
NoYes   Francisella novicida U112
NoYes   Nanoarchaeum equitans Kin4-M
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Cenarchaeum symbiosum A
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Candidatus Korarchaeum cryptofilum OPF8
NoYes   Acidilobus saccharovorans 345-15
NoYes   Fervidicoccus fontis Kam940
NoYes   Pyrolobus fumarii 1A
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Thermogladius cellulolyticus 1633
NoYes   Ignisphaera aggregans DSM 17230
NoYes   Aeropyrum pernix K1
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Thermosphaera aggregans DSM 11486
NoYes   Staphylothermus hellenicus DSM 12710
NoYes   Staphylothermus marinus F1
NoYes   Desulfurococcus fermentans DSM 16532
NoYes   Desulfurococcus kamchatkensis 1221n
NoYes   Desulfurococcus mucosus DSM 2162
NoYes   Metallosphaera cuprina Ar-4
NoYes   Metallosphaera sedula DSM 5348
NoYes   Acidianus hospitalis W1
NoYes   Sulfolobus tokodaii str. 7
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   Thermofilum sp. 1910b
NoYes   Thermofilum pendens Hrk 5
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Vulcanisaeta distributa DSM 14429
NoYes   Caldivirga maquilingensis IC-167
NoYes   Pyrobaculum sp. 1860
NoYes   Pyrobaculum calidifontis JCM 11548
NoYes   Pyrobaculum arsenaticum DSM 13514
NoYes   Pyrobaculum oguniense TE7
NoYes   Thermoproteus neutrophilus V24Sta
NoYes   Pyrobaculum aerophilum str. IM2
NoYes   Pyrobaculum islandicum DSM 4184
NoYes   Thermoproteus uzoniensis 768-20
NoYes   Thermoproteus tenax Kra 1
NoYes   halophilic archaeon DL31
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella conradii HZ254
NoYes   Methanocella paludicola SANAE
NoYes   Methanosaeta harundinacea 6Ac
NoYes   Methanosaeta thermophila PT
NoYes   Methanosaeta concilii GP6
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanococcoides burtonii DSM 6242
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Methanosphaerula palustris E1-9c
NoYes   Methanoregula boonei 6A8
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanocorpusculum labreanum Z
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanoculleus bourgensis MS2
NoYes   Methanoculleus marisnigri JR1
NoYes   Methanopyrus kandleri AV19
NoYes   Ferroglobus placidus DSM 10642
NoYes   Archaeoglobus profundus DSM 5631
NoYes   Archaeoglobus veneficus SNP6
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Thermococcus sp. 4557
NoYes   Thermococcus onnurineus NA1
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus gammatolerans EJ3
NoYes   Thermococcus sibiricus MM 739
NoYes   Thermococcus barophilus MP
NoYes   Pyrococcus sp. ST04
NoYes   Pyrococcus yayanosii CH1
NoYes   Pyrococcus horikoshii OT3
NoYes   Pyrococcus abyssi GE5
NoYes   Pyrococcus furiosus COM1
NoYes   Thermoplasmatales archaeon BRNA1
NoYes   Thermoplasma volcanium GSS1
NoYes   Thermoplasma acidophilum DSM 1728
NoYes   Picrophilus torridus DSM 9790
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Halopiger xanaduensis SH-6
NoYes   Methanobacterium sp. AL-21
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Natrinema sp. J7-2
NoYes   Natrialba magadii ATCC 43099
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Haloquadratum walsbyi DSM 16790
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Haloferax volcanii DS2
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Natronomonas pharaonis DSM 2160
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Halalkalicoccus jeotgali B3
NoYes   Halobacterium salinarum R1
NoYes   Halobacterium sp. NRC-1
NoYes   Methanotorris igneus Kol 5
NoYes   Methanocaldococcus sp. FS406-22
NoYes   Methanocaldococcus fervens AG86
NoYes   Methanocaldococcus vulcanius M7
NoYes   methanocaldococcus infernus ME
NoYes   Methanocaldococcus jannaschii DSM 2661
NoYes   Methanothermococcus okinawensis IH1
NoYes   Methanococcus aeolicus Nankai-3
NoYes   Methanococcus maripaludis C5
NoYes   Methanococcus voltae A3
NoYes   Methanococcus vannielii SB
NoYes   Methanothermus fervidus DSM 2088
NoYes   Methanothermobacter marburgensis str. Marburg
NoYes   Methanothermobacter thermautotrophicus str. Delta H
NoYes   Methanosphaera stadtmanae DSM 3091
NoYes   Methanobrevibacter sp. AbM4
NoYes   Methanobrevibacter ruminantium M1
NoYes   Methanobrevibacter smithii ATCC 35061
NoYes   Complete genome sequence of Methanobacterium sp. Mb1
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Cyanobium gracile PCC 6307
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Synechococcus sp. JA-3-3Ab
NoYes   Synechococcus sp. CC9902
NoYes   Synechococcus sp. RCC307
NoYes   Synechococcus sp. CC9605
NoYes   Synechococcus sp. WH 8102
NoYes   Synechococcus sp. WH 7803
NoYes   Synechococcus sp. PCC 7002
NoYes   Synechococcus elongatus PCC 6301
NoYes   Prochlorococcus marinus str. NATL1A
NoYes   Prochlorococcus marinus str. MIT 9301
NoYes   Prochlorococcus marinus str. AS9601
NoYes   Prochlorococcus marinus subsp. marinus str. CCMP1375
NoYes   Prochlorococcus marinus subsp. pastoris str. CCMP1986
NoYes   Prochlorococcus marinus str. MIT 9215
NoYes   Prochlorococcus marinus str. MIT 9211
NoYes   Prochlorococcus marinus str. MIT 9313
NoYes   Prochlorococcus marinus str. MIT 9312
NoYes   Prochlorococcus marinus str. MIT 9303
NoYes   Prochlorococcus marinus str. NATL2A
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Candidatus Phytoplasma solani tobfin_28409
NoYes   Candidatus Phytoplasma australiense Strawberry lethal yellows phytoplasma (CPA) str. NZSb11
NoYes   Candidatus Phytoplasma australiense
NoYes   Mesoplasma florum W37
NoYes   Spiroplasma syrphidicola EA-1
NoYes   Spiroplasma diminutum CUAS-1
NoYes   Spiroplasma chrysopicola DF-1
NoYes   Spiroplasma taiwanense CT-1
NoYes   Spiroplasma apis B31
NoYes   Ureaplasma parvum serovar 3 str. ATCC 700970
NoYes   Mycoplasma parvum str. Indiana
NoYes   Mycoplasma leachii PG50
NoYes   Mycoplasma mycoides subsp. mycoides SC str. Gladysdale
NoYes   Mycoplasma mycoides subsp. mycoides SC str. PG1
NoYes   Candidatus Mycoplasma haemominutum 'Birmingham 1'
NoYes   Mycoplasma ovis str. Michigan
NoYes   Mycoplasma cynos C142
NoYes   Candidatus Mycoplasma haemolamae str. Purdue
NoYes   Mycoplasma suis str. Illinois
NoYes   Mycoplasma haemofelis str. Langford 1
NoYes   Mycoplasma bovis Hubei-1
NoYes   Mycoplasma bovis PG45
NoYes   Mycoplasma putrefaciens Mput9231
NoYes   Mycoplasma fermentans JER
NoYes   Mycoplasma fermentans PG18
NoYes   Mycoplasma agalactiae
NoYes   Mycoplasma pneumoniae M129-B7
NoYes   Mycoplasma pneumoniae FH
NoYes   Mycoplasma pneumoniae M129
NoYes   Mycoplasma hyorhinis SK76
NoYes   Mycoplasma hyorhinis MCLD
NoYes   Mycoplasma hyorhinis HUB-1
NoYes   Mycoplasma hyorhinis DBS 1050
NoYes   Mycoplasma hyopneumoniae 168-L
NoYes   Mycoplasma hyopneumoniae 7422
NoYes   Mycoplasma hyopneumoniae 232
NoYes   Mycoplasma hyopneumoniae 7448
NoYes   Mycoplasma hyopneumoniae J
NoYes   Mycoplasma genitalium M2321
NoYes   Mycoplasma genitalium M2288
NoYes   Mycoplasma genitalium M6282
NoYes   Mycoplasma genitalium M6320
NoYes   Mycoplasma gallisepticum NC08_2008.031-4-3P
NoYes   Mycoplasma gallisepticum CA06_2006.052-5-2P
NoYes   Mycoplasma gallisepticum NC06_2006.080-5-2P
NoYes   Mycoplasma gallisepticum WI01_2001.043-13-2P
NoYes   Mycoplasma gallisepticum NY01_2001.047-5-1P
NoYes   Mycoplasma gallisepticum NC96_1596-4-2P
NoYes   Mycoplasma gallisepticum NC95_13295-2-2P
NoYes   Mycoplasma gallisepticum VA94_7994-1-7P
NoYes   Mycoplasma gallisepticum S6
NoYes   Mycoplasma gallisepticum str. R(high)
NoYes   Mycoplasma gallisepticum str. R(low)
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Adlercreutzia equolifaciens DSM 19450
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium avidum 44067
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis MAP4
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes