SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


PLP-dependent transferases alignments

These alignments are sequences aligned to the 0035073 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1ajsa_ ap..........................................................................................
d1b9ha_ kapefpawpqyddaernglvraleqgqwwrmggdevnsferefaahhga...........................................
d1bs0a_ swqekinaaldarraadalrrrypvaqgagrwlvaddrqyl...................................................
d1bt4a_ seraynfnagpaalplevleraqaefvdyqhtgmsimemshrgavyeavhneaqarllallgnptgykvlfiqggastqfamipmnflkegq
d1bw0a_ wdvsmsnhag..................................................................................
d1c0na_ fsvdavradfpvlsrevnglplayldsaasa.............................................................
d1c4ka2 ppffkslkeyvsryliqfdcpghqggqyyrkhpagrefydffgetvfradlcnadvalgdllihegpavaaekhaarvy.............
d1c7na_ miydfttkisrknlgslkwdlmy.....................................................................
d1cl1a_ kldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlthfslqqamceleggagc................
d1cs1a_ rkqatiavrsglnddeqygcvvppihlsstynftgfneprahdysrrgnptrdvvqralaelegga..........................
d1d2fa_ ll..........................................................................................
d1dfoa_ lkremniadydaelwqameqekvrqeehieliasenytsprvmqaqgsqltnkyaegypgkry.............................
d1elua_ qfpglanktyfnfggqgilptvaleaitamygylqengpfsiaanqhiqql.........................................
d1fc4a_ gshmrgefyqqltndletaraeglfkeeriitsaqqaditva..................................................
d1fg7a_ tvtitdlarenvrnltpyqsarrl....................................................................
d1gdea_ al..........................................................................................
d1h0ca_ hkllvtppkallkplsipnqlllgpgpsnlpprimaagglqmigsmskdmyqimdeikegiqyvfqtrnplt....................
d1iaya_ ilsklatneehgenspyfdgwkaydsdpfhplknpngviqmglaenqlcldliedwikrnpkgsicsegiksfk..................
d1iuga_ dwlltpgpvrlhpkalealarpqlhhrteaarevflkargllreafrteg..........................................
d1jg8a_ midlrsdtvtkpteemrkamaqaevgddvygedptinelerla.................................................
d1js3a_ mnasdfrrrgkemvdymadylegiegrqvypdvqpgylrplipatapqepdtfedilqdvekiimpgvthwhspyffayfptassypamlad
d1lc5a_ lfntahggnirepatvlgis........................................................................
d1lk9a_ kmtwtmkaaeeaeavanincsehgrafldgiisegspkcecntcytgpdcsekiqgcsadvasgdglfleeywkqhkeasavlvspwhrmsy
d1m32a_ yllltpgplttsrtvkeamlfdsc....................................................................
d1mdoa_ dflpfsrpamgaeelaavktvldsgwittgpknqeleaafcrltgnq.............................................
d1n8pa_ tlqesdkfatkaihagehvdvhgsviepislsttfkqsspanpigtyeysrsqnpnren.................................
d1o4sa_ v...........................................................................................
d1o69a_ gnelkyieevfksnyiaplgefvnrfeqsvkd............................................................
d1ohwa_ fdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdvdgnrmldlysqissipigyshpalvklvqqpqnvstfinrpa
d1p3wa_ klp.........................................................................................
d1pmma_ kkqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatfcqtwddenvhklmdlsinknwidkeeypqsa
d1qgna_ mkyasflnsdgsvaihagerlgrgivtdaittpvvntsayffnktselidfkekrrasfeyg..............................
d1qisa_ ............................................................................................
d1qj5a_ mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgynhpqlnaamksqidamshvmfggithapaielc
d1qz9a_ ttrndclaldaqdslaplrqqfalpe..................................................................
d1sffa_ nsnkelmqrrsqaiprgvgqihpifadraencrvwdvegreyldfaggiav.........................................
d1svva_ pysfvndysvgmhpkildlmardnmt..................................................................
d1tpla_ mnypaepfriksvetvsmiprderlkkmqeagyntfllnskdiyidlltdsgtnamsdkqwagmmmgdeayagsenfyhlertvqelfgfkh
d1u08a_ plipqsklpqlgtti.............................................................................
d1uu1a_ liakraypy...................................................................................
d1v2da_ mrlhprteaake................................................................................
d1v72a1 rppalgfssdniagaspevaqalvkhssgqa.............................................................
d1vefa1 wralleaektldsgvynkhdllivrgqgarvwdaegneyidcvggy..............................................
d1vp4a_ ihhhhhhmvvnlegkiskigqnmks...................................................................
d1wyua1 mdytphteeeiremlrrvgaasledlfahlpkeilsppidlpeplpewkvle........................................
d1wyub1 sfplifersrkgrrglklvkavpkaedlipkehlrevpprlpevdeltlvrhytglsrrqvgvdttfyplgsctmkynpklheeaarlfadl
d1xi9a_ siraskralsve................................................................................
d1yiza1 kfdlpkryqgstksvwve..........................................................................
d1z7da1 ktpedyinnelkygahnydpipvvlkrakgvfvydvndkryydflsayssvnqghchpnilnaminqaknlticsraffsvplgiceryltn
d1zoda1 lnddatfwrnarhhlvryggtfepmiierakgsfvydadgraildftsgqmsavlghchpeivsvigeyagkldhlfsemlsrpvvdlatrl
d2a7va1 gwtgqeslsdsdpemwellqrekdrqcrgleliasenfcsraalealgsclnnkysegypgkryyggaevvdeiellcqrraleaf......
d2aeua1 lrlekarkiileilnekgrdalydlsglsggflidekdkallntyigss...........................................
d2bkwa1 ksvdtllipgpiilsgavqkaldvpslghtspefvsifqrvlkntravfksaaasks...................................
d2bwna1 dynlaldkaiqklhdegryrtfidierekgafpkaqwnrpdggkqditvwc.........................................
d2c7ta_ dhwpewpqhsdrtrrkieevfqsnrwaisgywtge.........................................................
d2csta_ aa..........................................................................................
d2ctza1 mrfetlqlhagyepepttlsrqvpiypttsyvfkspehaanlfalkefgniysrimnptvdvlekrlaaleggk..................
d2cy8a_ silndykrktegsvfwaqrarsvmpdgvtadtrafdphglfisdaqgvhktdvdgnvyldffgghgalvlghghprvnaaiaealshgvqya
d2doub_ svflvvdeakrk................................................................................
d2dr1b_ evyemvkpkyklfta.............................................................................
d2e7ja1 dfinidplqtggklteearqallewgdgysvcdfcttgrldeiktppihdfihnqlpkflgcdv............................
d2e7ua_ merpiseayfqeakrhipggvsspvrafk...............................................................
d2fnua1 kefaysepcldkedkkavlevlnskqltqgkrsll.........................................................
d2gb3a1 f...........................................................................................
d2gsaa_ fktiksdeifaaaqklmpggvsspvrafksvggqpivfdrvkdayawdvdgnryidyvgtwgpaicgha.......................
d2huib_ meykvtppavlreplvtpnkllmgpgpsnapqrvldamsrpilghlhpetlkimddikegvrylf...........................
d2o0ra1 tvsrlr......................................................................................
d2o1ba_ is..........................................................................................
d2x5dd_ vfn.........................................................................................
d2z61a_ ml..........................................................................................
d2z67a1 mldfnieglipknmekrgelvlneylkeiedvfnhrkipengiddekiklflkflsmmdtdkdpksvrigereartyskiheelssgfchgi
d2zc0d_ mdytk.......................................................................................
d3a2ba_ skgklgekisqfkiveelkakglya...................................................................
d3aepa_ aqditttllhpkgdhvlhshaypifqtstfcfdstqqgadlfmgkgeghiysrlgnptveqfeemvcsiegaagsaa...............
d3asaa_ mkrnphfvsltkn...............................................................................
d3bc8a1 earrahehlirllleqgkcpedgwdestlelflhelavmdsnnflgncgvgeregrvasalvarrhyrfihgigrsgdisavqpkaagssll
d3cq4b1 kitlsdlplreelrgehaygapqlnvd.................................................................
d3drdb_ thdliekskkhlwlpftqmkdydenpliiesgtgikvkdingkeyydgfssvwlnvhghrkkelddaikkqlgkiahstllgmtnvpatqla
d3dzza_ kqydfthvpkrqgnsikwgvlkeke...................................................................
d3e2fb_ nakriegldsnvwvef............................................................................
d3eucb1 msvvdpslieriirddvramgay.....................................................................
d3ezsb_ mtfe........................................................................................
d3f0ha1 lnftvgpvmsseevraigaeqvpyfrttefsstmlenekfmleya...............................................
d3fdba1 mqfpsiedlrarntmkwtr.........................................................................
d3ffhb1 mkwkkslaglssykpgkreeev......................................................................
d3ffra1 mnnkiyftpgpselyptvrqhmitaldekigvishrskkfeevyktasdnlktllelpsnyevlflasateiweriiqncvekksfhcvngs
d3fkdb_ ivnfsttvwtdgdkdhl...........................................................................
d3ftba_ lldy........................................................................................
d3getb_ mkfneflnnlsnyepgkdiev.......................................................................
d3h14a1 knss........................................................................................
d3hdob_ iplrqniasmkgyipgyqp.........................................................................
d3hl2a_ earrshehlirlllekgkcpengwdestlelflhelaimdsnnflgncgvgeregrvasalvarrhyrfihgigrsgdisavqpkaagssll
d3i5tb_ avgaamrdhillpaqemaklgksaqpvlthaegiyvhtedgrrlidgpagmwcaqvgygrreivdamahqamvlpyaspwym..........
d3jtxa1 mnt.........................................................................................
d3ju7a_ enipflrastvpvieyldelk.......................................................................
d3k7ya_ md..........................................................................................
d3l8ab_ rydfttrpdrlnqftykwkt........................................................................
d3lg0d_ kssqdymnneltygahnydpipvvlkrgkgvfvydiedrryydflsayssvnqghchpdilnaminqakklticsraffsdslgvceryltn
d3mebb_ ............................................................................................
d3n5mb1 mktkqtdellakdeqyvwhgmrpfspnsttvgakaegcwvediqgkryldgmsglwcvnsgygrkelaeaaykqlqtlsyfpmsqshepaik
d3ndnb_ svrtpkalpdgvsqatvgvrggmlrsgfeetaeamyltsgyvygsaavaeksfageldhyvysrygnptvsvfeerlrliegap........
d3nx3b_ krfdivlekgqgvylfddkakkyldfssg...............................................................
d3nyuc_ iefidlknqqarikdkidagiqrvlrh.................................................................
d3p1ta_ aaaqav......................................................................................
d3pdxa_ kv..........................................................................................
d3q8nd_ tltqerrlvtaipgpisqelqarkqsavaagvgvtlpvyvvaagggvla...........................................
d3ri6a_ rgfttralhvpkakrdvhgalrtpvydnaafefensdeiaqvslgralghvysrssnptvedleqrlknltgalgv................
d3t32a_ e...........................................................................................
d3tqxb_ mqeilsqlnkeieglkkaglykseriitspqnaeikvgekevlnfcannylgladhpaliktaqtvveqygfgmasvrficg..........
d3uwca_ mrvpysylerqfadiepylndlrefiktadftlgaelekfekrfaalhnaphaigvgt..................................
d4cvqa_ mspiek......................................................................................
d4cxqb_ ltpeqiiavdgahlwhpyssigreavspvvavaahgawltlirdgqpievldamsswwtaihghghpaldqalttqlrvmnhvmfgglthep
d4eb5b_ ayfdytsa....................................................................................
d4f5kb1 ............................................................................................
d4ge9a1 mnyarfitaasa................................................................................
d4grxc_ qswearaetyslygftdmpsvhqrgtvvvthgegpyivdvhgrryldansglwnmvagfdhkglieaakaqydrfpgyhaffgrmsdqt...
d4h51a_ mttae.......................................................................................
d4isyd1 a...........................................................................................
d4ix8a_ sfrriasskhaqrtlqplnnltdnmkpsrst.............................................................
d4lc3a_ apflpftrpeideetiqgvvevlrsgwittgpqcqkfeaalseycgg.............................................
d4lw2a_ nvfnpaqfraqfpalqda..........................................................................
d4my5d_ dlsk........................................................................................
d4oc9l_ nfnketlalhgaynfdtqrsisvpiyqntaynfenldqaaarfnlqelgniysrlsnptsdvlgqrlanvegga..................
d4piwb_ mipfnappvvgteldymqsamgsgklcgdgg.............................................................
d4r5zd1 tarlrpelaglpvyvp............................................................................
d4rjyd_ midlrsdtvtrpsramleammaapvgd.................................................................
d4u1tf_ msgmrfdtrlvhggrrp...........................................................................
d4uhoa_ dlnlkahwmpfsanrnfhkdpriivaaegswlvddkgrriydslsglwtcgaghsrkeiadavakqigtldyspgfqyghplsfqlaekiaq
d4wbtb1 safsrftpliqslpasvpfvgpea....................................................................
d4xaub1 miplfkvavsptaldrvaevfasgylgqgprv............................................................
d4ysna1 mgkldkasklideenkyyarsarinyynlvidhahgatlvdvdgnkyidllasasai...................................
d4zm4a_ tnaesldgiksviaggvsssmraaavplplvvrsaggcllrdv.................................................
d5b89a1 mripedvrkdipltneviyfdntatsltpkpvveamdeyylkyranvhrgvh........................................
d5g0aa_ kinweqvkewdrkylmrtfstqneyqpvpiestegdylimpdgtrlldffnqlycvnlgqknqkvnaaikealdrygfvwdtyatdykakaa
d5i90a_ nkwkalrqqfdldpqylhfanflltshprpvreaierlrvrfdrnpgeavdwhreeiwkyed..............................
d5jaya1 mhlldtlaeglkeidarglrrrrrtadtpcaahmtvdgraiigfasndylglaahpqliaaiaegaqrygagsggshllgghsrah......
d5lhaa_ ekyknaekkfwhpmgssaaphrdktlviargdgny.........................................................
d5ti8a_ riitkaegvylwdsegnkildgmaglwcmnvgygrkelaevay.................................................
d5u23a1 mfflnlkqindrfntefitkfkeilesgwyilgkqcekfennfakycgvkh.........................................
d5uida_ gminvfqptlgeaelaavrevfasgwlgrgprtkvfead.....................................................
d5wt5a_ vqr.........................................................................................


                                                                                                    
                                                                                                    
d1ajsa_ ............................................................................................
d1b9ha_ ............................................................................................
d1bs0a_ ............................................................................................
d1bt4a_ tanyvmtgswaskalkeakligdthvaasseasnymtlpklqeiqlqdnaaylhltsnetiegaqfkafpdtgsvpligdmssdilsrpfdl
d1bw0a_ ............................................................................................
d1c0na_ ............................................................................................
d1c4ka2 ............................................................................................
d1c7na_ ............................................................................................
d1cl1a_ ............................................................................................
d1cs1a_ ............................................................................................
d1d2fa_ ............................................................................................
d1dfoa_ ............................................................................................
d1elua_ ............................................................................................
d1fc4a_ ............................................................................................
d1fg7a_ ............................................................................................
d1gdea_ ............................................................................................
d1h0ca_ ............................................................................................
d1iaya_ ............................................................................................
d1iuga_ ............................................................................................
d1jg8a_ ............................................................................................
d1js3a_ mlcgaigcigfswaaspacteletvmmdwlgkmlqlpeaflageagegggviqgsaseatlvallaartkvvrrlqaaspgltqgavleklv
d1lc5a_ ............................................................................................
d1lk9a_ ffnpvsnfisfelek.............................................................................
d1m32a_ ............................................................................................
d1mdoa_ ............................................................................................
d1n8pa_ ............................................................................................
d1o4sa_ ............................................................................................
d1o69a_ ............................................................................................
d1ohwa_ lgilppenfveklresllsvapkgmsqlitmacgscsnenafktifmwyrskergqsafskeeletcminqapgcpdy..............
d1p3wa_ ............................................................................................
d1pmma_ aidlrcvnmvadlwhap...........................................................................
d1qgna_ ............................................................................................
d1qisa_ ............................................................................................
d1qj5a_ rklvamtpqplecvfladsgsvavevamkmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqsrmdg
d1qz9a_ ............................................................................................
d1sffa_ ............................................................................................
d1svva_ ............................................................................................
d1tpla_ ivpthqgrgaenllsqlaikpgqyvagnmyftttryhqekngavfvdivrdeahdaglniafkgdidlkklqklidekgaeniayiclavtv
d1u08a_ ............................................................................................
d1uu1a_ ............................................................................................
d1v2da_ ............................................................................................
d1v72a1 ............................................................................................
d1vefa1 ............................................................................................
d1vp4a_ ............................................................................................
d1wyua1 ............................................................................................
d1wyub1 hpyqdprtaqgalrlmwelgeylkaltgmdaitlepaagahgeltgiliirayhedrgegrt..............................
d1xi9a_ ............................................................................................
d1yiza1 ............................................................................................
d1z7da1 llgydkvlmmntgaeanetayklcrkwgyevkkipenmakivvcknnfsgrtlgcisasttkkctsnfgpfapqfskvpyd...........
d1zoda1 anitppgldralllstgaesneaairmaklvtgkyeivgfaqswhgmtgaaasatysagrkgvgpaavgsfaipapftyrprferngaydyl
d2a7va1 ............................................................................................
d2aeua1 ............................................................................................
d2bkwa1 ............................................................................................
d2bwna1 ............................................................................................
d2c7ta_ ............................................................................................
d2csta_ ............................................................................................
d2ctza1 ............................................................................................
d2cy8a_ ashplevrwaerivaafpsirklrftgsgtettllalrvaraftgrrmilrfeghyhgwhdfsasgynshfdgqpapgvlpettantllirp
d2doub_ ............................................................................................
d2dr1b_ ............................................................................................
d2e7ja1 ............................................................................................
d2e7ua_ ............................................................................................
d2fnua1 ............................................................................................
d2gb3a1 ............................................................................................
d2gsaa_ ............................................................................................
d2huib_ ............................................................................................
d2o0ra1 ............................................................................................
d2o1ba_ ............................................................................................
d2x5dd_ ............................................................................................
d2z61a_ ............................................................................................
d2z67a1 grsgnlvdpqpkasgasimyaltnkilesffkql..........................................................
d2zc0d_ ............................................................................................
d3a2ba_ ............................................................................................
d3aepa_ ............................................................................................
d3asaa_ ............................................................................................
d3bc8a1 nkitnslvlnviklagvhsvascfvvpmatgmsltlcfltlrhkrpkakyiiwpridqkscf..............................
d3cq4b1 ............................................................................................
d3drdb_ etlidispkkltrvf.............................................................................
d3dzza_ ............................................................................................
d3e2fb_ ............................................................................................
d3eucb1 ............................................................................................
d3ezsb_ ............................................................................................
d3f0ha1 ............................................................................................
d3fdba1 ............................................................................................
d3ffhb1 ............................................................................................
d3ffra1 fskrfyefagelgreaykeeaafgkgfypaditvpadae.....................................................
d3fkdb_ ............................................................................................
d3ftba_ ............................................................................................
d3getb_ ............................................................................................
d3h14a1 ............................................................................................
d3hdob_ ............................................................................................
d3hl2a_ nkitnslvldiiklagvhtvancfvvpmatgmsltlcfltlrhkrpkakyiiwpridqkscf..............................
d3i5tb_ ............................................................................................
d3jtxa1 ............................................................................................
d3ju7a_ ............................................................................................
d3k7ya_ ............................................................................................
d3l8ab_ ............................................................................................
d3lg0d_ lfgydkvlmmntgaeasetayklcrkwgyevkkipensakiivcnnnfsgrtlgcvsastdkkcknnfgpfvpnflkvpyd...........
d3mebb_ ............................................................................................
d3n5mb1 laeklnewlggeyviffsnsgseanetafkiarqyyaqkgephrykfmsryrgyhgntmatmaatgqaqrryqyepfasgflhvtppdcyrm
d3ndnb_ ............................................................................................
d3nx3b_ ............................................................................................
d3nyuc_ ............................................................................................
d3p1ta_ ............................................................................................
d3pdxa_ ............................................................................................
d3q8nd_ ............................................................................................
d3ri6a_ ............................................................................................
d3t32a_ ............................................................................................
d3tqxb_ ............................................................................................
d3uwca_ ............................................................................................
d4cvqa_ ............................................................................................
d4cxqb_ aarlakllvditpagldtvffsdsgsvsvevaakmalqywrgrglpgkrrlmtwrggyhgdtflamsicdphggmhslwtdvlaaqvfapqv
d4eb5b_ ............................................................................................
d4f5kb1 ............................................................................................
d4ge9a1 ............................................................................................
d4grxc_ ............................................................................................
d4h51a_ ............................................................................................
d4isyd1 ............................................................................................
d4ix8a_ ............................................................................................
d4lc3a_ ............................................................................................
d4lw2a_ ............................................................................................
d4my5d_ ............................................................................................
d4oc9l_ ............................................................................................
d4piwb_ ............................................................................................
d4r5zd1 ............................................................................................
d4rjyd_ ............................................................................................
d4u1tf_ ............................................................................................
d4uhoa_ mtpgtldhvfftgsgsecadtsikmaraywrikgqaqktkligrargyhgvnvagtslggiggnrkmfgplmdvdhlphtlqpgmaftkgaa
d4wbtb1 ............................................................................................
d4xaub1 ............................................................................................
d4ysna1 ............................................................................................
d4zm4a_ ............................................................................................
d5b89a1 ............................................................................................
d5g0aa_ kiiiedilgdedwpgkvrfvstgseavetalniarlytnrplvvtrehdyhgwtggaatvtrlrsyrsglvgensesfsaqipgssynsavl
d5i90a_ ............................................................................................
d5jaya1 ............................................................................................
d5lhaa_ ............................................................................................
d5ti8a_ ............................................................................................
d5u23a1 ............................................................................................
d5uida_ ............................................................................................
d5wt5a_ ............................................................................................


                                                                                                    
                                                                                                    
d1ajsa_ ............................................................................................
d1b9ha_ ............................................................................................
d1bs0a_ ............................................................................................
d1bt4a_ nqfglvyagaqknlgpsgvtvvivredlvaespkhlptmlrydt................................................
d1bw0a_ ............................................................................................
d1c0na_ ............................................................................................
d1c4ka2 ............................................................................................
d1c7na_ ............................................................................................
d1cl1a_ ............................................................................................
d1cs1a_ ............................................................................................
d1d2fa_ ............................................................................................
d1dfoa_ ............................................................................................
d1elua_ ............................................................................................
d1fc4a_ ............................................................................................
d1fg7a_ ............................................................................................
d1gdea_ ............................................................................................
d1h0ca_ ............................................................................................
d1iaya_ ............................................................................................
d1iuga_ ............................................................................................
d1jg8a_ ............................................................................................
d1js3a_ ayasdqahssveragli...........................................................................
d1lc5a_ ............................................................................................
d1lk9a_ ............................................................................................
d1m32a_ ............................................................................................
d1mdoa_ ............................................................................................
d1n8pa_ ............................................................................................
d1o4sa_ ............................................................................................
d1o69a_ ............................................................................................
d1ohwa_ ............................................................................................
d1p3wa_ ............................................................................................
d1pmma_ ............................................................................................
d1qgna_ ............................................................................................
d1qisa_ ............................................................................................
d1qj5a_ ewderdmvgfarlmaahrheiaaviiepiv..............................................................
d1qz9a_ ............................................................................................
d1sffa_ ............................................................................................
d1svva_ ............................................................................................
d1tpla_ nlaggqpvsmanmravreltaahgikvfydatrcvenayfikeqeqgfenksiaeivhemfsyadgctmsgkkdclvniggflcmnddemfs
d1u08a_ ............................................................................................
d1uu1a_ ............................................................................................
d1v2da_ ............................................................................................
d1v72a1 ............................................................................................
d1vefa1 ............................................................................................
d1vp4a_ ............................................................................................
d1wyua1 ............................................................................................
d1wyub1 ............................................................................................
d1xi9a_ ............................................................................................
d1yiza1 ............................................................................................
d1z7da1 ............................................................................................
d1zoda1 aeldyafdlidrqssgnlaafiaepilssggiielp........................................................
d2a7va1 ............................................................................................
d2aeua1 ............................................................................................
d2bkwa1 ............................................................................................
d2bwna1 ............................................................................................
d2c7ta_ ............................................................................................
d2csta_ ............................................................................................
d2ctza1 ............................................................................................
d2cy8a_ d...........................................................................................
d2doub_ ............................................................................................
d2dr1b_ ............................................................................................
d2e7ja1 ............................................................................................
d2e7ua_ ............................................................................................
d2fnua1 ............................................................................................
d2gb3a1 ............................................................................................
d2gsaa_ ............................................................................................
d2huib_ ............................................................................................
d2o0ra1 ............................................................................................
d2o1ba_ ............................................................................................
d2x5dd_ ............................................................................................
d2z61a_ ............................................................................................
d2z67a1 ............................................................................................
d2zc0d_ ............................................................................................
d3a2ba_ ............................................................................................
d3aepa_ ............................................................................................
d3asaa_ ............................................................................................
d3bc8a1 ............................................................................................
d3cq4b1 ............................................................................................
d3drdb_ ............................................................................................
d3dzza_ ............................................................................................
d3e2fb_ ............................................................................................
d3eucb1 ............................................................................................
d3ezsb_ ............................................................................................
d3f0ha1 ............................................................................................
d3fdba1 ............................................................................................
d3ffhb1 ............................................................................................
d3ffra1 ............................................................................................
d3fkdb_ ............................................................................................
d3ftba_ ............................................................................................
d3getb_ ............................................................................................
d3h14a1 ............................................................................................
d3hdob_ ............................................................................................
d3hl2a_ ............................................................................................
d3i5tb_ ............................................................................................
d3jtxa1 ............................................................................................
d3ju7a_ ............................................................................................
d3k7ya_ ............................................................................................
d3l8ab_ ............................................................................................
d3lg0d_ ............................................................................................
d3mebb_ ............................................................................................
d3n5mb1 pgiereniydvecvkevdrvmtwelsetiaafimepiitgggilm...............................................
d3ndnb_ ............................................................................................
d3nx3b_ ............................................................................................
d3nyuc_ ............................................................................................
d3p1ta_ ............................................................................................
d3pdxa_ ............................................................................................
d3q8nd_ ............................................................................................
d3ri6a_ ............................................................................................
d3t32a_ ............................................................................................
d3tqxb_ ............................................................................................
d3uwca_ ............................................................................................
d4cvqa_ ............................................................................................
d4cxqb_ prdyd.......................................................................................
d4eb5b_ ............................................................................................
d4f5kb1 ............................................................................................
d4ge9a1 ............................................................................................
d4grxc_ ............................................................................................
d4h51a_ ............................................................................................
d4isyd1 ............................................................................................
d4ix8a_ ............................................................................................
d4lc3a_ ............................................................................................
d4lw2a_ ............................................................................................
d4my5d_ ............................................................................................
d4oc9l_ ............................................................................................
d4piwb_ ............................................................................................
d4r5zd1 ............................................................................................
d4rjyd_ ............................................................................................
d4u1tf_ ............................................................................................
d4uhoa_ etggvel.....................................................................................
d4wbtb1 ............................................................................................
d4xaub1 ............................................................................................
d4ysna1 ............................................................................................
d4zm4a_ ............................................................................................
d5b89a1 ............................................................................................
d5g0aa_ mapspnmfqdsdgnllk...........................................................................
d5i90a_ ............................................................................................
d5jaya1 ............................................................................................
d5lhaa_ ............................................................................................
d5ti8a_ ............................................................................................
d5u23a1 ............................................................................................
d5uida_ ............................................................................................
d5wt5a_ ............................................................................................


                                             10        20            30        40               50  
                                              |         |             |         |                |  
d1ajsa_ .............................--PSVFAEVPQAQPVLVFKLIADFR..ED..PDPRKVNLGVGAYRTDDC...Q....PWVLPV
d1b9ha_ .............................-------------------------..--..------------------...-....------
d1bs0a_ .............................-------------------------..--..------NFSSN----DYL...G....LSHHPQ
d1bt4a_ .............................-------------------------..--..------------------...-....------
d1bw0a_ .............................-----------LVFNPIRTVSDNAKp.SP..SPKPIIKLSVG-----DP...TldknLLTSAA
d1c0na_ .............................-------------------------..--..------------------...-....-QKPSQ
d1c4ka2 .............................-------------------------..--..------------------...-....------
d1c7na_ .............................----------------------SQN..PE..VGNEVVPLSVA-----DM...E....FKNPPE
d1cl1a_ .............................-------------------------..--..------------------...-....------
d1cs1a_ .............................-------------------------..--..------------------...-....------
d1d2fa_ .............................-------------------------..--..------PFTIS-----DM...D....FATAPC
d1dfoa_ .............................-------------------------..--..------------------...-....------
d1elua_ .............................-------------------------..--..------------------...-....------
d1fc4a_ .............................-------------------------..--..DGSHVINFCANNYLGLAN...H....PDLIAA
d1fg7a_ .............................-------------------------..--..GGNGDVWLNAN-------...-....----EY
d1gdea_ .............................-----SDRLELVSASEIRKLFDIAA..--..GMKDVISLGIG-----EP...D....FDTPQH
d1h0ca_ .............................-------------------------..--..------------------...-....------
d1iaya_ .............................-------------------------..--..------------------...-....------
d1iuga_ .............................-------------------------..--..------------------...-....------
d1jg8a_ .............................-------------------------..--..------------------...-....------
d1js3a_ .............................-------------------------..--..------------------...-....------
d1lc5a_ .............................-------------------------..--..-PDQLLDFSAN-----IN...P....LGMPVS
d1lk9a_ .............................-------------------------..--..------------------...-....------
d1m32a_ .............................-------------------------..--..------------TWDDDY...N....IGVVEQ
d1mdoa_ .............................-------------------------..--..------------------...-....------
d1n8pa_ .............................-------------------------..--..------------------...-....------
d1o4sa_ .............................-----SRRISEIPISKTMELDAKAK..ALikKGEDVINLTAG-----EP...D....FPTPEP
d1o69a_ .............................-------------------------..--..------------------...-....------
d1ohwa_ .............................-------------------------..--..------------------...-....------
d1p3wa_ .............................-------------------------..--..-----------IYLDYSA...T....TPVDPR
d1pmma_ .............................-------------------------..--..------------------...-....------
d1qgna_ .............................-------------------------..--..------------------...-....------
d1qisa_ .............................----MFENITAAPADPILGLADLFR..AD..ERPGKINLGIGVYKDETG...K....TPVLTS
d1qj5a_ .............................-------------------------..--..------------------...-....------
d1qz9a_ .............................-------------------------..--..---GVIYLDGN-----SL...G....ARPVAA
d1sffa_ .............................-------------------------..--..-------LNTG-----HL...H....PKVVAA
d1svva_ .............................-------------------------..--..------------------...-....------
d1tpla_ sakelvvvyegmpsygglagrdmeamaig-------------------------..--..------------------...-....------
d1u08a_ .............................----------------FTQMSALA-..--..QQHQAINLSQG-----FP...D....FDGPRY
d1uu1a_ .............................-------------------------..ET..EKRDKTYLALN-----EN...P....FPFPED
d1v2da_ .............................--------------SIFPRMSGLAQ..--..-RLGAVNLGQG-----FP...S....NPPPPF
d1v72a1 .............................-------------------------..--..------------------...-....------
d1vefa1 .............................-------------------------..--..---GVANLGHG-------...N....PEVVEA
d1vp4a_ .............................--------------SIIREILKFAA..--..-DKDAISFGGGVP---DP...E....TFPRKE
d1wyua1 .............................------------------ELRRLAA..QN..LPAHKAFLGGG-----VR...S....HHVPPV
d1wyub1 .............................-------------------------..--..------------------...-....------
d1xi9a_ .............................----------YAIRDVVLPARELEK..--..KGIKVIRLNIG-----DPvkfD....FQPPEH
d1yiza1 .............................----------------------YIQ..LA..AQYKPLNLGQG-----FP...D....YHAPKY
d1z7da1 .............................-------------------------..--..------------------...-....------
d1zoda1 .............................-------------------------..--..------------------...-....------
d2a7va1 .............................-------------------------..--..------------------...-....------
d2aeua1 .............................-------------------------..--..------------------...-....------
d2bkwa1 .............................-------------------------..--..------------------...-....------
d2bwna1 .............................-------------------------..--..----------G---NDYL...G....MGQHPV
d2c7ta_ .............................-------------------------..--..------------------...-....------
d2csta_ .............................---SIFAAVPRAPPVAVFKLTADFR..ED..GDSRKVNLGVGAYRTDEG...Q....PWVLPV
d2ctza1 .............................-------------------------..--..------------------...-....------
d2cy8a_ .............................-------------------------..--..------------------...-....------
d2doub_ .............................------------------------A..RE..RGVGLIDLSIG-----ST...D....LPPPEA
d2dr1b_ .............................-------------------------..--..-----------------G...P....VACFPE
d2e7ja1 .............................-------------------------..--..------------------...-....------
d2e7ua_ .............................-------AVGGTPPFLVRGEGAYVW..DA..DGNRYLDYVMS-----WG...P....LILGHA
d2fnua1 .............................-------------------------..--..------------------...-....------
d2gb3a1 .............................-----SDRVLLTEESPIRKLVPFAEmaKK..RGVRIHHLNIG-----QP...D....LKTPEV
d2gsaa_ .............................-------------------------..--..------------------...-....---HPE
d2huib_ .............................-------------------------..--..------------------...-....------
d2o0ra1 .............................-------------PYATTVFAEMSA..LA..TRIGAVNLGQG-----FP...D....EDGPPK
d2o1ba_ .............................------NKLANIPDSYFGKTMGRKI..EH..GPLPLINMAVG-----IP...D....GPTPQG
d2x5dd_ .............................----------------ITAELKMAA..RR..RGEDIIDLSMG-----NP...D....GPTPPH
d2z61a_ .............................-----SKRLLNFESFEVMDILALAQklES..EGKKVIHLEIG-----EP...D....FNTPKP
d2z67a1 .............................-------------------------..--..------------------...-....------
d2zc0d_ .............................---YLAGRANWIKGSALADVMKKASelQK..KGVKLISLAAG---DPDP...E....LIPRAV
d3a2ba_ .............................------------YFRPIQSKQDTEV..KI..DGRRVLMFGSNSYLGLTT...D....TRIIKA
d3aepa_ .............................-------------------------..--..------------------...-....------
d3asaa_ .............................----------YLFADLQKRVAQFRL..EN..PQHTVINLSIG-----DT...T....QPLNAS
d3bc8a1 .............................-------------------------..--..------------------...-....------
d3cq4b1 .............................-------------------------..--..-----IRLNTN-----EN...P....YPPSEA
d3drdb_ .............................-------------------------..--..------------------...-....--YSDS
d3dzza_ .............................-------------------------..--..-----LPMWIA-----EM...D....FKIAPE
d3e2fb_ .............................-----------------------TK..LA..ADPSVVNLGQG-----FP...D....ISPPSY
d3eucb1 .............................------------------------H..VP..DSHGLVKLDAM-----EN...P....YRLPPA
d3ezsb_ .............................-------------PYPFERLRALLKe.IT..PKKRGLDLGIG-----EP...Q....FETPKF
d3f0ha1 .............................-------------------------..--..------------------...-....------
d3fdba1 .............................-------------------------..--..YGQGVLPLWVA-----ES...D....FSTCPA
d3ffhb1 .............................-----------------------MA..EL..GLTKITKLSSN-----EN...P....LGTSKK
d3ffra1 .............................-------------------------..--..------------------...-....------
d3fkdb_ .............................-------------------------..--..------------------...-....------
d3ftba_ .............................-------------------------..--..--------SSN-----IN...P....LGIPKS
d3getb_ .............................----------------------IAK..EY..GVKEVIKLASN-----EN...P....FGTPPK
d3h14a1 .............................--------RSAVDPFIVMDVMEAARraEE..AGRRIIHMEVG-----QP...G....TGAPRG
d3hdob_ .............................-------------------------..-P..DIASWIKLNTN-----EN...P....YPPSPE
d3hl2a_ .............................-------------------------..--..------------------...-....------
d3i5tb_ .............................-------------------------..--..------------------...-....------
d3jtxa1 .............................----LLKQLKPYPFARLHEAMQGIS..AP..EGMEAVPLHIG-----EP...K....HPTPKV
d3ju7a_ .............................-------------------------..--..------------------...-....------
d3k7ya_ .............................---KLLSSLENIEVDNILKTAREFK..ED..TCEEKINLSIGVCCNDDG...D....LHIFDS
d3l8ab_ .............................-------------------------..SE..NNPELLQMWVA-----DM...D....FLPVPE
d3lg0d_ .............................-------------------------..--..------------------...-....------
d3mebb_ .............................--MSVFSGFPASPPDAILNLTVLYN..AD..TNPKKVNLGVGAYRDESG...K....PWILPA
d3n5mb1 .............................-------------------------..--..------------------...-....------
d3ndnb_ .............................-------------------------..--..------------------...-....------
d3nx3b_ .............................-------------------------..--..---------IGVCALGYN...H....AKFNAK
d3nyuc_ .............................-------------------------..--..------------------...-....------
d3p1ta_ .............................-------------------------..--..------CLAFN-----EN...P....EAVEPR
d3pdxa_ .............................------------------------K..PN..PNKTVISLSIG-----DP...TvfgnLPTDPE
d3q8nd_ .............................-------------------------..DA..DGNQLIDFGSGIAVTTVG...Nsa..PAVVDA
d3ri6a_ .............................-------------------------..--..------------------...-....------
d3t32a_ .............................-------------------------..--..---ELIHAWIA-----DM...D....FEVPQP
d3tqxb_ .............................-------------------------..--..------------------...-....------
d3uwca_ .............................-------------------------..--..------------------...-....------
d4cvqa_ .............................-----SSKLENVCYDIRGPVLKEAKrlEE..EGNKVLKLNIG-----NP...A....PFGFDA
d4cxqb_ .............................-------------------------..--..------------------...-....------
d4eb5b_ .............................-------------------------..--..------------------...-....KPVDER
d4f5kb1 .............................-----FENITAAPADPILGLADLFR..AD..ERPGKVDLGVGVYKDETG...K....TPVMTS
d4ge9a1 .............................----------ARNPSPIRTMTDILS..RG..P-KSMISLAGGLP-----...N....PNMFPF
d4grxc_ .............................-------------------------..--..------------------...-....------
d4h51a_ .............................----RWQKIQAQAPDVIFDLAKRAA..AA..K-GPKANLVIGAYRDEQG...R....PYPLRV
d4isyd1 .............................-------------------------..--..------------YLDHAA...T....TPMHPA
d4ix8a_ .............................-------------------------..--..--KSNLRLSIG-DPTVDG...N....LKTPDI
d4lc3a_ .............................-------------------------..--..------------------...-....------
d4lw2a_ .............................-------------------------..--..----------GVYLDSAA...T....ALKPEA
d4my5d_ .............................---RFNKNLNKIEVSMIRQFDQSIS..--..DIPDVLKLTLG-----EP...D....FATPKH
d4oc9l_ .............................-------------------------..--..------------------...-....------
d4piwb_ .............................-------------------------..--..------------------...-....------
d4r5zd1 .............................-------------------------..GK..TVPGAIKLASN-----ET...V....FGPLPS
d4rjyd_ .............................-------------------------..--..------------------...-....------
d4u1tf_ .............................-------------------------..--..--------SAG-----TG...D....VVPPIH
d4uhoa_ .............................-------------------------..--..------------------...-....------
d4wbtb1 .............................------------------------L..ER..QHGRKIAARIGAN---ES...G....FGPAPS
d4xaub1 .............................-------------------------..--..------------------...-....------
d4ysna1 .............................-------------------------..--..--------NVG-----HT...H....EKVVKA
d4zm4a_ .............................-------------------------..--..EDGEIIDLNMG-----YG...P....HLFGYA
d5b89a1 .............................-------------------------..--..------------------...-....------
d5g0aa_ .............................-------------------------..--..------------------...-....------
d5i90a_ .............................-------------------------..--..------------------...-....------
d5jaya1 .............................-------------------------..--..------------------...-....------
d5lhaa_ .............................----------------ITDIDGQRM..LD..GVGGLWNVNIG-----HN...-....---RAS
d5ti8a_ .............................-------------------------..--..------------------...-....------
d5u23a1 .............................-------------------------..--..------------------...-....------
d5uida_ .............................-------------------------..--..------------------...-....------
d5wt5a_ .............................-------------------------..--..-----------IYLDNNA...T....TRIDPK


              60                     70           80        90               100        110       12
               |                      |            |         |                 |          |         
d1ajsa_ VRKVEQRIANNS.............SLNHEYL..PI.LGLAEFRTCASRLALGDDS......PALQEK..RVGG.VQSLGGTGALRIGAEFL
d1b9ha_ ------------.............-------..--.-------------------......-----A..HA--.LAVTNGTHALELALQVM
d1bs0a_ IIRAWQQGAEQFgigsggs......GHVSGYS..VV.H--QALEEELAEWL-----......---GYS..RA--.LLFISGFAANQAV----
d1bt4a_ ------------.............-------..--.-------------------......------..----.-----------------
d1bw0a_ QIKKLKEAIDS-.............QECNGYF..PT.VGSPEAREAVATWWRNSFVhkeelkSTIVKD..NV--.VLCSGGSHGILMA----
d1c0na_ VIDAEAEFYRH-.............----GYA..AVhAGAHTLSAQATEKMENVRKraslfiNARSAE..EL--.VFVRGTTEGINLVANSW
d1c4ka2 ------------.............-------..--.-------------------......---NADk.TY--.FVLGGSSNANNTV----
d1c7na_ LIEGLKKYLDE-.............-TVLGYT..GP.T--EEYKKTVKKWMKDRHQ......WDIQTD..WI--.INTAGVVPAVFNA----
d1cl1a_ ------------.............-------..--.-------------------......------..----.VLFPCGAAAVANS----
d1cs1a_ ------------.............-------..--.-------------------......------..--GA.VLTNTGMSAIHLV----
d1d2fa_ IIEALNQRLMH-.............-GVFGYS..RW.K-NDEFLAAIAHWFSTQHY......TAIDSQ..TV--.VYGPSVIYMVSEL----
d1dfoa_ ------------.............-----Y-..--.-GGCEYVDIVEQLAIDRAK......ELFGADy.AN--.VQPHSGSQANFAV----
d1elua_ ------------.............-------..--.--IAQLRQALAETF-----......-NVDPN..TI--.TITDNVTTGCDIVLWGL
d1fc4a_ AKAGMDSHGFGMa............SVRFICG..TQ.DSHKELEQKLAAFL-----......---GME..DA--.ILYSSCFDANGGL----
d1fg7a_ PTAVEFQLTQQ-.............-TLNRYP..EC.Q-PKAVIENYAQYA-----......-GVKPE..QV--.LVSRGADEGIELL----
d1gdea_ IKEYAKEALDK-.............-GLTHYG..PN.IGLLELREAIAEKLKKQNG......IEADPKt.EI--.MVLLGANQAFLMG----
d1h0ca_ ------------.............-------..--.-------------------......------..---L.VISGSGHCALEAA----
d1iaya_ ------------.............-AIANFQ..DY.HGLPEFRKAIAKFMEKTRGgr....VRFDPE..RV--.VMAGGATGANETI----
d1iuga_ ------------.............-------..--.-------------------......------..-EVL.ILTGSGTLAMEAL----
d1jg8a_ ------------.............-------..--.----------AETF-----......---GKE..--AA.LFVPSGTMGNQVS----
d1js3a_ ------------.............-------..--.-------------------......------..----.-----------------
d1lc5a_ VKRALIDNLDC-.............--IERYP..DA.D-YFHLHQALARHH-----......-QVPAS..WI--.LAGNGETESIFTVASGL
d1lk9a_ ------------.............-------..--.--------TIKELHEVVGN......AAAKDR..YI--.VFGVGVTQLIHGLVISL
d1m32a_ IRQQLTALATA-.............--SEGYT..SV.L------------------......------..----.LQGSGSYAVEAVL----
d1mdoa_ ------------.............-------..--.-------------------......------..--YA.VAVSSATAGMHIA----
d1n8pa_ ------------.............-------..--.-----LERAVAALENAQYG......LAFS--..----.----SGSATTATI----
d1o4sa_ VVEEAVRFLQK-.............-GEVKYT..DP.RGIYELREGIAKRIGERYK......KDISPD..QV--.VVTNGAKQALFNA----
d1o69a_ ------------.............-------..--.-------------------......-YSKSE..NA--.LALNSATAALHLALRVA
d1ohwa_ ------------.............-------..--.-------------------......------..SI--.LSFMGAFHGRTMG----
d1p3wa_ VAEKMMQFMTMDgtfgnpasr....SHRFGWQ..AE.EAVDIARNQIADLV-----......-GADPR..EI--.VFTSGATESDNLAIKGA
d1pmma_ ------------.............-------..--.-------------------......-APKNG..QAVG.TNTIGSSEACMLGGMAM
d1qgna_ ------------.............----RYG..NP.T-TVVLEEKISALE-----......---GAE..ST--.LLMASGMCASTVM----
d1qisa_ VKKAEQYLLEN-.............ETTKNYL..GI.DGIPEFGRCTQELLFGKGS......ALINDK..RART.AQTPGGTGALRVAADFL
d1qj5a_ ------------.............-------..--.-------------------......------..----.-----------------
d1qz9a_ LARAQAVIAEEWg............NGLIRSW..NS.AGWRDLSERLGNRLATL--......IGARDG..EV--.VVTDTTSINLFKVLSAA
d1sffa_ VEAQLKKLSHTC.............FQVLAYE..PY.L---ELCEIMNQKVPG---......-DFAKK..TL--.LVTTG-SEAVENAVKIA
d1svva_ ------------.............-QHAGY-..--.-GQDSHCAKAARLIGEL--......LERPDA..DV--.HFISGGTQTNLIA----
d1tpla_ ------------.............-------..--.-------------------......------..----.-----------------
d1u08a_ LQERLAHHVAQ-.............-GANQYA..PM.TGVQALREAIAQKTERLYG......YQPDADs.DI--.TVTAGATEALYAA----
d1uu1a_ LVDEVFRRLNS-.............DALRIYY..DS.P-DEELIEKILSYLDTD--......-FLSKN..NV--.SVGNGADEIIYVM----
d1v2da_ LLEAVRRALGR-.............--QDQYA..PP.AGLPALREALAEEF-----......-AVEPE..SV--.VVTSGATEALYVL----
d1v72a1 ------------.............-------..GP.YGTDELTAQVKRKF----C......EIFERDv.EV--.FLVPTGTAANALC----
d1vefa1 VKRQAETLMAM-.............-PQTLPT..PM.RG--EFYRTLTAIL-----......-PPELN..RV--.FPVNSGTEANEAALKFA
d1vp4a_ LAEIAKEIIEKEy............HYTLQYS..TT.EGDPVLKQQILKLLERMYGi.....TGLDED..NL--.IFTVGSQQALDLI----
d1wyua1 VQALAARG----.............EFLTAYT..PY.Q--PEVSQGVLQATFEYQTmiael.AGLEIA..NA--.SMYDGATALAEGV----
d1wyub1 ------------.............-------..--.-------------------......------..----.-----------------
d1xi9a_ MKEAYCKAIKE-.............-GHNYYG..DS.EGLPELRKAIVEREKRKNG......VDITPD..DV--.RVTAAVTEALQLI----
d1yiza1 ALNALAAAANSPd............PLANQYT..RG.FGHPRLVQALSKLYSQLVD......RTINPMt.EV--.LVTVGAYEALYAT----
d1z7da1 ------------.............-------..--.-------------------......------..----.-----------------
d1zoda1 ------------.............-------..--.-------------------......------..----.-----------------
d2a7va1 ------------.............-------..--.-------------------......-DLDPAq.WGVN.VQPYSGSPANLAV----
d2aeua1 ------------.............-------..--.----YFAEKVNEYGLKHLG......GDENDK..CVGF.NRTSSAILATILA----
d2bkwa1 ------------.............-------..--.-------------------......------..----.-----------------
d2bwna1 VLAAMHEALEAVgagsggtrni...SGTTAY-..--.--HRRLEAEIAGLHQKE--......------..--AA.LVFSSAYNANDATLSTL
d2c7ta_ ------------.............-------..--.---ESMERKFAKAFADFNG......VPYC--..----.VPTTSGSTALMLALEAL
d2csta_ VRKVEQLIAGDG.............SLNHEYL..PI.LGLPEFRANASRIALGDDS......PAIAQK..RVGS.VQGLGGTGALRIGAEFL
d2ctza1 ------------.............-------..--.-------------------......------..--AA.LATASGHAAQFLA----
d2cy8a_ ------------.............-------..--.-------------------......------..----.-----------------
d2doub_ PLKALAEALND-.............PTTYGYC..LK.SCTLPFLEEAARWYEGRYG......VGLDPRr.EA--.LALIGSQEGLAHL----
d2dr1b_ VLEIMKVQMFS-.............HRSKEYR..KV.H--MDTVERLREFL-----......-EVEKG..EV-L.LVPSSGTGIMEAS----
d2e7ja1 ------------.............-------..--.-------------------......-----A..----.RVTNGAREAKFAV----
d2e7ua_ HPKVLARVRETL.............ERGLTFG..AP.S---PLEVALAKKVKRAYP......F---VD..LV--.RFVNSGTEATMSALRLA
d2fnua1 ------------.............-------..--.-----FEEALCEFL-----......---GVK..HA--.LVFNSATSALLTLYRNF
d2gb3a1 FFERIYENKPE-.............--VVYYS..HS.AGIWELREAFASYYKRRQR......VDVKPE..NV--.LVTNGGSEAILFS----
d2gsaa_ VIEALKVAMEK-.............--GTSFG..AP.C---ALENVLAEMVNDA--......-VPSIE..MV--.RFVNSGTEACMAVLRLM
d2huib_ ------------.............-------..--.-------------------......---QTN..NIATfCLSASGHGGMEAT----
d2o0ra1 MLQAAQDAIAG-.............-GVNQYP..PG.PGSAPLRRAIAAQRRRHFG......VDYDPEt.EV--.LVTVGATEAIAAA----
d2o1ba_ IIDHFQKALTI-.............PENQKYG..AF.HGKEAFKQAIVDFYQRQYN......VTLDKEd.EV--.CILYGTKNGLVAV----
d2x5dd_ IVEKLCTVAQR-.............EDTHGYS..TS.RGIPRLRRAISHWYRDRYD......VQIDPEs.EA--.IVTIGSKEGLAHL----
d2z61a_ IVDEGIKSLKE-.............-GKTHYT..DS.RGILELREKISELYKDKYK......ADIIPD..NI--.IITGGSSLGLFFA----
d2z67a1 ------------.............-------..--.-------------------......-GLNVH..AIAT.PISTGMSISLCLS----
d2zc0d_ LGEIAKEVLEKE.............PKSVMYT..PA.NGIPELREELAAFLKKYDH......LEVSPE..NI--.VITIGGTGALDLL----
d3a2ba_ AQDALEKYGTGCags..........RFLNGTL..DI.H--VELEEKLSAYVGKE--......-----A..AI--.LFSTGFQSNLGP-----
d3aepa_ ------------.............-------..--.-------------------......------..----.--FGSGMGAISSS----
d3asaa_ VAEAFASSIARLssp..........TTCRGYG..PD.FGLPALRQKLSEDFYRG--......-FVDAK..EI--.FISDGAKVDLFR-----
d3bc8a1 ------------.............-------..--.-------------------......------..----.-----------------
d3cq4b1 LVADLVATVDKIa............TELNRYP..ER.D-AVELRDELAAYITKQTG......VAVTRD..NL--.WAANGSNEILQQL----
d3drdb_ GAEAMEIALK--.............-MAFQYW..KN.IGKPEKQKFIAMKN-----......-GYHGD..TI-G.AVSVGSIELFHHV----
d3dzza_ IMASMEEKLKV-.............-AAFGYE..SV.P--AEYYKAVADWEEIEHR......ARPKED..WC--.VFASGVVPAISAM----
d3e2fb_ VKEELSKAAFI-.............DNMNQYT..RG.FGHPALVKALSCLYGKIYQ......RQIDPNe.EI--.LVAVGAYGSLFNS----
d3eucb1 LRSELAARLGE-.............VALNRYP..VP.S-SEALRAKLKEVM-----......-QVPAGm.EV--.LLGNGSDEIISML----
d3ezsb_ IQDALKNHTHS-.............--LNIYP..KS.AFEESLRAAQRGFFKRRFK......IELKEN..EL--.ISTLGSREVLFNFPSFV
d3f0ha1 ------------.............-------..--.------------------K......APEGSK..AV--.FMTCSSTGSMEAV----
d3fdba1 VLQAITDAVQR-.............-EAFGYQ..PD.G--SLLSQATAEFYADRYG......YQARPE..WI--.FPIPDVVRGLYIA----
d3ffhb1 VAAIQANSSVE-.............--TEIYP..DG.W-ASSLRKEVADFY-----......-QLEEE..EL--.IFTAGVDELIELL----
d3ffra1 ------------.............-------..--.-------------------......------..----.-----------------
d3fkdb_ ----EKHLVENL.............NCIRHYP..EP.D-AGTLRQMLAKRN-----......-SVDNN..AI--.LVTNGPTAAFYQI----
d3ftba_ FLNNIDEGIKN-.............--LGVYP..DV.N-YRRLNKSIENYL-----......-KLKDI..GI--.VLGNGASEIIELS----
d3getb_ AIECLRQNANK-.............--AHLYP..DD.S-MIELKSTLAQKY-----......-KVQNE..NI--.IIGAGSDQVIEFA----
d3h14a1 AVEALAKSLET-.............-DALGYT..VA.LGLPALRQRIARLYGEWYG......VDLDPG..RV--.VITPGSSGGFLLA----
d3hdob_ VVKAILEELGPD.............GAALRIY..PS.ASSQKLREVAGELY-----......-GFDPS..WI--.IMANGSDEVLNNL----
d3hl2a_ ------------.............-------..--.-------------------......------..----.-----------------
d3i5tb_ ------------.............-------..AT.SPAARLAEKIATLT-----......-PGDLN..RI--.FFTTGGSTAVDSALRFS
d3jtxa1 ITDALTASLHE-.............--LEKYP..LT.AGLPELRQACANWLKRRYDg.....LTVDADn.EI--.LPVLGSREALFSF----
d3ju7a_ -----EIDAS--.............HIYTNYG..PI.N--QRFEQTIMSGFFQNRG......AVTTVA..NA--.--TLGLMAAIQ----LK
d3k7ya_ VLNADKLVTEN-.............YKEKPYL..LG.NGTEDFSTLTQNLIFGNNS......KYIEDK..KICT.IQCIGGTGAIFVLLEFL
d3l8ab_ IKEAIINYGRE-.............-HIFGYN..YF.N--DDLYQAVIDWERKEHD......YAVVKE..DI--.LFIDGVVPAISIA----
d3lg0d_ ------------.............-------..--.-------------------......------..----.-----------------
d3mebb_ VKEAEAIISSDLs............KYNKEYP..PV.AGFPLFLEAAQFLMFGKDS......KAAQEG..RIAS.CQSLSGTGSLHIGFEFL
d3n5mb1 ------------.............-------..--.-------------------......------..----.-----------------
d3ndnb_ ------------.............-------..--.-------------------......------..--AA.FATASGMAAVFTS----
d3nx3b_ IKAQVDKLLHT-.............-SNLYYN..EN.I------AAAAKNL----A......KASALE..RV--.FFTNSGTESIEGAMKTA
d3nyuc_ ------------.............---GQYI..LG.PEVTELEDRLADFVGAKYC......------..----.ISCANGTDALQIV----
d3p1ta_ VQAAIAAAAAR-.............--INRYP..FD.A-EPRVMRKLAEHF-----......-SCPED..NL--.MLVRGIDECFDRISAEF
d3pdxa_ VTQAMKDALDS-.............GKYNGYA..PS.IGYLSSREEVASYY-HCPE......APLEAK..DV--.ILTSGCSQAIELC----
d3q8nd_ VTQQVAAFTHT-.............--CFMVT..PY.EGYVKVAEHLNRLT-----......-PGDHEk.RT--.ALFNSGAEAVENAVKIA
d3ri6a_ ------------.............-------..--.-------------------......------..----.LALGSGMAAISTA----
d3t32a_ IQTALKKRIEH-.............-PIFGYT..LP.P--ENIGDIICNWTKKQYN......WDIQKE..WI--.VFSAGIVPALSTS----
d3tqxb_ ------------.............-------..--.------TQTIHKELEKDIS......EFLGTD..DT--.ILYSSCFDANGGL----
d3uwca_ ------------.............-------..--.-------------------......------..----.-----GTDALAMSFKML
d4cvqa_ PDEILVDVIRNL.............PTAQGYC..DS.KGLYSARKAIMQHYQARGM......RDVTVE..DI--.YIGNGVSELIVQA----
d4cxqb_ ------------.............-------..--.-------------------......------..----.-----------------
d4eb5b_ ILEAMLPYMTESfgnp.........SSVHSYGfkAR.EAVQEAREKVAKLV-----......-NGGGG..TV--.VFTSGATEANNLAIIGY
d4f5kb1 VKKAEQYLLEN-.............ETTKTYL..GL.DGLPEFGRCTQELLFGKGS......ALINDK..RART.AQTPGGSGALRVAADFL
d4ge9a1 KTAVITVENGKTiqfgeemm.....KRALQYS..PS.AGIPELLSWLKQLQIKLHNppt...IHYPPSqgQMDL.CVTSGSQQGLCKV----
d4grxc_ ------------.............-------..--.---VMLSEKLVEVS-----......-PFDNG..RV--.FYTNSGSEANDTMVKML
d4h51a_ VRKAEQLLLDM-.............NLDYEYL..PI.SGYQPFIDEAVKIIYGN--......-TVELE..NLVA.VQTLSGTGAVSLGAKLL
d4isyd1 AIEAMAAVQRTIgnass........LHTSGRS..AR.RRIEEARELIADKL-----......-GARPS..EV--.IFTAGGTESDNLAVKGI
d4ix8a_ VTEAMVDVVRS-.............GKFNGYP..PT.VGADNLRQVVSTYWRRFCQtksrq.EALKWE..NV--.IITSGVSQAIVLA----
d4lc3a_ ------------.............-------..--.-------------------......-----R..PV--.RVFNSGTCTLEIGLRIA
d4lw2a_ VVEATQQFYSLSagnvhrsqfaeaqRLTAR--..--.--YEAAREKVAQLL-----......-NAPDDk.TI--.VWTRGTTESINMVAQCY
d4my5d_ IKEAAKRAIDA-.............-DESHYT..GM.AGLLALRQAASAFVKEKYH......LTYNPDn.EI--.LVTIGATEALSAS----
d4oc9l_ ------------.............-------..--.-------------------......------..--FG.IPVASGMAACFYA----
d4piwb_ ------------.............-------..--.-----FTRRCQQWL----E......QRFGSA..KV--.LLTPSCTASLEMAALLL
d4r5zd1 VRAAIDRATDT-.............--VNRYP..DN.-GCVQLKAALARHL----G......PDFAPE..HV--.AVGCGSVSLCQQL----
d4rjyd_ ------------.............-------..DV.YGDDPTVNALQDYAAELSG......KE----..--AA.IFLPTGTQANLVA----
d4u1tf_ VSTTYERRAQD-.............--EPRYF..YG.RGENPTREELEECLAGLER......A-----..PF--.ATVFSSGQAAAAT----
d4uhoa_ ------------.............-------..--.-------------------......------..----.-----------------
d4wbtb1 VLLAIRQAAGD-.............--TWKYA..DP.E-NHDLKQALARHL-----......-GTSPA..NI--.AIGEGIDGLLGQI----
d4xaub1 ------------.............-------..--.---AEFESALAARL-----......---GNP..RV--.VSVHSGTSGLCLA----
d4ysna1 IADQAQKLIHYT.............PAYFHHV..PG.M---ELSEKLAKIA-----......PGNSPK..MV--.SFGNSGSDANDAIIKFA
d4zm4a_ DREVLDAVADQ-.............---FAKG..HM.TGLPHELDARAGALIAE--......LVPGVE..QV--.RFANSGTEAVASALRLA
d5b89a1 --RLSQMATHK-.............-------..--.--YEESRKIVADFI-----......-GAKFE..EI--.VFTKNTSESLNLVALGL
d5g0aa_ ------------.............-------..--.-------------------......------..----.-----------------
d5i90a_ ------------.............-------..--.----EARAWAGRYF-----......-AVQPG..QV--.ALTGSTTDGLAAIYGGL
d5jaya1 ------------.............-------..--.---AQLEDDLAEFV----G......GFVENA..RA--.LYFSTGYMANLAT----
d5lhaa_ VKAAIAAQLDE-.............--LAYYQ..TF.DGIAHPR--VFDLAERLTG......MFAQERmaRV--.LFSSGGSDAVETALKMA
d5ti8a_ --KQMLELPYY-.............NLFFQTA..HP.P-ALELAKAIADIA-----......-PEGMN..HV--.FFTGSGSESNDTVLRMV
d5u23a1 ------------.............-------..--.-------------------......------..----.--CIGVANGLDALRLII
d5uida_ ------------.............-------..--.---------FAEHL-----......-GVGAE..QV--.VSVSCCTEGLFLSMELL
d5wt5a_ VKEIMDPFLRDHygnp.........SSLHQFG..TE.T-HPAIAEALDKLYKGIN-......-ARDID..DV--.IITSCATESNNWVLKGV


        0                   130                140                      150                         
        |                     |                  |                        |                         
d1ajsa_ ARWYNGT.NN...........KD.....TPV..YVS.SPT.WE..NHNG...V....FTT......AGFK......................
d1b9ha_ GVG----.--...........PG.....TEV..IVP.AFT.FI..SSSQ...A....AQR......LGAV......................
d1bs0a_ ---IAAM.MA...........KE.....DRI..AAD.RLS.HA..SLLE...A....ASL......SPSQ......................
d1bt4a_ -------.--...........--.....---..---.---.--..----...-....---......----......................
d1bw0a_ ---ITAI.CD...........AG.....DYA..LVP.QPG.FP..HYET...V....CKA......YGIG......................
d1c0na_ GNS---N.VR...........AG.....DNI..IIS.QME.HH..ANIV...P....WQMlcar..VGAE......................
d1c4ka2 ---TSAL.VS...........NG.....DLV..LFD.RNN.HK..SVYN...S....ALAm.....AGGR......................
d1c7na_ ---VREF.TK...........PG.....DGV..III.TPV.YY..PFFM...A....IKN......QERK......................
d1cl1a_ ---ILAF.IE...........QG.....DHV..LMT.NTA.YE..PSQD...F....CSKilsk..LGVT......................
d1cs1a_ ---TTVF.LK...........PG.....DLL..VAP.HDC.YG..GSYR...L....FDSlak...RGCY......................
d1d2fa_ ---IRQW.SE...........TG.....EGV..VIH.TPA.YD..AFYK...A....IEG......NQRT......................
d1dfoa_ ---YTAL.LE...........PG.....DTV..LGM.NLA.HG..GHLT...H....GSP......VNFSgk....................
d1elua_ DWH----.--...........QG.....DEI..LLT.DCE.HP..GIIA...I....VQAiaar..FGIT......................
d1fc4a_ ---FETL.LG...........AE.....DAI..ISD.ALN.HA..SIID...G....VRL......CKAK......................
d1fg7a_ ---IRAF.CE...........PGk....DAI..LYC.PPT.YG..MYSV...S....AET......IGVE......................
d1gdea_ ---LSAF.LK...........DG.....EEV..LIP.TPA.FV..SYAP...A....VIL......AGGK......................
d1h0ca_ ---LVNV.LE...........PG.....DSF..LVG.ANG.IW..GQRA...V....DIG......ERIG......................
d1iaya_ ---IFCL.AD...........PG.....DAF..LVP.SPY.YP..AFNR...D....LRWr.....TGVQ......................
d1iuga_ ---VKNL.FA...........PG.....ERV..LVP.VYG.KF..SERF...Y....EIAle....AGLV......................
d1jg8a_ ---IMAH.TQ...........RG.....DEV..ILE.ADS.HI..FWYEvgaM....AVL......SGVM......................
d1js3a_ -------.--...........--.....---..---.---.--..----...-....---......GGVK......................
d1lc5a_ KPR----.--...........--.....-RA..MIV.TPG.FA..EYGR...A....LAQ......SGCE......................
d1lk9a_ SPNMTAT.PD...........APe....SKV..VAH.APF.YP..VFRE...Q....TKY......FDKK......................
d1m32a_ ---GSAL.GP...........QD.....KVL..IVS.NGA.YG..AR--...M....VEM......AGLM......................
d1mdoa_ ---LMALgIG...........EG.....DEV..ITP.SMT.WV..STLN...M....IVL......LGAN......................
d1n8pa_ ---LQSL.PQ...........GS.....HAV..SIG.DVY.GG..THRY...F....TKV......ANAH......................
d1o4sa_ ---FMAL.LD...........PG.....DEV..IVF.SPV.WV..SYIP...Q....IIL......AGGT......................
d1o69a_ GVK----.--...........QD.....DIV..LAS.SFT.FI..ASVA...P....ICY......LKAK......................
d1ohwa_ ---CLAT.TH...........SKai...HKI..DIP.SFD.WP..IAPF...P....RLK......YPLE......................
d1p3wa_ ANF---Y.QK...........KG.....KHI..ITS.KTE.HK..AVLD...T....CRQ......LERE......................
d1pmma_ KWRWRKR.MEaagk.......PTd....KPN..LVC.GPV.QI..CWHK...F....ARY......WDVE......................
d1qgna_ ---LLAL.VP...........AG.....GHI..VTT.TDC.YR..KTRI...F....IETilpk..MGIT......................
d1qisa_ AKN----.-T...........SV.....KRV..WVS.NPS.WP..NHKS...V....FNS......AGLE......................
d1qj5a_ -------.--...........--.....---..---.---.--..----...-....---......----......................
d1qz9a_ LR-VQAT.RS...........PE.....RRV..IVT.ETSnFP..TDLY...I....AEGladmlqQGYT......................
d1sffa_ RAA----.TK...........RS.....GTI..AFS.GAY.HG..RTHY...T....LAL......TGKVnpysagmglmp...........
d1svva_ ---CSLA.LR...........PW.....EAV..IAT.QLG.HI..STHE...Tga..IEA......TGHK......................
d1tpla_ -------.--...........--.....---..---.---.--..----...-....---......----......................
d1u08a_ ---ITAL.VR...........NG.....DEV..ICF.DPS.YD..SYAP...A....IAL......SGGI......................
d1uu1a_ ---MLMF.--...........--.....DRS..VFF.PPT.YS..CYRI...F....AKA......VGAK......................
d1v2da_ ---LQSL.VG...........PG.....DEV..VVL.EPF.FD..VYLP...D....AFL......AGAK......................
d1v72a1 ---LSAM.TP...........PW.....GNI..YCH.PAS.HI..NNDE...CgapeFFS......NGAK......................
d1vefa1 RAH----.TGrkkfvaamrgfSG.....RTM..GSL.SVT.WE..PKYR...E....PFL......PLVE......................
d1vp4a_ ---GKLF.LD...........DE.....SYC..VLD.DPA.YL..GAIN...A....FRQ......YLAN......................
d1wyua1 ---LLAL.RE...........TGr....MGV..LVS.QGV.HP..EYRA...V....LRAylea..VGAK......................
d1wyub1 -------.--...........-R.....RVV..LVP.DSA.HG..SNPA...T....ASM......AGYQ......................
d1xi9a_ ---FGAL.LD...........PG.....DEI..LVP.GPS.YP..PYTG...L....VKF......YGGK......................
d1yiza1 ---IQGH.VD...........EG.....DEV..III.EPF.FD..CYEP...M....VKA......AGGI......................
d1z7da1 -------.--...........--.....---..---.---.--..----...-....---......----......................
d1zoda1 -------.--...........--.....---..---.---.--..----...-....---......----......................
d2a7va1 ---YTAL.LQ...........PH.....DRI..MGL.DLP.DG..GHLT...H....GYM......SDVKrisatsiff.............
d2aeua1 ------L.-K...........PK.....KVIhyLPE.LPG.HP..SIER...S....CKI......VNAK......................
d2bkwa1 -------.--...........--.....---..---.---.--..----...-....---......----......................
d2bwna1 RVL----.-F...........PG.....LII..YSD.SLN.HA..SMIE...G....IKRn.....AGPK......................
d2c7ta_ GIG----.--...........EG.....DEV..IVP.SLT.WI..ATAT...A....VLN......VNAL......................
d2csta_ RRWYNGN.NN...........TA.....TPV..YVS.SPT.WE..NHNS...V....FMD......AGFK......................
d2ctza1 ---LTTL.AQ...........AG.....DNI..VST.PNL.YG..GTFN...Q....FKVtlkr..LGIE......................
d2cy8a_ -------.--...........--.....---..---.---.--..----...-....---......----......................
d2doub_ ---LLAL.TE...........PE.....DLL..LLP.EVA.YP..SYFG...A....ARV......ASLR......................
d2dr1b_ ---IRNG.VS...........KG.....GKV..LVT.IIG.AFgkRYKE...V....VES......NGRK......................
d2e7ja1 ---MHSL.AK...........KD.....AWV..VMD.ENC.HY..SSYV...A....AER......AGLN......................
d2e7ua_ RGY----.-T...........GR.....PYI..VKF.RGN.YH..GHAD...G....LLVe.....A-GSgaltlgvpssagvpeeya....
d2fnua1 SEF----.-S...........ADr....NEI..ITT.PIS.FV..ATAN...M....LLE......SGYT......................
d2gb3a1 ---FAVI.AN...........PG.....DEI..LVL.EPF.YA..NYNA...F....AKI......AGVK......................
d2gsaa_ RAY----.-T...........GR.....DKI..IKF.EGC.YH..GHAD...M....FLVkag...S--Gvatlglpsspgvpkktta....
d2huib_ ---LCNL.LE...........DG.....DVI..LIG.HTG.HW..GDRS...Adm..ATR......YGAD......................
d2o0ra1 ---VLGL.VE...........PG.....SEV..LLI.EPF.YD..SYSP...V....VAM......AGAH......................
d2o1ba_ ---PTCV.IN...........PG.....DYV..LLP.DPG.YT..DYLA...G....VLL......ADGK......................
d2x5dd_ ---MLAT.LD...........HG.....DTI..LVP.NPS.YP..IHIY...G....AVI......AGAQ......................
d2z61a_ ---LSSI.ID...........DG.....DEV..LIQ.NPC.YP..CYKN...F....IRF......LGAK......................
d2z67a1 ---AARK.KY...........GS.....NVV..IYP.YAS.HK..SPIK...A....VSF......VGMN......................
d2zc0d_ ---GRVL.ID...........PG.....DVV..ITE.NPS.YI..NTLL...A....FEQ......LGAK......................
d3a2ba_ ---LSCL.MG...........RN.....DYI..LLD.ERD.HA..SIID...G....SRL......SFSK......................
d3aepa_ ---TLAF.LQ...........KG.....DHL..IAG.DTL.YG..CTVS...L....FTHwlpr..FGIE......................
d3asaa_ ---LLSF.FG...........PN.....QTV..AIQ.DPS.YP..AYLD...I....ARL......TGAK......................
d3bc8a1 -------.--...........--.....---..---.---.--..---K...S....MVT......AGFE......................
d3cq4b1 ---LQAF.GG...........PG.....RTA..LGF.QPS.YS..MHPI...L....AKG......THTE......................
d3drdb_ ---YGP-.--...........--.....---..---.---.--..---L...M....FES......YKAP......................
d3dzza_ ---VRQF.TS...........PG.....DQI..LVQ.EPV.YN..MFYS...V....IEG......NGRR......................
d3e2fb_ ---IQGL.VD...........PG.....DEV..IIM.VPF.YD..CYEP...M....VRM......AGAV......................
d3eucb1 ---ALAA.AR...........PG.....AKV..MAP.VPG.FV..MYAM...S....AQF......AGLE......................
d3ezsb_ LFD----.-Y...........QN.....PTI..AYP.NPF.YQ..IYEG...A....AKF......IKAK......................
d3f0ha1 ---VMNC.FT...........KK.....DKV..LVI.DGG.SF..GHRF...V....QLC......EIHE......................
d3fdba1 ---IDHF.TP...........AQ.....SKV..IVP.TPA.YP..PFFH...L....LSA......TQRE......................
d3ffhb1 ---TRVL.LD...........TT.....TNT..VMA.TPT.FV..QYRQ...N....ALI......EGAE......................
d3ffra1 -------.--...........--.....---..---.---.--..----...-....---......----......................
d3fkdb_ ---AQAF.--...........RG.....SRS..LIA.IPS.FA..EYED...A....CRM......YEHE......................
d3ftba_ ---ISLF.--...........--.....EKI..LII.VPS.YA..EYEI...N....AKK......HGVS......................
d3getb_ ---IHSK.LN...........SK.....NAF..LQA.GVT.FA..MYEI...Y....AKQ......CGAK......................
d3h14a1 ---FTAL.FD...........SG.....DRV..GIG.APG.YP..SYRQ...I....LRA......LGLV......................
d3hdob_ ---IRAF.AA...........EG.....EEI..GYV.HPS.YS..YYGT...L....AEV......QGAR......................
d3hl2a_ -------.--...........--.....---..---.---.--..---K...S....MIT......AGFE......................
d3i5tb_ EFYNNVL.GR...........PQk....KRI..IVR.YDG.YH..GSTA...L....TAA......CTGRtgnwpnfdiaqdrisflssp..
d3jtxa1 ---VQTV.LN...........PVsdgikPAI..VSP.NPF.YQ..IYEG...A....TLL......GGGE......................
d3ju7a_ KRK----.--...........KG.....KYA..LMP.SFT.FP..ATPL...A....AIW......CGLE......................
d3k7ya_ KML----.--...........NV.....ETL..YVT.NPP.YI..NHVN...M....IES......RGFN......................
d3l8ab_ ---LQAF.SE...........KG.....DAV..LIN.SPV.YY..PFAR...T....IRL......NDHR......................
d3lg0d_ -------.--...........--.....---..---.---.--..----...-....---......----......................
d3mebb_ HLW----.-M...........PK.....AEF..YMP.STT.WP..NHYG...I....YDKvfnk..LKVP......................
d3n5mb1 -------.--...........--.....---..---.---.--..----...-....---......----......................
d3ndnb_ ---LGAL.LG...........AG.....DRL..VAA.RSL.FG..SCFV...V....CSEilpr..WGVQ......................
d3nx3b_ RKYAFNK.GV...........KG.....GQF..IAF.KHS.FH..GRTL...G....ALS......LTANekyqkpfkplis..........
d3nyuc_ ---QMALgVG...........PG.....DEV..ITP.GFT.YV..ATAE...T....VAL......LGAK......................
d3p1ta_ SSM----.--...........--.....-RF..VTA.WPG.FD..GYRA...R....IAV......SGLR......................
d3pdxa_ ---LAVL.AN...........PG.....QNI..LIP.RPG.FS..LYRT...L....AES......MGIE......................
d3q8nd_ RAY----.-T...........RR.....QAV..VVF.DHA.YH..GRTN...L....TMA......MTAKnqpykhgfgpfanevyr.....
d3ri6a_ ---ILTL.AR...........AG.....DSV..VTT.DRL.FG..HTLS...L....FQKtlps..FGIE......................
d3t32a_ ---IQAF.TK...........EN.....ESV..LVQ.PPI.YP..PFFE...M....VTT......NNRQ......................
d3tqxb_ ---FETL.LG...........PE.....DAI..ISD.ELN.HA..SIID...G....IRL......CKAQ......................
d3uwca_ NI-----.-G...........AG.....DEV..ITC.ANT.FI..ASVG...A....IVQ......AGAT......................
d4cvqa_ ---MQAL.LN...........SG.....DEM..LVP.APD.YP..LWTA...A....VSL......SSGK......................
d4cxqb_ -------.--...........--.....---..---.---.--..----...-....---......----......................
d4eb5b_ ---AMRN.AR...........KG.....KHI..LVS.AVE.HM..SVIN...P....AKFlqk...QGFE......................
d4f5kb1 AKN----.-T...........SV.....KRV..WVS.NPT.WP..NHKA...I....FNS......AGLE......................
d4ge9a1 ---FEMI.IN...........PG.....DNV..LLD.EPA.YS..GTLQ...S....LHP......LGCN......................
d4grxc_ WFLHAAE.GK...........PQk....RKI..LTR.WNA.YH..GVTA...V....SAS......MTGKpynsvfglplpgfihlt.....
d4h51a_ TRV----.FD...........AEt....TPI..YLS.DPT.WP..NHYG...V....VKA......AGWK......................
d4isyd1 YWARRDA.EP...........HR.....RRI..VTT.EVE.HH..AVLD...S....VNWlveh..EGAH......................
d4ix8a_ ---LTAL.CN...........EG.....DNI..LVC.APS.FP..HYKS...V....CDS......YGIE......................
d4lc3a_ GV-----.-G...........PG.....DEV..ITT.PAS.WV..STSN...V....IIE......TGAT......................
d4lw2a_ ARP---R.LQ...........PG.....DEI..IVS.VAE.HH..ANLV...P....WLMvaqq..TGAK......................
d4my5d_ ---LTAI.LE...........PG.....DKV..LLP.APA.YP..GYEP...V....VNL......VGAE......................
d4oc9l_ ---LINL.AS...........SG.....DNV..AYS.NKI.YG..GTQT...L....ISHtlkn..FGIE......................
d4piwb_ DIQ----.--...........PG.....DEV..IMP.SYT.FV..STAN...A....FVL......RGAK......................
d4r5zd1 ---VQVT.AS...........VG.....DEV..VFG.WRS.FE..LYPP...Q....VRV......AGAI......................
d4rjyd_ ---LLSH.CE...........RG.....EEY..IVG.QAA.HN..YLFE...A....GGA......AVLG......................
d4u1tf_ ---LLSL.VR...........PG.....QCV..VST.DDV.YA..GTDG...L....FDL......AARQ......................
d4uhoa_ -------.--...........--.....---..---.---.--..----...-....---......----......................
d4wbtb1 ---VRLV.VE...........AG.....APV..VTS.LGG.YP..TFNY...H....VAG......HGGR......................
d4xaub1 ---LRLL.DA...........PEer...DEV..LST.PLT.FE..ATNW...A....ILA......DGRR......................
d4ysna1 RAY----.TG...........R-.....QYI..VSY.MGS.YH..GSTY...G....SQT......LSGSslnmtrkigpmlpsvvhvpypd
d4zm4a_ RAT----.--...........TGr....TLV..VTF.EGH.YH..GWSE...T....VLR......AGKTalhmegtrptdvvpgalgmipe
d5b89a1 GHI----.FK...........RG.....DKI..VTT.PYE.HH..SDLL...P....WQRlatk..LGLK......................
d5g0aa_ -------.--...........--.....---..---.---.--..----...-....---......----......................
d5i90a_ LVQ----.--...........PG.....KEI..LTS.SHE.HY..STYT...T....LEYrhkr..MGTQ......................
d5jaya1 ---LTAL.AG...........RG.....TTL..FSD.ALN.HA..SLID...G....ARL......SRAD......................
d5lhaa_ RQYWIAS.GE...........PGr....TRF..LSL.RNG.YH..GVHM...G....GTS......VGGNgvyhynhgqllagchlldtpwl
d5ti8a_ RHYWSIK.GK...........PQ.....KKV..VIGrWNG.YH..GSTV...A....GVS......LGGMkalhsqgdlpipgivhiaqpyw
d5u23a1 KAY---D.FK...........EN.....DEI..IVP.ANT.YI..ASIL...A....ITD......NKCK......................
d5uida_ GVG----.--...........PG.....DEV..VLP.SIS.FV..GAAN...A....IAA......RGAR......................
d5wt5a_ YF--DEC.LK...........KGk....NHI..VTT.VAE.HP..AVRS...T....CNFles...LGVE......................


                      160                         170               180                             
                        |                           |                 |                             
d1ajsa_ ..........DIRSYRY.........WDTEK........RGLD.L.....QGFLSDLE...NA......PE......F.........SIFVL
d1b9ha_ ..........-TVPVDV.........DAA-T........YNLD.P.....EAVAAAV-...--......TP......R.........TKVIM
d1bs0a_ ..........-LRRFA-.........--H--........--ND.V.....THLARLLA...SP......CP......G.........QQMVV
d1bt4a_ ..........-------.........-----........----.-.....--------...--......--......-.........-----
d1bw0a_ ..........-MHFYNC.........RPEND........WEAD.L.....DEIRRLK-...--......DD......K.........TKLLI
d1c0na_ ..........-LRVIPL.........NPD--........GTLQ.L.....ETLPTLF-...--......DA......A.........TRLLA
d1c4ka2 ..........-PVYLQT.........NRN--........----.-.....--------...--......--......-.........-----
d1c7na_ ..........-IIECEL.........LEKDGy.......YTID.F.....QKLEKLSK...--......DK......N.........NKALL
d1cl1a_ ..........-------.........----T........SWFD.P.....LIGADIVK...HL......QP......N.........TKIVF
d1cs1a_ ..........RVLFVD-.........-----........-QGD.E.....QALRAAL-...--......AE......K.........PKLVL
d1d2fa_ ..........-VMPVALe........KQADG........WFCD.M.....GKLEAVLA...--......KP......E.........CKIML
d1dfoa_ ..........LYNIVPY.........GIDAT........GHID.Y.....ADLEKQAK...EH......--......K.........PKMII
d1elua_ ..........-YRFFPV.........AATLN........QGDA.A.....AVLANHL-...--......GP......K.........TRLVI
d1fc4a_ ..........-RYRYA-.........-----........-NND.M.....QELEARLK...EA......REa.....G.........ARHVL
d1fg7a_ ..........-CRTVPT.........LDN--........WQLD.L.....QGISDKL-...--......-D......G.........VKVVY
d1gdea_ ..........-PVEVPT.........YEEDE........FRLN.V.....DELKKYV-...--......TD......K.........TRALI
d1h0ca_ ..........-ARVHPM.........TKDPG........GHYT.L.....QEVEEGLA...--......QH......K.........PVLLF
d1iaya_ ..........-LIPIHC.........ESSNN........FKIT.S.....KAVKEAYE...NA......QKsni...K.........VKGLI
d1iuga_ ..........-VERLDYp........YGD--........-TPR.P.....EDVA----...--......KE......G.........YAGLL
d1jg8a_ ..........-PHPVPG.........KNG--........-AMD.P.....DDVRKAI-...--......RP......Rnihfpr...TSLIA
d1js3a_ ..........-LKAIPS.........DGK--........FAMR.A.....SALQEALE...--......RD......K.........AAGLI
d1lc5a_ ..........-IRRWSL.........READG........WQLT.-.....DAILEAL-...--......TP......D.........LDCLF
d1lk9a_ ..........GYVWAGN.........AAN--........-YVN.V.....SNPEQYIE...--......--......-.........----M
d1m32a_ ..........GIAHHAY.........DCGEV........ARPD.V.....QAIDAIL-...--......NA......D.........PTISH
d1mdoa_ ..........-PVMVDV.........DRD-T........LMVT.P.....EHIEAAI-...--......TP......Q.........TKAII
d1n8pa_ ..........-GVETSF.........TND--........---L.L.....NDLPQLI-...--......KE......N.........TKLVW
d1o4sa_ ..........-VNVVET.........FMSKN........FQPS.L.....EEVEGLL-...--......VG......K.........TKAVL
d1o69a_ ..........-PVFIDC.........DET--........YNID.V.....DLLKLAIK...EC......EK......K.........PKALI
d1ohwa_ ..........EFVKENQ.........QEEAR........CLEE.V.....EDLIVKYR...KK......KK......T.........VAGII
d1p3wa_ ..........-GFEVTYl........APQRN........GIID.L.....KELEAAM-...--......RD......D.........TILVS
d1pmma_ ..........-LREIPM.........RPG-Q........LFMD.P.....KRMIEAC-...--......DE......N.........TIGVV
d1qgna_ ..........-ATVID-.........-----........-PAD.V.....GALELALN...--......QK......K.........VNLFF
d1qisa_ ..........-VREYAY.........YDAEN........HTLD.F.....DALINSLN...EA......QA......G.........DVVLF
d1qj5a_ ..........-------.........-----........----.-.....--------...--......--......-.........-----
d1qz9a_ ..........----LRL.........VDS--........----.P.....EELPQAI-...--......DQ......D.........TAVVM
d1sffa_ ..........GHVYRAL.........YPCPL........HGIS.E.....DDAIASIH...RIfkndaaPE......D.........IAAIV
d1svva_ ..........-VVTAPC.........PDG--........-KLR.V.....ADIESALH...EN......RS......Ehmvi.....PKLVY
d1tpla_ ..........-------.........-----........----.-.....--------...--......--......-.........-----
d1u08a_ ..........-VKRMAL.........QPP-H........FRVD.W.....QEFAALL-...--......SE......R.........TRLVI
d1uu1a_ ..........-FLEVPL.........TKD-L........RIPE.V.....N-------...--......VG......E.........GDVVF
d1v2da_ ..........-ARLVRLd........LTPEG........FRLD.L.....SALEKAL-...--......TP......R.........TRALL
d1v72a1 ..........-LMTVDG.........PAA--........-KLD.I.....VRLRERT-...--......RE......K.........VGDVH
d1vefa1 ..........PVEFIP-.........YN---........---D.V.....EALKRAV-...--......DE......E.........TAAVI
d1vp4a_ ..........-FVVVPL.........EDD--........-GMD.L.....NVLERKLS...EF......DK......Ngkikq....VKFIY
d1wyua1 ..........-LLTLPL.........EGGRT........PLPE.V.....--------...--......GE......E.........VGAVV
d1wyub1 ..........-VREIPS.........GPE--........GEVD.L.....EALKREL-...--......GP......H.........VAALM
d1xi9a_ ..........-PVEYRT.........IEEED........WQPD.I.....DDIRKKI-...--......TD......R.........TKAIA
d1yiza1 ..........-PRFIPL.........KPNKTggtissadWVLD.N.....NELEALF-...--......NE......K.........TKMII
d1z7da1 ..........-------.........-----........---D.L.....EALEEELK...--......DP......N.........VCAFI
d1zoda1 ..........-------.........-----........----.-.....--------...--......--......-.........-----
d2a7va1 ..........E--SMPYk........LNPKT........GLID.Y.....NQLALTAR...LF......RP......R.........LIIAG
d2aeua1 ..........-------.........-----........-YFE.S.....DKVGEILN...KI......DK......D.........TLVII
d2bkwa1 ..........-------.........-----........----.-.....--------...--......--......-.........-----
d2bwna1 ..........-----RI.........FRHND........VAHL.R.....ELIAADD-...--......PA......A.........PKLIA
d2c7ta_ ..........-PVFVDV.........EAD-T........YCID.P.....QLIKSAI-...--......TD......K.........TKAII
d2csta_ ..........DIRTYRY.........WDAAK........RGLD.L.....QGLLDDME...KA......PE......F.........SIFIL
d2ctza1 ..........-VRFTSR.........EER--........----.P.....EEFLALT-...--......DE......K.........TRAWW
d2cy8a_ ..........-------.........-----........---D.I.....EGMREVFA...NH......GS......D.........IAAFI
d2doub_ ..........-TFLIPL.........RED--........GLAD.L.....KAVPEGV-...--......WR......E.........AKVLL
d2dr1b_ ..........-AVVLEY.........EPG--........KAVK.P.....EDLDDALR...K-......NP......D.........VEAVT
d2e7ja1 ..........-IALVPK.........TDYPD........YAIT.P.....ENFAQTIE...E-......TK......K.........RGEVV
d2e7ua_ ..........KLTLVL-.........--E--........-YND.P.....EGLREVLK...RR......GE......E.........IAAII
d2fnua1 ..........-PVFAGI.........KND--........GNID.E.....LALEKLI-...--......NE......R.........TKAIV
d2gb3a1 ..........-LIPVTR.........RMEEG........FAI-.P.....QNLESFI-...--......NE......R.........TKGIV
d2gsaa_ ..........NTL----.........TT---........PYND.L.....EAVKALFA...EN......PG......E.........IAGVI
d2huib_ ..........-VRVVKS.........KVG--........QSLS.L.....DEIRDALL...--......IH......K.........PSVLF
d2o0ra1 ..........-RVTVPLv........PDGRG........FALD.A.....DALRRAV-...--......TP......R.........TRALI
d2o1ba_ ..........-PVPLNL.........EPP-H........YLPD.W.....SKVDSQI-...--......ID......K.........TKLIY
d2x5dd_ ..........-VRSVPL.........VPG--........-IDF.F.....NELERAIR...ES......IP......K.........PRMMI
d2z61a_ ..........-PVFCD-.........-----........--FT.V.....ESLEEAL-...--......SD......K.........TKAII
d2z67a1 ..........-MRLVETv........LDGDR........VYVP.V.....EDIENAIKkeiEL......GN......R.........PCVLS
d2zc0d_ ..........-IEGVPV.........DND--........-GMR.V.....DLLEEKIK...EL......KA......Kgqk......VKLIY
d3a2ba_ ..........-VIKYG-.........-----........-HNN.M.....EDLRAKLS...RL......PE......D.........SAKLI
d3aepa_ ..........-VDLID-.........-----........-TSD.V.....EKVKAAW-...--......KP......N.........TKMVY
d3asaa_ ..........EIIALPC.........LQENA........FFPE.F.....PE------...--......DT......H.........IDILC
d3bc8a1 ..........PVVIENV.........LEGDE........LRTD.L.....KAVEAKIQ...EL......GP......E.........HILCL
d3cq4b1 ..........-FIAVSR.........GAD--........FRID.M.....DVALEEIR...--......AK......Q.........PDIVF
d3drdb_ ..........-IPYVYRsesg.....DPDEC........RDQC.L.....RELAQLLE...EH......HE......E.........IAALS
d3dzza_ ..........-VISSDLi........YENSK........YSVN.W.....ADLEEKLA...--......TP......S.........VRMMV
d3e2fb_ ..........-PVFIPLrskptdgmkWTSSD........WTFD.P.....RELESKF-...--......SS......K.........TKAII
d3eucb1 ..........-FVGVPL.........RAD--........FTLD.R.....GAMLAAMA...--......EH......Q.........PAIVY
d3ezsb_ ..........-SLLMPL.........TKEND........FTPS.L.....NEKE----...--......LQ......E.........VDLVI
d3f0ha1 ..........-IPYVAL.........KLEHG........KKLT.K.....EKLYEYD-...--......NQ......N.........FTGLL
d3fdba1 ..........-GIFID-.........---AT........GGIN.L.....HDVEKGF-...--......QA......G.........ARSIL
d3ffhb1 ..........-VREIPL.........LQD--........GEHD.L.....EGMLNAI-...--......DE......K.........TTIVW
d3ffra1 ..........-------.........-----........----.-.....--------...--......--......-.........----I
d3fkdb_ ..........-VCFYPS.........NED-I........GEAD.F.....S-------...--......--......N.........MDFCW
d3ftba_ ..........-VVFSYL.........DEN--........MCID.Y.....EDIISKI-...--......-D......D.........VDSVI
d3getb_ ..........------C.........YKTQS........ITHN.L.....DEFKKLYE...TH......KD......E.........IKLIF
d3h14a1 ..........-PVDLPT.........APENR........LQPV.P.....ADFAGL--...--......--......D.........LAGLM
d3hdob_ ..........-VRTFGL.........TGD--........--FR.I.....AGFPERY-...--......--......E.........GKVFF
d3hl2a_ ..........PVVIENV.........LEGDE........LRTD.L.....KAVEAKVQ...EL......GP......D.........CILCI
d3i5tb_ ..........NPRHAGN.........RSQEA........FLDDlV.....QEFEDRIE...SL......GP......D.........TIAAF
d3jtxa1 ..........-IHFANC.........PAP-S........FNPD.W.....RSISEEV-...--......WK......R.........TKLVF
d3ju7a_ ..........-PYFIDI.........SID-D........WYMD.K.....TVLWDKIE...EL......KE......E.........VAIVV
d3k7ya_ ..........-LKYINF.........FDYNL........IDIN.Y.....DLFLNDLR...NI......PN......G.........SSVIL
d3l8ab_ ..........-LVENSLq........IINGR........FEID.F.....EQLEKDII...--......DN......N.........VKIYL
d3lg0d_ ..........-------.........-----........---D.L.....EALEKELQ...--......DP......N.........VCAFI
d3mebb_ ..........-YKEYTYl........RKDGE........LEID.F.....SNTKKDIQ...SA......PE......K.........SIFLF
d3n5mb1 ..........-------.........-----........----.-.....--------...--......--......-.........-----
d3ndnb_ ..........-TVFVD-.........-----........-GDD.L.....SQWERAL-...--......SV......P.........TQAVF
d3nx3b_ ..........GVKFA--.........-----........KYND.I.....SSVEKLV-...--......NE......K.........TCAII
d3nyuc_ ..........-PVYVDI.........DPR-T........YNLD.P.....QLLEAAI-...--......TP......R.........TKAII
d3p1ta_ ..........-HFEIGL.........TDD--........LLLD.P.....NDLAQVS-...--......--......R.........DDCVV
d3pdxa_ ..........-VKLYNL.........LPEKS........WEID.L.....KQLESLI-...--......DE......K.........TACLV
d3q8nd_ ..........VPTSYPFr........DGETD........GAAA.A.....AHALDLIN...KQvg....AD......N.........VAAVV
d3ri6a_ ..........-VRFVDV.........MDS--........----.-.....LAVEHAC-...--......DE......T.........TKLLF
d3t32a_ ..........-LCVSPLq........KQNDT........YAID.F.....EHLEKQF-...--......QQ......G.........VKLML
d3tqxb_ ..........-RYRYK-.........-NN--........---A.M.....GDLEAKLK...EA......DE......K.........GARFK
d3uwca_ ..........-PVLVD-.........-SENG........YVID.P.....EKIEAAI-...--......TD......K.........TKAIM
d4cvqa_ ..........-AVHYLC.........DESSD........WFPD.L.....DDIRAKI-...--......TP......R.........TRGIV
d4cxqb_ ..........-------.........-PA--........YSAA.F.....EAQLAQH-...-A......GE......L.........AAVVV
d4eb5b_ ..........-VEYIPV.........GKY--........GEVD.V.....SFIDQKL-...--......RD......D.........TILVS
d4f5kb1 ..........-VREYAY.........YDAEN........HTLD.F.....DALINSLN...EA......QA......G.........DVVLF
d4ge9a1 ..........-IINVAS.........DES--........-GIV.P.....DSLRDILS...RW......KP......EdaknpqkntPKFLY
d4grxc_ ..........CPHYWRY.........GEEGE........TEAQ.FvarlaRELEDTIT...RE......GA......D.........TIAGF
d4h51a_ ..........NICTYAY.........YDPKT........VSLN.F.....EGMKKDIL...AA......PD......G.........SVFIL
d4isyd1 ..........-VTWLPT.........AAD--........GSVS.A.....TALREALQ...S-......HD......D.........VALVS
d4ix8a_ ..........-CRYYYL.........DPSKS........WECD.L.....RAAAGMV-...--......DS......H.........TKAFV
d4lc3a_ ..........-PVFADI.........DPV-T........RNID.L.....DKLEQAI-...--......TP......R.........TKAII
d4lw2a_ ..........-VVKLPL.........NAQ--........RLPD.V.....DLLPELI-...--......TP......R.........SRILA
d4my5d_ ..........-VVEIDT.........RSN-D........FVLT.P.....EMLEEAIL...KE......GE......A.........LKAVI
d4oc9l_ ..........-AREFD-.........-----........-IDD.L.....DSLEKVI-...--......DQ......N.........TKAIF
d4piwb_ ..........-IVFVDV.........RPD-T........MNID.E.....TLIEAAI-...--......TD......K.........TRVIV
d4r5zd1 ..........-PIQVPL.........TDH--........-TFD.L.....YAMLATV-...--......TD......R.........TRLIF
d4rjyd_ ..........SIQPQPI.........DAAAD........GTLP.L.....DKVAMKI-...--......KPddihfaR.........TKLLS
d4u1tf_ ..........-GVRVRY.........AD---........-LTT.P.....EGIAAALA...--......EP......D.........LALVW
d4uhoa_ ..........-------.........-----........----.A.....NELLKLIE...LH......DAs.....N.........IAAVI
d4wbtb1 ..........-LVTVPY.........ADD--........-RED.L.....EGLLAAVG...--......RE......N.........APLVY
d4xaub1 ..........-ITWVDV.........DPA-T........LTMD.L.....DDLERKI-...--......SP......A.........TRAII
d4ysna1 syrtypgeteHDVSLRY.........FNE--........FKKP.F.....ESFLP---...--......AD......E.........TACVL
d4zm4a_ .......alaHTVQL--.........-----........GWND.P.....DALRELFA...RD......GD......R.........IAAVI
d5b89a1 ..........-LEFIEG.........DDE--........GNLD.L.....SDAEKKIK...--......--......G.........AKLVA
d5g0aa_ ..........-------.........-DENG........ELLS.V.....KYTRRMIE...NYg.....PE......Q.........VAAVI
d5i90a_ ..........-VREFPL.........FKD-P........HRVS.A.....DEILSSIAa..QI......RP......Q.........TRVLG
d5jaya1 ..........-VQIYP-.........-----........-HCD.T.....DALSAMLE...AS......DA......D.........VKVIV
d5lhaa_ ..........YRNPWDCr........DPQAL........TAHC.I.....RQLEEQIA...LL......GA......Q.........TIAAL
d5ti8a_ ..........YGEGGDM.........SAEEF........GVWA.A.....EQLEKKIL...EV......GE......E.........NVAAF
d5u23a1 ..........-PILIEP.........DIN-T........YNIN.P.....DLIEEKI-...--......TK......K.........TKAIM
d5uida_ ..........-PVFCDV.........DPA-T........LNPT.A.....DHVAEKL-...--......GP......R.........TKAVV
d5wt5a_ ..........-VTYLPI.........NEH--........GSIT.A.....EQVREAI-...--......TE......K.........TALVS


         190                   200                210             220        230         240        
           |                     |                  |               |          |           |        
d1ajsa_ ..HACA.......HNP..T..GT.DP.....T..PE.QW.KQIASVMKRR......FLFPFFDSAYQ.GFASGNLE..KDAWAIRYF.....
d1b9ha_ ..PVHM.......A--..-..G-.--.....L..MA.DM.DALAKISADT......GVPLLQDAAHA.HGA-----..---------.....
d1bs0a_ ..TEGV.......---..F..SM.DG.....D..SA.PL.AEIQQVTQQH......NGWLMVDDAHG.TGVIGE--..-QGRGSCWL.....
d1bt4a_ ..----.......---..-..--.--.....-..--.--.----------......-----------.--------..---------.....
d1bw0a_ ..VTNP.......SNP..C..GS.NF.....S..RK.HV.EDIVRLAEEL......RLPLFSDEIYA.GMVFKGKDpnATFTSVADF.....
d1c0na_ ..ITHV.......SNV..L..GT.E-.....-..-N.PL.AEMITLAHQH......GAKVLVDGAQA.VMH-----..-HPVDV---.....
d1c4ka2 ..----.......---..-..--.--.....-..--.--.----------......-----------.--------..---------.....
d1c7na_ ..FCSP.......HNP..V..GR.VW.....K..KD.EL.QKIKDIVLKS......DLMLWSDEIHF.DLIMPG--..YEHTVFQSI.....
d1cl1a_ ..LESP.......GS-..-..-I.TM.....E..VH.DV.PAIVAAVRSVvp....DAIIMIDNTW-.--------..---------.....
d1cs1a_ ..VESP.......SNP..-..--.LL.....R..VV.DI.AKICHLAREV......GAVSVVDNTFL.SPALQN--..---------.....
d1d2fa_ ..LCSP.......QNP..T..GK.VW.....T..CD.EL.EIMADLCERH......GVRVISDEIHM.DMVWGE--..QPHIPWSNV.....
d1dfoa_ ..GG-F.......S--..-..-A.YS.....G..VV.DW.AKMREIADSI......GAYLFVDMAHVaGLVAAGVY..PN-------.....
d1elua_ ..LSHL.......LWN..T..GQ.VL.....P..--.-L.AEIMAVCRRHqgny..PVRVLVDGAQS.--------..--AGSLPLD.....
d1fc4a_ ..IA-T.......DGV..F..SM.DG.....V..IA.NL.KGVCDLADKY......DALVMVDDSHA.VGFVGE--..NGRGSHEYC.....
d1fg7a_ ..VCSP.......NNP..T..GQ.LI.....N..PQ.DF.RTLLELTRG-......KAIVVADEAYI.EFC-----..-PQASLAGW.....
d1gdea_ ..INSP.......CNP..T..GA.VL.....T..KK.DL.EEIADFVVEH......DLIVISDEVYE.HFIYDD--..ARHYSIASL.....
d1h0ca_ ..LTHG.......ESS..T..GV.LQ.....P..--.-L.DGFGELCHRY......KCLLLVDSV--.--------..---------.....
d1iaya_ ..LTNP.......SNP..L..GT.TL.....D..KD.TL.KSVLSFTNQH......NIHLVCDEIYA.ATVFDT--..PQFVSIAEI.....
d1iuga_ ..LVHS.......ETS..T..GA.L-.....-..-A.DL.PALARAFKE-......-----------.--------..---------.....
d1jg8a_ ..IENT.......HNR..Sg.GR.VV.....P..LE.NI.KEICTIAKEH......GINVHIDGARI.FNA---SI..ASGVPVKEY.....
d1js3a_ pfFVVA.......TLG..T..TS.CC.....S..FD.NL.LEVGPICHEE......DIWLHVDAAYA.GSA-----..---------.....
d1lc5a_ ..LCTP.......NNP..T..GL.LP.....E..RP.LL.QAIADRCKSL......NINLILDEAFI.DFIPHE--..---TGFIPA.....
d1lk9a_ ..VTSP.......NNP..E..GL.L-.....-..--.-R.HAVIKGCKS-......----IYDMVYY.WPHYTP--..-----IKY-.....
d1m32a_ ..IAMV.......HSEttT..GM.L-.....-..-N.PI.DEVGALAHRY......GKTYIVDAM--.-SSFGGIP..MDI------.....
d1mdoa_ .pVHYA.......GAP..-..--.--.....-..-A.DL.DAIYALGERY......GIPVIEDAAHA.TGT-----..---------.....
d1n8pa_ ..IETP.......TNP..-..--.TL.....K..VT.DI.QKVADLIKKHaagq..DVILVVDNTFL.SPYISN--..---------.....
d1o4sa_ ..INSP.......NNP..T..GV.VY.....R..RE.FL.EGLVRLAKKR......NFYIISDEVYD.SLVYTD--..-EFTSILDV.....
d1o69a_ ..LTHL.......---..-..--.YG.....N..AA.KM.DEIVEICKEN......DIVLIEDAA--.--------..---------.....
d1ohwa_ ..VEPI.......QSE..G..GD.NHa....S..DD.FF.RKLRDISRKH......GCAFLVDEVQT.GGGSTG--..-KFWAHEHW.....
d1p3wa_ ..IMHV.......NNE..I..GV.V-.....-..-Q.DI.AAIGEMCRAR......GIIYHVDATQS.V---GK--..----LPID-.....
d1pmma_ ..PTFG.......VTY..T..GN.Y-.....-..-E.FP.QPLHDALDKFqadtgiDIDMHIDAASG.GFL-----..APFVAPDIV.....
d1qgna_ ..TESP.......TNP..-..--.FL.....R..CV.DI.ELVSKLCHEK......GALVCIDGTFA.TPL----N..QKAL-----.....
d1qisa_ ..HGFC.......HNP..T..GI.DP.....T..LE.QW.QTLAQLSVEK......GWLPLFDFAYQ.GFA-RGLE..EDAEGLRAF.....
d1qj5a_ ..----.......QGA..G..GMrMY.....H..PE.WL.KRIRKICDRE......GILLIADEIAT.GFGRTG--..-KLFACEHA.....
d1qz9a_ ..LTHV.......NYK..T..GY.M-.....-..-H.DM.QALTALSHEC......GALAIWDLAHS.--------..---------.....
d1sffa_ ..IEPV.......QGE..G..GF.YAs....S..PA.FM.QRLRALCDEH......GIMLIADEVQS.GAGRTG--..-TLFAM---.....
d1svva_ ..I-SN.......TTE..V..GT.QY.....T..KQ.EL.EDISASCKEH......GLYLFLDGARL.ASALSSPV..NDLTLADI-.....
d1tpla_ ..----.......---..-..--.--.....-..--.--.----------......-----------.--------..---------.....
d1u08a_ ..LNTP.......HNP..S..AT.VW.....Q..QA.DF.AALWQAIAGH......EIFVISDEVYE.HINFSQ--..QGHASVLAH.....
d1uu1a_ ..IPNP.......NNP..T..GH.VF.....E..RE.EI.ERILKT----......GAFVALDEAYY.EFH-GE--..----SYVDF.....
d1v2da_ ..LNTP.......MNP..T..GL.VF.....G..ER.EL.EAIARLARAH......DLFLISDEVYD.ELYYGE--..-RPRRLREF.....
d1v72a1 ..TTQPacvsitqATE..V..GS.IY.....T..LD.EI.EAIGDVCKSS......SLGLHMDGSRF.ANALVS--..-LGCSPAEM.....
d1vefa1 ..LEPV.......QGE..G..GV.RPa....T..PE.FL.RAAREITQEK......GALLILDEIQT.GMGRTG--..-KRFAFEHF.....
d1vp4a_ .vVSNF.......HNP..A..GV.TT.....S..LE.KR.KALVEIAEKY......DLFIVEDDPYG.ALRYEG--..ETVDPIFKI.....
d1wyua1 ..VQNP.......---..-..--.--.....-..--.--.----------......-----------.--------..---------.....
d1wyub1 ..LTNP.......NT-..-..-L.GL.....F..ER.RI.LEISRLCKEA......GVQLYYD----.-----GAN..LNAIMGWAR.....
d1xi9a_ ..VINP.......NNP..T..GA.LY.....D..KK.TL.EEILNIAGEY......EIPVISDEIYD.LMTYEG--..-EHISPGSL.....
d1yiza1 ..INTP.......HNP..L..GK.VM.....D..RA.EL.EVVANLCKKW......NVLCVSDEVYE.HMVFEP--..FEHIRICTL.....
d1z7da1 ..VEPI.......QGE..A..GViVP.....S..DN.YL.QGVYDICKKY......NVLFVADEVQT.GLGRTG--..-KLLCVHHY.....
d1zoda1 ..----.......---..-..--.--.....-..DG.YM.AALKRKCEAR......GMLLILDEAQT.GVGRTG--..-TMFAC---.....
d2a7va1 ..----.......---..T..SA.YA.....R..LI.DY.ARMREVCDEV......KAHLLADMAHI.SGLVAA--..KVIPS----.....
d2aeua1 ..----.......---..T..GS.TMdlkviE..LE.NF.KKVINTAKNK......EAIVFVDDASG.A-------..----RVRLL.....
d2bkwa1 ..----.......---..-..--.--.....-..--.--.----------......-----------.--------..---------.....
d2bwna1 ..FESV.......---..Y..SM.DG.....D..FG.PI.KEICDIAEEF......GALTYIDEVHA.VGMYGP--..-RGAGVAER.....
d2c7ta_ ..----.......--P..V..HL.FG.....S..MA.NM.DEINEIAQEH......NLFVIEDCAQS.H-------..---------.....
d2csta_ ..HACA.......HNP..T..GT.DP.....T..PD.EW.KQIAAVMKRR......CLFPFFDSAYQ.GFASGSLD..KDAWAVRYF.....
d2ctza1 ..VESI.......GNP..-..--.AL.....N..IP.DL.EALAQAAREK......GVALIVDNTFG.---MGG--..---YLLRPL.....
d2cy8a_ ..AEPV.......GSH..F..GV.TPv....S..DS.FL.REGAELARQY......GALFILDEVIS.GFRVGN--..---HGMQAL.....
d2doub_ ..LNYP.......NNP..T..GA.VA.....D..WG.YF.EEALGLARKH......GLWLIHDNPYV.DQVYEG--..-EAPSPLAL.....
d2dr1b_ ..ITYN.......ETS..T..GV.L-.....-..-N.PL.PELAKVAKEH......DKLVFVDAVSA.M---GG--..----ADIKF.....
d2e7ja1 ..LALI.......TYP..D..GN.YG.....N..LP.DV.KKIAKVCSEY......DVPLLVNGAYA.IGR-----..-MPVSL---.....
d2e7ua_ ..FEPVv......GN-..A..GV.LV.....P..TE.DF.LKALHEAKAY......GVLLIADEVMT.GFR-----..LAFGGATEL.....
d2fnua1 ..SVDY.......A--..-..--.-G.....K..SV.EV.ESVQKLCKKH......SLSFLSDSSH-.--------..---------.....
d2gb3a1 ..LSNP.......CNP..T..GV.VY.....G..KD.EM.RYLVEIAERH......GLFLIVDEVYS.EIVFRG--..-EFASALSI.....
d2gsaa_ .lEPIV.......GNS..G..FI.VP.....D..AG.FL.EGLREITLEH......DALLVFDEVMT.GFR-----..---IAYGGV.....
d2huib_ ..LTQG.......DSS..T..GV.LQ.....G..--.-L.EGVGALCHQH......NCLLIVDTV--.--------..---------.....
d2o0ra1 ..INSP.......HNP..T..GA.VL.....S..AT.EL.AAIAEIAVAA......NLVVITDEVYE.HLVFDH--..ARHLPLAGF.....
d2o1ba_ ..LTYP.......NNP..T..GS.TA.....T..KE.VF.DEAIAKFKGT......DTKIVHDFAYG.AFGFDA--..-KNPSILAS.....
d2x5dd_ ..LGFP.......SNP..T..AQ.CV.....E..LD.FF.ERVVALAKQY......DVMVVHDLAYA.DIVYDG--..WKAPSIMQV.....
d2z61a_ ..INSP.......SNP..L..GE.VI.....D..R-.--.-EIYEFAYEN......IPYIISDEIYN.GLVYEG--..-KCYSAIEF.....
d2z67a1 ..TLTF.......FPP..-..--.-R.....N..SD.DI.VEIAKICENY......DIPHIINGAYA.IQNNYYLE..KLKKAF---.....
d2zc0d_ .tIPTG.......QNP..M..GV.TM.....S..ME.RR.KALLEIASKY......DLLIIEDTAYN.FMRYEG--..GDIVPLKAL.....
d3a2ba_ ..C--T.......DGI..F..SM.EG.....D..IV.NL.PELTSIANEF......DAAVMVDDAHS.LGVIGH--..-KGAGTASH.....
d3aepa_ ..LESP.......ANP..T..CK.V-.....-..-S.DI.KGIAVVCHER......GARLVVDATFT.--------..-SPCFLKPL.....
d3asaa_ ..LCSP.......NNP..T..GT.VL.....N..KD.QL.RAIVHYAIEH......EILILFDAAYS.TFISDP--..SLPKSIFEI.....
d3bc8a1 ..HST-.......---..T..AC.FA.....PrvPD.RL.EELAVICANY......DIPHVVNNAYG.LQS-SK--..-CMHLIQQG.....
d3cq4b1 ..VTTP.......NNP..T..GD.VT.....S..LD.DV.ERIINVAPG-......--IVIVDEAYA.EFSP----..-SPSATTLL.....
d3drdb_ ..IESMv......QGA..S..GMiVM.....P..EG.YL.AGVRELCTTY......DVLMIVDEVAT.GFGRTG--..-KMFACEHE.....
d3dzza_ ..FCNP.......HNP..I..GY.AW.....S..EE.EV.KRIAELCAKH......QVLLISDEIHG.DLVLTD--..EDITPAFTVd....
d3e2fb_ ..LNTP.......HNP..L..GK.VY.....T..RQ.EL.QVIADLCVKH......DTLCISDEVYE.WLVYTG--..HTHVKIATL.....
d3eucb1 ..LAYP.......NNP..T..GN.LF.....D..AA.DM.EAIVRAAQGSvc....RSLVVVDEAYQ.PFAQES--..-----WMSR.....
d3ezsb_ ..LNSP.......NNP..T..GR.TL.....S..LE.EL.ISWVKLALKH......DFILINDECYS.EIY-EN--..TPPPSLLEAcmlag
d3f0ha1 ..VNVD.......ETS..T..AV.LY.....D..--.-T.MMIGEFCKKN......NMFFVCDCVSA.FLA-----..-DPF-----.....
d3fdba1 ..LCNP.......YNP..L..GM.VF.....A..PE.WL.NELCDLAHRY......DARVLVDEIHA.PLVFDG--..QHTVAAGVS.....
d3ffhb1 ..ICNP.......NNP..T..GN.YI.....E..LA.DI.QAFLDRVPS-......DVLVVLDEAYI.EYVTPQPE..KHEKLVRTY.....
d3ffra1 ..ICLT.......HNE..TssGV.SM.....P..VE.DI.NTFRDK--NK......DALIFVDAVSS.--------..---LPYPKF.....
d3fkdb_ ..LCNP.......NNP..D..GR.LL.....Q..R-.--.TEILRLLNDHp.....DTTFVLDQSYV.SFTTEE--..----VIRPAd....
d3ftba_ ..IGNP.......NNP..N..GG.LI.....N..KE.KF.IHVLKLAEEK......KKTIIIDEAFI.EFT-GD--..-PSSSFVGE.....
d3getb_ ..LCLP.......NNP..L..GE.CL.....D..AS.EA.TEFIKGVNE-......DCLVVIDAAYN.EFASFKDS..KKHLEPCEL.....
d3h14a1 ..VASP.......ANP..T..GT.ML.....D..HA.AM.GALIEAAQAQ......GASFISDEIYH.GIEYEA--..---KAVTAL.....
d3hdob_ ..LTTP.......NAP..L..GP.SF.....P..LE.YI.DELARRCAG-......--MLVLDETYA.EFAESN--..-----ALEL.....
d3hl2a_ ..H---.......-ST..T..SC.FA.....PrvPD.RL.EELAVICANY......DIPHIVNNAYG.VQS-SK--..-CMHLIQQG.....
d3i5tb_ ..LAEPi......LAS..G..GV.IIp....P..AG.YH.ARFKAICEKH......DILYISDEVVT.GFGRCG--..EWFASEKVF.....
d3jtxa1 ..VCSP.......NNP..S..GS.VL.....D..LD.GW.KEVFDLQDKY......GFIIASDECYS.EIYFDG--..NKPLGCLQA.....
d3ju7a_ ..-PYA.......T--..F..GS.WM.....N..LE.EY.EEL----EKK......GVPVVVDAAPG.FGLMNG--..----GMHYG.....
d3k7ya_ ..QISC.......YNP..C..SV.NI.....E..EK.YF.DEIIEIVLHK......KHVIIFDIAYQ.GFGHTNLE..EDVLLIRKF.....
d3l8ab_ ..LCSP.......HNP..G..GR.VW.....D..ND.DL.IKIAELCKKH......GVILVSDEIHQ.DLALFG--..NTHHSLNTLd....
d3lg0d_ ..VEPV.......QGE..A..GViVP.....S..DS.YF.PGVASLCKKY......NVLFVADEVQT.GLGRTG--..-KLLCTHHY.....
d3mebb_ ..HACA.......HNP..S..GI.DF.....T..EA.QW.KELLPIMKEK......KHIAFFDSAYQ.GFATGSFE..ADAFAVRMF.....
d3n5mb1 ..----.......---..-..--.-A.....P..QD.YM.KAVHETCQKH......GALLISDEVIC.GFGRTG--..-KAFGFMNY.....
d3ndnb_ ..FETP.......SNP..-..--.MQ.....S..LV.DI.AAVTELAHAA......GAKVVLDNVFA.TPLLQQ--..---------.....
d3nx3b_ ..LESV.......QGE..G..GI.NPa....N..KD.FY.KALRKLCDEK......DILLIADEIQC.GMGRSG--..-KFFAYEHA.....
d3nyuc_ ..----.......--P..V..SL.YG.....Q..CA.DF.DAINAIASKY......GIPVIEDAAQS.FGA-----..-SYKGKRSC.....
d3p1ta_ ..LANP.......SNP..T..GQ.AL.....S..AG.EL.DQLRQRAGK-......---LLIDETYV.DYS-----..----SFRARg....
d3pdxa_ ..VNNP.......SNP..C..GS.VF.....S..KR.HL.QKILAVAERQ......CVPILADEIYG.DMVFSD--..CKYEPMATL.....
d3q8nd_ ..IEPV.......HGE..G..GF.VVp....A..PG.FL.GALQKWCTDN......GAVFVADEVQT.GFARTG--..--ALFACEH.....
d3ri6a_ ..LETI.......SNP..-..--.QL.....Q..VA.DL.EALSKVVHAK......GIPLVVD----.--------..TTMTPPYLLe....
d3t32a_ ..LCSP.......HNP..I..GR.VW.....K..KE.EL.TKLGSLCTKY......NVIVVADEIHS.DIIYAD--..HTHTPFASLs....
d3tqxb_ ..LIAT.......DGV..F..SM.DG.....I..IA.DL.KSICDLADKY......NALVMVDDSHA.VGFIGE--..-NGRGTPEY.....
d3uwca_ ..PVHY.......---..-..--.TG.....N..IA.DM.PALAKIAKKH......NLHIVEDACQT.IL------..---------.....
d4cvqa_ ..IINP.......NNP..T..GA.VY.....S..KE.LL.MEIVEIARQH......NLIIFADEIYD.KILYDD--..AEHHSIAPL.....
d4cxqb_ ..EPVV.......QGA..G..GM.RFh....D..PR.YL.HDLRDICRRY......EVLLIFDEIAT.GFGRTG--..-ALFAADH-.....
d4eb5b_ ..VQHA.......NNE..I..GT.IQ.....P..VE.EI.SEVLAGKAAL......HIDATASVGQI.EVDVEK--..---------.....
d4f5kb1 ..HGCC.......HNP..T..GA.DP.....T..LE.QW.QTLAQLSVEK......GWLPLIDIAYQ.GFG-RGLE..EDAEGLRAF.....
d4ge9a1 .tVPNG.......NNP..T..GN.SL.....T..SE.RK.KEIYELARKY......DFLIIEDDPYY.FLQFNS--..GRVPTFLSM.....
d4grxc_ ..FAEPv......MGA..G..GV.IPp....A..KG.YF.QAILPILRKY......DIPMISDEVIC.GFGRTG--..-NTWGCLTY.....
d4h51a_ ..HQCA.......HNP..T..GV.DP.....S..QE.QW.NEIASLMLAK......HHQVFFDSAYQ.GYASGSLD..TDAYAARLF.....
d4isyd1 ..VMWA.......NNE..V..GT.IL.....P..--.-I.AEMSVVAMEF......GVPMHSDAIQA.--------..-VGQLPLDF.....
d4ix8a_ ..IINP.......SNP..C..GS.NF.....S..RA.HV.SDIIDFCQQH......QIPLISDEIYA.EMVLNN--..GIFTSVADF.....
d4lc3a_ ..PVFL.......SG-..-..--.--.....L..PV.DM.DRLYAIARAH......KLRVIEDAAQA.FGS-----..-TWHGKRIG.....
d4lw2a_ ..LGQM.......SNV..T..GG.CP.....D..--.-L.ARAITFAHSA......GMVVMVDGAQG.AVHFPA--..--------D.....
d4my5d_ ..LNYP.......TNP..T..GV.TY.....S..RQ.QI.KNLAEVLKKY......PIFVISDEVYA.ELTYTG--..ESHVSIAEY.....
d4oc9l_ ..FESL.......SNP..-..--.QI.....A..IA.DI.EKINQIAKKH......KIVSICDNT--.--------..-VATPFLLQ.....
d4piwb_ ..PVHY.......---..A..GV.A-.....-..-C.EM.DTIMALAKKH......NLFVVEDAAQG.VMSTYK--..--GRALGTI.....
d4r5zd1 ..VCNP.......NNP..T..ST.VV.....G..PD.AL.ARFVEAVPA-......HILIAIDEAYV.EYIRDG--..MRPDSLGLV.....
d4rjyd_ ..LENT.......HN-..-..GK.VL.....P..RE.YL.KEAWEFTRKR......NLALHVDGARI.FNA-----..----VVAYG.....
d4u1tf_ ..IETP.......TNP..-..--.LL.....T..VV.DV.AEVSRRAHER......GARVVVDNTFA.SPVLQQ--..---------.....
d4uhoa_ ..VEPM.......SGS..A..GViVP.....P..KG.YL.QRLREICDAN......DILLIFDEVIT.AFGRMG--..-KATGAEYF.....
d4wbtb1 ..LANP.......DNP..M..GS.WW.....P..AE.RV.VAFAQALPE-......TTLLVLDEAYC.ETAPRD--..-ALPPIESL.....
d4xaub1 ..VVHW.......---..T..GY.PV.....D..LD.RL.AGILDRAEREhgf...RPAVIEDCAHA.--------..---------.....
d4ysna1 ..IEPI.......QGD..G..GI.IK.....A..PE.EYmQLVYKFCHEH......GILFAIDEVNQ.GLGRTG--..-KMWAIQQF.....
d4zm4a_ ..VEPVl......ANA..G..VI.PP.....A..PG.FL.QLLRELTGRS......GAMLVFDEVIT.GFR-----..VARGGAQER.....
d5b89a1 ..VQHV.......SNA..L..GV.I-.....-..-H.EV.EELGKIAKDE......GAIFVVDAAQS.AGH-----..-----MEVN.....
d5g0aa_ ..TEVS.......QGA..G..SA.MP.....P..YE.YI.PQIRKMTKEL......GVLWINDEVLT.GFGRTG--..-KWFGYQHY.....
d5i90a_ ..MTWV.......QSG..S..GV.KL.....P..IR.EI.GKLVRELNQKrdeqd.RIIYVVDGVHG.FGV-ED--..---VSFADF.....
d5jaya1 ..SDTV.......---..F..SM.DG.....D..IA.PL.PRLLELAEQH......GAWLIVDDAHG.FGVLGPQG..RGAIAQAAL.....
d5lhaa_ ..IAEPv......QGA..G..GViVP.....P..AD.YW.PRLREVCDRH......GILLIADEVVT.GFGRSG--..-CMLGSRGW.....
d5ti8a_ ..IAEPi......QGA..G..GV.IV.....P..PDtYW.PKIREILAKY......EILFIADEVIC.GFGRTG--..-EWFGSQYY.....
d5u23a1 ..VVHL.......---..Y..GQ.VC.....D..--.-M.EKIQLLANKY......NLKIIEDCAQA.HGAIYK--..---------.....
d5uida_ ..VLHYg......GYP..-..--.--.....-..-G.DL.VAIAELCRER......GVPLVEDSACA.--------..---------.....
d5wt5a_ ..VMWA.......NNE..T..GL.IF.....P..--.-I.EEIGAICKEK......GVLFHTDAVQA.I---GK--..-IPVDVLKA.....


                   250            260         270                280                   290          
                     |              |           |                  |                     |          
d1ajsa_ VSEG.......FEL.FCAQSF....SKNF.GLY.NERVGNLTV........VAKEP.DSILR............VLSQMQKI...VRVTWSN
d1b9ha_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d1bs0a_ QKVK.......PEL.LVV-TF....GKGF.GVS.G---AAVLC........SSTVA.DYLLQ............FAR----H...LIYSTSM
d1bt4a_ ----.......---.------....----.---.---------........-----.-----............-----YVK...NNSLYNT
d1bw0a_ -ETT.......VPR.VILGGT....AKNL.VVP.GWRLGWLLYvdphgn..GPSFL.EGLKR............VGM-----...--LVCGP
d1c0na_ -QAL.......DCD.FYVFSG....HKLY.GPT.G--IGILYV........KEALL.QEMPP............WEGGGSMI...ATVSLSE
d1c4ka2 ----.......---.------....----.---.---------........-----.-----............--------...-------
d1c7na_ DEQLa......DKT.ITFTAP....SKTF.NIA.GMGMSNIIIk.......NPDIR.ERFTK............SRD-----...--ATSGM
d1cl1a_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d1cs1a_ PLAL.......GAD.LVLHSC....TKYL.NGH.SDVVAGVVIak......DPDVV.TELAW............WAN-----...--NIGVT
d1d2fa_ --AR.......GDW.ALLTSG....SKSF.NIP.ALTGAYGIIe.......NSSSR.DAYLSa...........LKG-----...-RDGLSS
d1dfoa_ -PVP.......HAH.VVTTTT....HKTL.--A.GPRGGLILA........KGGSE.ELYKK............LNS---AV...FPGGQGG
d1elua_ FSRL.......EVD.YYAFTG....HKWF.A-G.PAGVGGLYI........HGDCL.GEINP............TYVGWRSI...TYGAKGE
d1fc4a_ DVMG.......RVD.IITGTL....GKAL.G--.GASGGYTAA........RKEVV.EWLRQ............RSR-----...---PYLF
d1fg7a_ LAEY.......PHL.AILRTL....SKAF.ALA.GLRCGFTLA........NEEVI.NLLMK............VIA-----...----PYP
d1gdea_ DGMF.......ERT.ITVNGF....SKTF.AMT.GWRLGFVAA........PSWII.ERMVK............FQM-----...--YNATC
d1h0ca_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d1iaya_ LDEQemtycnkDLV.HIVYSL....SKDM.GLP.GFRVGIIYSf.......NDDVV.NCARK............MSS-----...----FGL
d1iuga_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d1jg8a_ AGYA.......DSV.MFC--L....SKGL.C--.-APVGSVVVg.......DRDFI.ERARK............ARK-----...--MLGGG
d1js3a_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d1lc5a_ LKDN.......PHI.WVLRSL....TKFY.AIP.GLRLGYLVN........SDDAA.MARMR............RQQ-----...---MPWS
d1lk9a_ --KA.......DED.ILLFTM....SKFT.GHS.GSRFGWALIk.......DESVY.NNLLN............YMT-----...--KNTEG
d1m32a_ -AAL.......HID.YLISSA....NKCIqGVP.G--FAFVIA........REQKL.AACKGhsrslsld....LYAQWRCMednHGKWRFT
d1mdoa_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d1n8pa_ PLNF.......GAD.IVVHSA....TKYInGHS.DVVLGVLATn.......NKPLY.ERLQF............LQN-----...--AIGAI
d1o4sa_ SEGF.......DRI.VYINGF....SKSH.SMT.GWRVGYLIS........SEKVA.TAVSK............IQS-----...--HTTSC
d1o69a_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d1ohwa_ --GL.......DDP.ADVMTF....SKKM.M--.---TGGFFH........KEEFR.P----............--------...-------
d1p3wa_ LSQL.......KVD.LMSFSG....HKIY.GPK.G--IGALYVrr......KPRVR.IEAQM............HGGGHERG...MRSGTLP
d1pmma_ WDFRl......PRV.KSISAS....GHKF.GLA.PLGCGWVIWrd......EEALP.QELVF............NVDYLGGQ...IGTFAIN
d1qgna_ --AL.......GAD.LVLHSA....TKFLgGHN.DVLAGCISG........PLKLV.SEIRN............LHH-----...--ILGGA
d1qisa_ AAMH.......KEL.IVASSY....SKNF.GLY.NERVGACTL........VAADS.ETVDR............AFSQMKAA...IRANYSN
d1qj5a_ -EIA.......PDI.LCL---....GKAL.TGG.TMTLSATLT........TREVA.ETISN............GEA-----...--GCFMH
d1qz9a_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d1sffa_ -EQM.......GVA.PDLTTF....AKSI.A-G.GFPLAGVTG........RAEVM.DAVAP............GGL-----...--GGTYA
d1svva_ -ARL.......TDM.FYI-GA....TKAG.GMF.G--------........-----.EALII............LNDALKPN...ARHLIKQ
d1tpla_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d1u08a_ PQLR.......ERA.VAVSSF....GKTY.HMT.GWKVGYCVA........PAPIS.AEIRK............VHQ-----...--YLTFS
d1uu1a_ LKKY.......ENL.AVIRTF....SKAF.SLA.AQRVGYVVA........SEKFI.DAYNR............VRL-----...----PFN
d1v2da_ --AP.......ERT.FTVGSA....GKRL.EAT.GYRVGWIVG........PKEFM.PRLAG............MRQ-----...--WTSFS
d1v72a1 TWKA.......GVD.ALSFGA....TKNG.VLA.AE--AIVLF........NTSLA.TEMSY............RRK-----...RAGHLSS
d1vefa1 -GIV.......PDI.LTL---....AKAL.G-G.GVPLGVAVM........REEVA.RSMPK............GGH-----...--GTTFG
d1vp4a_ -GGP.......ERV.VLLNTF....SKVL.A-P.GLRIGMVAG........SKEFI.RKIVQ............AKQ-----...--SADLC
d1wyua1 ----.......---.------....----.---.---------........-----.-----............--------...-------
d1wyub1 PGDM.......GFD.VVHLNL....HKTF.TVP.HGGGGPGSG........PVGVK.AHLAP............Y-------...-------
d1xi9a_ -TKD.......VPV.IVMNGL....SKVY.FAT.GWRLGYMYFvdpenk..LSEVR.EAIDR............LAR-----...---IRLC
d1yiza1 PGMW.......ERT.ITIGSA....GKTF.SLT.GWKIGWAYG........PEALL.KNLQM............VHQ-----...--NCVYT
d1z7da1 -NVK.......PDV.ILL---....GKAL.SGG.HYPISAVLA........NDDIM.LVIKP............GEH-----...--GSTYG
d1zoda1 -QRD.......GVT.PDILTL....SKTL.G-A.GLPLAAIVT........SAAIE.ERAHE............LGY-----...LFYTTHV
d2a7va1 -PFK.......HAD.IVTTTT....HKTL.R--.GARSGLIFY........RKGVK.AVDPKtgreipytfedrI---NFAV...FPSLQGG
d2aeua1 FNQPpalkl..GAD.LVVTST....DKLM.E--.GPRGGLLAG........KKELV.DKIYI............EGT-----...--KFGLE
d2bkwa1 ----.......---.------....----.---.---------........-----.-----............--------...-------
d2bwna1 DGLM.......HRIdIFNGTL....AKAY.GVF.G---GYIAA........SARMV.DAVRS............YAP-----...--GFIFS
d2c7ta_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d2csta_ VSEG.......FEL.FCAQSF....SKNF.GLY.NERVGNLSV........VGKDE.DNVQR............VLSQMEKI...VRTTWSN
d2ctza1 --AW.......GAA.LVTHSL....TKWV.GGH.GAVIAGAIV........DGG--.-----............--------...-------
d2cy8a_ LDVQ.......PDL.TCL---....AKAS.A-G.GLPGGILGG........REDVM.GVLSRgsdrk.......VLH-----...--QGTFT
d2doub_ PGAK.......ERV.VELFSL....SKSY.NLA.GFRLGFALG........SEEAL.ARLER............VKG-----...--VIDFN
d2dr1b_ -DKW.......GLD.VVFSSS....QKAF.GVPpGLAIGAFSE........--RFL.EIAEKmpergwyfdip.LYVKYLKEkesTPSTPPM
d2e7ja1 -KEI.......GAD.FIVGSG....HKSM.A-A.SGPIGVMGM........KEEWA.EIVLR............RSEKYKNK...E-VELLG
d2e7ua_ LGLK.......PDL.VTL---....GKIL.G-G.GLPAAAYAG........RREIM.EKVAPlgp.........VYQ-----...--AGTLS
d2fnua1 ----.......---.------....----.---.---------........-----.-----............--------...-------
d2gb3a1 --ES.......DKV.VVIDSV....SKKF.SAC.GARVGCLITr.......NEELI.SHAMK............LAQ-----...---GRLA
d2gsaa_ QEKF.......GVT.PDLTTL....GKII.G-G.GLPVGAYGG........KREIM.QLVAPagp.........MYQ-----...--AGTLS
d2huib_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d2o0ra1 DGMA.......ERT.ITISSA....AKMF.NCT.GWKIGWACG........PAELI.AGVRA............AKQ-----...--YLSYV
d2o1ba_ ENGK.......DVA.IEIYSL....SKGY.NMS.GFRVGFAVG........NKDMI.QALKK............YQT-----...--HTNAG
d2x5dd_ PGAK.......DIA.VEFFTL....SKSY.NMA.GWRIGFMVG........NPELV.SALAR............IKS-----...--YHDYG
d2z61a_ DENL.......EKT.ILINGF....SKLY.AMT.GWRIGYVIS........NDEII.EAILK............LQQ-----...--NLFIS
d2z67a1 --KY.......RVD.AVVSSS....DKNL.L-T.PIGGGLVYSt.......DAEFI.KEISL............SYP-----...----GRA
d2zc0d_ -DNE.......GRV.IVAGTL....SKVL.G-T.GFRIGWIIA........EGEIL.KKVLM............QKQ-----...--PIDFC
d3a2ba_ FGLNd......DVD.LIMGTF....SKSL.ASL.G---GFVAG........DADVI.DFLKH............NAR-----...--SVMFS
d3aepa_ --EL.......GAD.IALHSV....SKYI.NGH.GDVIGGVSS........-----.-----............--------...-------
d3asaa_ PDAR.......FCA.IEINSF....SKPL.GFA.GIRLGWTVI........PQELTyADGHF............VIQDWERF...LSTTFNG
d3bc8a1 ARVG.......RID.AFVQSL....DKNF.MVP.---VGGAIIagf.....NEPFI.QDISK............MYP-----...--GRASA
d3cq4b1 EKYP.......TKL.VVSRTM....SKAF.DFA.GGRLGYFVA........NPAFI.DAVML............VRL-----...----PYH
d3drdb_ -NVQ.......PDL.MAA---....GKGI.TGG.YLPIAVTFA........TEDIY.KAFYD............DYENLKTF...FHGHSYT
d3dzza_ WDAK.......NWV.VSLISP....SKTF.NLA.ALHAACAII........PNPDL.RARAEes..........FFL-----...--AGIGE
d3e2fb_ PGMW.......ERT.ITIGSA....GKTF.SVT.GWKLGWSIG........PAHLI.KHLQT............VQQ-----...--NSFYT
d3eucb1 LTDF.......GNL.LVMRTV....SK-L.GLA.GIRLGYVAG........DPQWL.EQLDK............VRP-----...----PYN
d3ezsb_ NEAF.......KNV.LVIHSL....SKRS.SAP.GLRSGFIAG........DSRLL.EKYKA............FRA-----...--YLGYT
d3f0ha1 ----.......---.------....----.---.---------........-----.-----............--------...-------
d3fdba1 DTAA.......SVC.ITITAP....SKAW.NIA.GLKCAQIIFs.......NPSDA.EHWQQ............LSP-----...--VIKDG
d3ffhb1 ----.......KNL.IITRTF....SKIY.GLA.SARVGYGIA........DKEII.RQLNI............VRP-----...----PFN
d3ffra1 -DWT.......KID.SVFFSV....QKCF.GLP.A-GLGVWIL........NDRVI.EKSKA............LLAKRKSI...GT-----
d3fkdb_ IKGR.......KNL.VMVYSF....SHAY.GIP.GLRIGYIVA........NKDFM.KRVAA............FST-----...----PWA
d3ftba_ IKNY.......SCL.FIIRAM....TKFF.AMP.GIRFGYGIT........NNKEI.AAKIK............AKQ-----...---NPWN
d3getb_ IKEF.......DNV.LYLGTF....SKLY.GLG.GLRIGYGIA........NANII.SAFYK............LRA-----...----PFN
d3h14a1 -ELT.......DEC.YVINSF....SKYF.SMT.GWRVGWMVV........PEDQV.RVVER............IAQ-----...--NMFIC
d3hdob_ VRRH.......ENV.VVTRTL....SKSY.SLA.GMRIGLAIA........RPEVI.AALDK............IRD-----...----HYN
d3hl2a_ ARVG.......RID.AFVQSL....DKNF.MVP.---VGGAIIagf.....NDSFI.QEISK............MYP-----...--GRASA
d3i5tb_ -GVV.......PDI.ITF---....AKGV.TSG.YVPLGGLAI........SEAVL.ARISG............ENAKGSWF...TNGYTYS
d3jtxa1 AAQLgrsr...QKL.LMFTSL....SKRS.NVP.GLRSGFVAG........DAELL.KNFLL............YRT-----...--YHGSA
d3ju7a_ QDFS.......GMI.IYSFHA....TKPF.G-I.G--EGGLIYsk......NEEDI.QRIKR............MGNFGFDT...-------
d3k7ya_ EEKN.......IAF.SVCQSF....SKNM.SLY.GERAGALHI........VCKNQ.EEKKI............VFNNLCFI...VRKFYSS
d3l8ab_ ASYK.......DFT.IILSSA....TKTF.NIA.GTKNSFAII........QNESL.RRKFQ............YRQ-----...LANNQHE
d3lg0d_ -GVK.......PDV.ILL---....GKAL.SGG.HYPISAILA........NDDVM.LVLKP............GEH-----...--GSTYG
d3mebb_ VDAG.......VEV.LVAQSF....SKNF.GLY.GERIGCLHVvhagvegsVEKNK.ALSAA............MVSGMTLQ...IRKTWSM
d3n5mb1 -DVK.......PDI.ITM---....AKGI.TSA.YLPLSATAV........KREIY.EAFKG............KGE-YEFF...RHINTFG
d3ndnb_ -GFPl......GVD.VVVYSG....TKHI.DGQ.GRVLGGAILg.......DREYI.DGPVQ............KLM-----...----RHT
d3nx3b_ -QIL.......PDI.MTS---....AKAL.G-C.GLSVGAFVI........NQKVA.SNSLE............AGD-----...-HGSTYG
d3nyuc_ ---N.......LST.VACTSFfp..SKPL.GCY.GDGGAIFTN........DDELA.TAIRQ............IAR-----...-------
d3p1ta_ LAYG.......ENE.LVFRSF....SKSY.GLA.GLRLGALFG........PSELI.AAMKR............KQW-----...----FCN
d3pdxa_ -STN.......VPI.LSCGGL....AKRW.LVP.GWRLGWILIhdrrdif.GNEIR.DGLVK............LSQ-----...---RILG
d3q8nd_ ENVV.......PDL.IVT---....AKGI.A-G.GLPLSAVTG........RAEIM.DGPQS............GGL-----...--GGTYG
d3ri6a_ AKRL.......GVD.IEVLSS....TKFI.SGG.GTSVGGVLI........DHGLF.EWKSL............--------...-------
d3t32a_ EELA.......ART.ITCMAP....SKTF.NIA.GLQASIIII........PNEKL.RQAFT............SIQ-----...YRQGFHG
d3tqxb_ CGVA.......DRVdILTGTL....GKAL.G--.GASGGYTSG........HKEII.EWLRN............RSR-----...---PYLF
d3uwca_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d4cvqa_ -APD.......LLT.ITFNGL....SKTY.RVA.GFRQGWMVLng......P--KK.HAKGY............IEG--LEM...LASMRLC
d4cxqb_ AGVS.......PDI.MCV---....GKAL.TGG.YLSLAATLC........TADVA.HTISA............GAA--GAL...MHGPTFM
d4eb5b_ ---I.......GAD.MLTISS....NDIY.GPK.G--VGALWI........RKEAK.LQPVI............LGGGQENG...LRSGSEN
d4f5kb1 AAMH.......KEL.IVASSC....SKNF.SLY.NERVGACTL........VAADS.ETVDR............AFGQMKAA...IRANYSN
d4ge9a1 -DVD.......GRV.IRADSF....SKII.S-S.GLRIGFLTG........PKPLI.ERVIL............HIQ-----...--VSTLH
d4grxc_ -DFM.......PDA.IIS---....SKNL.TAG.FFPMGAVIL........GPDLA.KRVEA............AVEAIEEF...PHGFTAS
d4h51a_ ARRG.......IEV.LLAQSF....SKNM.GLY.SERAGTLSL........LLKDK.TKRAD............VKSVMDSL...IREEYTC
d4isyd1 -GAS.......GLS.AMSVAG....HKFG.GPP.G--VGALLL........RRDVT.CVPLM............HGGGQERD...IRSGTPD
d4ix8a_ -DTN.......VPR.LILGGT....AKYQ.VCP.GWRVGWSIL........IDPMN.VAGDW............AVG--MER...LTQLIAG
d4lc3a_ ---A.......IGD.LVSFSF....HANK.NLT.TIEGGALVL........NNEDE.AVL--............--------...-------
d4lw2a_ VQQL.......DID.FYAFSG....HKLY.GPT.G--IGVLYG........KSELL.EAMSP............WLGGGKMV...HEVSFDG
d4my5d_ --LP.......DQT.ILISGL....SKSH.AMT.GWRLGLIFA........PAVLT.AQLIK............SHQ-----...--YLVTA
d4oc9l_ PFKH.......GVD.VIVHSL....SKYV.SGQ.GTALGGALI........ERKDL.NDLLK............NNDR----...--YKAFN
d4piwb_ ----.......-GH.IGCFSFhe..TKNY.TAG.GEGGATLIN........DKALI.ERAEI............IRE-----...-------
d4r5zd1 -RAH.......NNV.VVLRTF....SKAY.GLA.GLRIGYAIG........HPDVI.TALDK............VYV-----...----PFT
d4rjyd_ CELK.......EIT.QYCDSFticlSKGL.---.GTPVGSLLVg.......NRDYI.KRAIR............WRK-----...MTGGGMR
d4u1tf_ PLAL.......GAD.VSLYST....TKSIaGHA.DVLGGALVY........RDADL.HAAVR............AYR-----...----TTA
d4uhoa_ -GVT.......PDI.MNV---....AKQV.TNG.AVPMGAVIA........SSEIY.DTFMNqn..........LPEYAVEF...GHGYTYS
d4wbtb1 I-DK.......PNV.IRARTF....SKAY.GLA.GARIGYTLS........TPGTA.QAFDK............IRN-----...----HFG
d4xaub1 ----.......---.------....----.---.---------........-----.-----............--------...-------
d4ysna1 KDIE.......PDL.MSV---....GKSL.A-S.GMPLSAVIG........KKEVM.QSLDA............PAH-----...--LFTTA
d4zm4a_ YGVE.......PDL.TVL---....SRVM.G-G.GFPVAAFGG........RRHAM.RMLASne..........AHH-----...--AGVYA
d5b89a1 VKKL.......HAD.FLAFSG....HKGPmGPT.G--IGVLYI........REEFF.DTF--............--------...-------
d5g0aa_ -GVQ.......PDI.ITM---....GKGL.SSS.SLPAGAVLV........SKEIA.AFMDKhr..........WES-----...--VSTYA
d5i90a_ ----.......DCD.YFIAGT....HKWL.F-G.PRGTGVIIAr.......SEQLQ.EHLVP............SIPTFSRA...D-NFGTL
d5jaya1 --RS.......PNL.ISIGTL....DKAA.GVS.G---AFVAA........HETVI.EWLVQ............RAR--PYI...FTTASVP
d5lhaa_ -GVA.......PDI.LCL---....AKGI.TAG.YIPLGATLF........NQRIA.DAIEN............GQGFSHMI...MHGYTYS
d5ti8a_ -GNA.......PDL.MPI---....AKGL.TSG.YIPMGGVIV........RDEIV.DTLNEggef........YHG-----...--FTYSG
d5u23a1 ----.......---.------....DKRV.GNL.GDAAGFSFY........PGKNL.GALGD............--------...--AGCIC
d5uida_ ----.......---.------....----.---.---------........-----.-----............--------...-------
d5wt5a_ ----.......NAD.FLSFSA....HKFH.GPK.G--IGGLYI........RSGVG.LTPLF............HGGEHMNG...RRSGTLN


         300                                   310          320        330       340                
           |                                     |            |          |         |                
d1ajsa_ P.PAQ.................GAR..IV..ART.......LSDPE...LFHEWTGN.VKTMADRILSMRSELRARL....EALKTP.....
d1b9ha_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d1bs0a_ P.PAQ.................AQAlrAS..LAV.......IRS--...------DE.GDARREKLAALITRFRAGV....QDLP--.....
d1bt4a_ P.PSF.................GIY..MV..NEV.......LKWIE...E----RGG.LEGVQQANRKKASLIYDAI....DQSG--.....
d1bw0a_ C.TVV.................QAA..LG..EAL.......LNTP-...-----QEH.LDQIVAKIEESAMYLYNHI....GECIG-.....
d1c0na_ G.TTWtkapwrfeagtpntg..GII..GL..GAA.......LE---...-----YVS.ALGLNNIAEYEQNLMHYAL....SQLESV.....
d1c4ka2 -.---.................---..--..---.......-----...--------.-------------------....------.....
d1c7na_ PfTTL.................GYK..AC..EIC.......YKEC-...-----GKW.LDGCIKVIDKNQRIVKDFF....EVNHPE.....
d1cl1a_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d1cs1a_ G.GAF.................DSY..LL..LRG.......-----...-----LRT.LVPRMELAQRNAQAIVKYL....QTQ---.....
d1d2fa_ P.SVL.................ALT..AH..IAA.......YQQG-...-----APW.LDALRIYLKDNLTYIADKM....NAAFPE.....
d1dfoa_ P.LMH.................VIA..GK..AVA.......LKEAM...-----EPE.FKTYQQQVAKNAKAMVEVF....LERG--.....
d1elua_ P.TGWaeggkrfevatsayp..QYA..GL..LAA.......LQLHQ...R----QGT.AEERYQAICQRSEFLWRGL....NQLPHV.....
d1fc4a_ S.NSL.................APA..IV..AAS.......IKVLE...M----VEA.GSELRDRLWANARQFREQM....SAAG--.....
d1fg7a_ L.STP.................VAD..IA..AQA.......LSPQG...-----IVA.MRERVAQIIAEREYLIAAL....KEIPC-.....
d1gdea_ P.VTF.................IQY..AA..AKA.......LKDER...S----WKA.VEEMRKEYDRRRKLVWKRL....NEMG--.....
d1h0ca_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d1iaya_ V.STQ.................TQY..FL..AAM.......LSDEK...FV---DNF.LRESAMRLGKRHKHFTNGL....EVVG--.....
d1iuga_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d1jg8a_ M.RQA.................GVL..AA..AGI.......IAL--...------TK.MVDRLKEDHENARFLALKL....KEIG--.....
d1js3a_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d1lc5a_ V.NAL.................AAL..AG..EVA.......LQD--...-----SAW.QQATWHWLREEGARFYQAL....CQLP--.....
d1lk9a_ T.PRE.................TQL..RS..LKV.......LKEV-...-----VAM.VKTQKGTMRDLNTFGFKKL....RERWVN.....
d1m32a_ S.PTH.................TVL..AF..AQA.......LKELA...K----EGG.VAARHQRYQQNQRSLVAGM....RALGFN.....
d1mdoa_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d1n8pa_ P.SPF.................DAW..--..---.......-----...--------.-------------------....------.....
d1o4sa_ I.NTV.................AQY..AA..LKA.......LEVDN...--------.-SYMVQTFKERKNFVVERL....KKMG--.....
d1o69a_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d1ohwa_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d1p3wa_ V.HQI.................VGM..GE..AYR.......IA---...-----KEE.MATEMERLRGLRNRLWNGI....KDIE--.....
d1pmma_ F.SRPagq..............VIA..QY..YEF.......LRLG-...-----REG.YTKVQNASYQVAAYLADEI....AKLGP-.....
d1qgna_ L.NPN.................AAY..LI..IRG.......MKTLH...L-------.---RVQQQNSTALRMAEIL....EAH---.....
d1qisa_ P.PAH.................GAS..VV..ATI.......LSNDA...LRAIWEQE.LTDMRQRIQRMRQLFVNTL....QEKGAN.....
d1qj5a_ G.PTFmgnplaca.........AAN..AS..LAI.......LES--...-----GDW.QQQVADIEVQLREQLAPAR....DAEMVA.....
d1qz9a_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d1sffa_ G.NPI.................ACV..AA..LEV.......LK---...-----VFE.QENLLQKANDLGQKLKDGL....LAIAEK.....
d1svva_ R.GAL.................MAK..GW..LLG.......IQFEV...LMK--DNL.FFELGAHSNKMAAILKAGL....EACG--.....
d1tpla_ -.---.................---..--..---.......LR---...-----EAM.QYEYIEHRVKQVRYLGDKL....KAAG--.....
d1u08a_ V.NTP.................AQL..AL..ADM.......LRAE-...-----PEH.YLALPDFYRQKRDILVNAL....NESR--.....
d1uu1a_ V.SYV.................SQM..FA..KVA.......LDH--...-----REI.FEERTKFIVEERERMKSAL....REMGY-.....
d1v2da_ A.PTP.................LQA..GV..AEA.......LKLAR...R----EGF.YEALREGYRRRRDLLAGGL....RAMG--.....
d1v72a1 K.MRF.................LSA..QI..DAY.......LTD--...------DL.WLRNARKANAAAQRLAQGL....EGLGG-.....
d1vefa1 G.NPL.................AMA..AG..VAA.......IR---...-----YLE.RTRLWERAAELGPWFMEKL....RAIP--.....
d1vp4a_ S.PAI.................THR..LA..ARY.......LERYD...L----LEQ.LKPTIELYRRKRTVMLNAL....EEYFSDi....
d1wyua1 -.---.................---..--..---.......-----...--------.-------------------....------.....
d1wyub1 -.---.................---..--..---.......-----...--------.-------------------....------.....
d1xi9a_ P.NTP.................AQF..AA..IAG.......LTGP-...-----MDY.LKEYMKKLKERRDYIYKRL....NEIPG-.....
d1yiza1 C.ATP.................IQE..AI..AVG.......FETELk..RLKSPECY.FNSISGELMAKRDYMASFL....AEVG--.....
d1z7da1 G.NPL.................AAS..IC..VEA.......LN---...-----VLI.NEKLCENAEKLGGPFLENL....KREL--.....
d1zoda1 S.DPL.................PAA..VG..LRV.......LD---...-----VVQ.RDGLVARANVMGDRLRRGL....LDLM--.....
d2a7va1 P.HNH.................AIA..AV..AVA.......LKQA-...CTPMFREY.SLQVLKNARAMADALLE--....--RG--.....
d2aeua1 A.QPP.................LLA..GI..YRA.......LKNFN...L-------.-------------------....------.....
d2bkwa1 -.---.................---..--..---.......-----...--------.-------------------....------.....
d2bwna1 T.SLPpaiaa............GAQ..AS..IAF.......LK---...-----TAE.GQKLRDAQQMHAKVLKMRL....KALG--.....
d2c7ta_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d2csta_ P.PSQ.................GAR..IV..ATT.......LTSPQ...LFAEWKDN.VKTMADRVLLMRSELRSRL....ESLGTP.....
d2ctza1 -.---.................---..--..---.......-----...--------.-------------------....------.....
d2cy8a_ G.NPI.................TAA..AA..IAA.......IDTIL...E----DDV.CAKINDLGQFAREAMNHLF....ARKGLN.....
d2doub_ Q.YAG.................VLR..MG..VEA.......LKTP-...-----KEV.VRGYARVYRERALGMAEAL....KGV---.....
d2dr1b_ P.QVF.................GIN..VA..LRI.......IEK--...-----MGG.KEKWLEMYEKRAKMVREGV....REIG--.....
d2e7ja1 C.TAR.................GAT..II..TLM.......ASFPHvreRIKRWDEE.VEKARRFAAEMEKLGIKQL....GDNPHN.....
d2e7ua_ G.NPL.................AMA..AG..LAT.......LEL--...-----LEE.NPGYYAYLEDLGARLEAGL....KEVLKE.....
d2fnua1 -.---.................---..--..---.......-----...--------.-------------------....------.....
d2gb3a1 P.PLL.................EQI..GS..VGL.......LNLD-...-----DSF.FDFVRETYRERVETVLKKL....EEHGL-.....
d2gsaa_ G.NPL.................AMT..AG..IKT.......LE---...-----LLR.QPGTYEYLDQITKRLSDGL....LAIAQEt....
d2huib_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d2o0ra1 G.GAP.................FQP..AV..ALA.......LDTE-...-----DAW.VAALRNSLRARRDRLAAGL....TEIG--.....
d2o1ba_ M.FGA.................LQD..AA..IYA.......LNHY-...-----DDF.LEEQSNVFKTRRDRFEAML....AKAD--.....
d2x5dd_ T.FTP.................LQV..AA..IAA.......LEGD-...-----QQC.VRDIARQYQQRRDVLVKGL....REAG--.....
d2z61a_ A.PTI.................SQY..AA..LKA.......FEKET...-----ERE.INSMIKEFDRRRRLVLKYV....KDFG--.....
d2z67a1 S.ATP.................VVN..TL..VSL.......LSMG-...-----SKN.YLELVKNQKNSKKLLDELL....N-----.....
d2zc0d_ A.PAI.................SQY..IA..LEY.......LKRGY...FE---KYH.LEGALLGYKEKRDIMLKAL....ENHLPN.....
d3a2ba_ A.SMT.................PAS..VA..STL.......KALEI...-----IQN.EPEHIEKLWKNTDYAKAQL....LDHG--.....
d3aepa_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d3asaa_ A.SIP.................AQE..AG..VAG.......LS---...-----ILP.QLEAIHYYRENSDLLRKAL....LATG--.....
d3bc8a1 S.PSL.................DVL..IT..LLS.......LGCSG...YRKL-LKE.RKEMFVYLSTQLKKLAEAH....NE----.....
d3cq4b1 L.SAL.................SQA..AA..IVA.......LRH--...-----SAD.TLGTVEKLSVERVRVAARL....EELG--.....
d3drdb_ G.NQL.................GCA..VA..LEN.......LA---...-----LFE.SENIVEQVAEKSKKLHFLL....QDLH--.....
d3dzza_ P.NLL.................AIP..AA..IAA.......YEEG-...-----HDW.LRELKQVLRDNFAYAREFL....AKEVPE.....
d3e2fb_ C.ATP.................LQA..AL..AEAfwidikrMDDP-...-----ECY.FNSLPKELEVKRDRMVRLL....NSVG--.....
d3eucb1 V.NVL.................TEA..TA..LFA.......LEH--...-----VAV.LDEQAAQLRAERSRVAEGM....AAHGG-.....
d3ezsb_ S.ANA.................IQK..AS..EAA.......WLD--...-----DRH.AEFFRNIYANNLKLARKIF....KNTLI-.....
d3f0ha1 -.---.................---..--..---.......-----...--------.-------------------....------.....
d3fdba1 A.STL.................GLI..AA..EAA.......YRYG-...-----TDF.LNQEVAYLKNNHDFLLHEI....PKRIPG.....
d3ffhb1 T.TSI.................GQK..LA..IEA.......IKDQA...F----IGE.CRTSNANGIKQYEAFAKRF....EKVK--.....
d3ffra1 -.---.................---..--..---.......-----...--------.-------------------....------.....
d3fkdb_ V.NAL.................AIE..AA..KFI.......LIHP-...-----AQF.TLPIRKWQRNTVDFI-TAL....NRLDG-.....
d3ftba_ I.NCF.................AEM..AA..INC.......LKD--...-----TNY.IEESLLWIKKERKRFIEEL....NKIGF-.....
d3getb_ V.SNL.................ALK..AA..VAA.......MDD--...-----DEF.TEKTLENNFSQMELYKEFA....KKHN--.....
d3h14a1 A.PHA.................SQV..AA..LAA.......LDC--...-----DAE.LQANLDVYKANRKLMLERL....PKAGF-.....
d3hdob_ L.DRL.................AQA..AC..VAA.......LRD--...-----QAY.LSECCRRIRETREWFTTEL....RSIG--.....
d3hl2a_ S.PSL.................DVL..IT..LLS.......LGSNG...YKK-LLKE.RKEMFSYLSNQIKKLSEAY....NERLL-.....
d3i5tb_ N.QPV.................ACA..AA..LAN.......IE---...-----LME.REGIVDQAREMADYFAAAL....ASLR--.....
d3jtxa1 M.SIP.................VQR..AS..IAA.......WDD--...-----EQH.VIDNRRLYQEKFERVIPIL....QQV---.....
d3ju7a_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d3k7ya_ P.VIH.................TNR..IL..CQL.......LNNQN...LKLNWIKE.LSQLSQRITNNRILFFNKLetyqKKYNLN.....
d3l8ab_ V.PTV.................GMI..AT..QAA.......FQYG-...-----KPW.LEELKTVIEGNIKLVIKEL....EAKTK-.....
d3lg0d_ G.NPL.................AAA..IC..VEA.......LK---...-----VLI.NEKLCENADKLGAPFLQNL....KEQL--.....
d3mebb_ S.AIH.................GAY..IV..QVI.......VHDKR...LLQMFYDN.VKEMSARIHRMRSLLHASL....AKRKTPgpgsk
d3n5mb1 G.NPA.................ACA..LA..LKN.......LE---...-----IIE.NENLIERSAQMGSLLLEQL....KEEIGE.....
d3ndnb_ G.PAM.................SAF..NA..WVL.......LKG--...-----LET.LAIRVQHSNASAQRIAEFL....NGHPSV.....
d3nx3b_ G.NPL.................VCA..GV..NAV.......FE---...-----IFK.EEKILENVNKLTPYLEQSL....DELINE.....
d3nyuc_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d3p1ta_ V.GTL.................DLH..AL..EAA.......LDN--...-----DRA.REAHIAKTLAQRRRVADAL....RGLG--.....
d3pdxa_ P.CTI.................VQG..AL..KSI.......LQRTP...-----QEF.YQDTLSFLKSNADLCYGAL....SAIPG-.....
d3q8nd_ G.NPL.................ACA..AA..LAV.......ID---...-----TIE.RENLVARARAIGETMLSRL....GALAAA.....
d3ri6a_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d3t32a_ L.NIF.................AYT..AM..QSA.......YTEC-...-----NDW.LNEIRFYIEDNAKFACEYI....KDHIPT.....
d3tqxb_ S.NTV.................APV..IV..ATS.......LKVLE...LL---KTE.GPQLRKQLQENSRYFRAGM....EKLG--.....
d3uwca_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d4cvqa_ A.NVP.................AQH..AI..QTA.......LGGYQ...S----ISE.FITPGGRLYEQRNRAWELI....NDIPG-.....
d4cxqb_ A.NPL.................ACA..VS..VAS.......-----...--------.-------------------....------.....
d4eb5b_ V.PSI.................VGF..GK..AAE.......ITAM-...-------E.WREEAERLRRLRDRIIDNVlkieESYLN-.....
d4f5kb1 P.PAH.................GAS..VV..ATI.......LSNDA...LRAIWEQE.LTDMRQRIQRMRQLFVNTL....QEKGAN.....
d4ge9a1 P.STF.................NQL..MI..SQL.......LHE-W...GEEGFMAH.VDRVIDFYSNQKDAILAAA....DKWLT-.....
d4grxc_ G.HPV.................GCA..IA..LKA.......ID---...-----VVM.NEGLAENVRRLAPRFEAGL....KRIAD-.....
d4h51a_ P.PAH.................GAR..LA..HLI.......LSNNE...LRKEWEAE.LSAMAERIRTMRRTVYDEL....LRLQTP.....
d4isyd1 V.ASA.................VGM..AT..AAQ.......IA---...-----VDG.LEENSARLRLLRDRLVEGV....LAEIDDvclng
d4ix8a_ V.NSI.................CQE..AI..ART.......LLKCP...-----TEC.TEHIVTQLEAGAKVYARLL....EHDIG-.....
d4lc3a_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d4lw2a_ F.TTQsapwkleagtpnvagviGLS..AA..LEW.......LA---...-----DYD.INQAESWSRSLATLAEDAL....AKRPGF.....
d4my5d_ A.TTS.................VQF..AA..IEA.......LTNG-...-----KDD.ALPMKEEYIKRRDYIIEKM....EAMK--.....
d4oc9l_ T.PDP.................SY-..--..---.......-----...--------.-------------------....------.....
d4piwb_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d4r5zd1 V.SSI.................GQA..AA..IAS.......LDA--...-----ADE.LLARTDTVVAERARVSAEL....RAAG--.....
d4rjyd_ Q.SGI.................LAA..AG..MYA.......LKNN-...-----VAR.LQEDHDNTAWMAEQLREAG....ADVM--.....
d4u1tf_ G.NVP.................GAL..DC..FLV.......RRG--...-----LHT.LSLRVHRQVATARVLVERL....RASPVV.....
d4uhoa_ A.HPV.................ACA..AG..IAA.......LDL--...------LQ.KENLIQQSAELAPHFEKAL....HGLKGT.....
d4wbtb1 M.SRI.................GVA..AA..IAA.......LAD--...-----QDY.LKEVTLKIANSRQRIGRIA....ADSGL-.....
d4xaub1 -.---.................---..--..---.......-----...--------.-------------------....------.....
d4ysna1 G.NPV.................CSA..AS..LAT.......LDVIE...Y----EGL.VEKSATDGAYAKQRFLEMQ....QRHPMI.....
d4zm4a_ G.NHA.................ALR..AV..VAM.......LGK--...-----IRS.LPDLYERLEDTGQYMEDTV....REVFAT.....
d5b89a1 -.---.................---..--..---.......-----...--------.-------------------....------.....
d5g0aa_ G.HPV.................AMA..AV..CAN.......LEV-M...MEENFVEQ.AKDSGEYIRSKLELLQEKH....KSIGNF.....
d5i90a_ M.TPG.................GYH..AF..EHR.......LALGT...AFELHLQLgKAEVQARIHQLNAYLKQRL....GEHPKV.....
d5jaya1 A.AAH.................AVS..AS..LRI.......IG---...-----GEE.GDARRAHLQQLIGRTRAML....KATPW-.....
d5lhaa_ G.HPT.................ACA..AA..LAV.......LD---...-----IVE.AEDLPGNAAKVGAQLLEQL....QPLV--.....
d5ti8a_ H.PVA.................AAV..ALenIRI.......LRE--...-----EKI.VETVKAETAPYLQKRWQEL....ADHPLV.....
d5u23a1 T.NDD.................NFA..SK..IRA.......LANYG...SHKKYENL.YTGLNSRLDEIQAAFLDIK....LKY---.....
d5uida_ -.---.................---..--..---.......-----...--------.-------------------....------.....
d5wt5a_ V.PYI.................VGM..GE..AMK.......LA---...-----VEH.LDYEKEVVGKLRDKLEEAL....LKIPDVmvv..


        350                 360                                             370            380      
          |                   |                                               |              |      
d1ajsa_ GTWNH..I.TDQI.......GMFSFTGLN...........................P...........KQVEYLINQKH.....IYLLP.SG
d1b9ha_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1bs0a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1bt4a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1bw0a_ --LAP..T.MPRG.......AMYLMSRIDlekyrdikt..................Dv..........EFFEKLLEEEN.....VQVLP.GT
d1c0na_ PDLTL..Y.GPQ-.......ARLGVIAFNlga........................Hha.........YDVGSFLDNYG.....IAVRT.GH
d1c4ka2 -----..-.----.......---------...........................-...........-----------.....-----.--
d1c7na_ --IKA..P.LIEG.......TYLQWIDFRalkm.......................Dhk.........AMEEFMIHKAQ.....IFFDE.GY
d1cl1a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1cs1a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1d2fa_ --LNW..Q.IPQS.......TYLAWLDLR...........................Plniddn.....ALQKALIEQEK.....VAIMP.GY
d1dfoa_ --YKV..V.----.......---------...........................-...........-----------.....-----.--
d1elua_ HCLAT..S.APQA.......GLVSFTVDS...........................Plgh........RAIVQKLEEQR.....IYLRT.IA
d1fc4a_ --FTL..A.GADH.......AIIPVMLG-...........................Davva.......QKFARELQKEG.....IYVTG.FF
d1fg7a_ --VEQ..V.FDSE.......TNYILARFK...........................As..........SAVFKSLWDQG.....IILRD.QN
d1gdea_ --LPT..V.KPKG.......AFYIFPRIR...........................Dtgltsk.....KFSELMLKEAR.....VAVVP.GS
d1h0ca_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1iaya_ --IKC..L.KNNA.......GLFCWMDLR...........................PllrestfdsemSLWRVIINDVK.....LNVSP.GS
d1iuga_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1jg8a_ --YSV..NpEDVK.......TNMVILRTD...........................Nlkvna......HGFIEALRNSG.....VLANA.VS
d1js3a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1lc5a_ --LLT..V.YPGR.......ANYLLLRCE...........................Red.........IDLQRRLLTQR.....ILIRS.CA
d1lk9a_ --ITA..L.LDQS.......DRFSYQELPqseycnyfrrmrppspsyawvkceweeD...........KDCYQTFQNGR.....INTQN.GV
d1m32a_ TLLDDelH.SPII.......TAFYSPEDP...........................Qyrf........SEFYRRLKEQG.....FVIYP.GK
d1mdoa_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1n8pa_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1o4sa_ --VKF..V.EPEG.......AFYLFFKVR...........................Gddv........KFCERLLEEKK.....VALVP.GS
d1o69a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1ohwa_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1p3wa_ -----..-.----.......---------...........................-...........----------E.....VYLNG.DL
d1pmma_ --YEF..-.----.......---------...........................-...........-----------.....-----.--
d1qgna_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1qisa_ RDFSF..I.IKQN.......GMFSFSGLT...........................K...........EQVLRLREEFG.....VYAVA.SG
d1qj5a_ D-VRV..L.---G.......AIGVVETTH...........................Pvnm........AALQKFFVEQG.....VWIRP.FG
d1qz9a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d1sffa_ --HPE..I.GDVR.......GLGAMIAIElfedgdhnkp.................Daklta......EIVARARDK-G.....LILLS.CG
d1svva_ --IRL..A.WPSA.......SNQLFPILE...........................N...........TMIAELNNDFD.....MYTV-.--
d1tpla_ --VPI..V.EPVG.......GHAVFLDARrfcehltq...................Defpaq......SLAASIYVETG.....VR---.--
d1u08a_ --LEI..L.PCEG.......TYFLLVDYSavstl......................Ddv.........EFCQWLTQEHG.....VAAIP.LS
d1uu1a_ ---R-..I.TDSR.......GNFVFVFME...........................Keek........ERLLEHLRTKN.....VAVRS.F-
d1v2da_ --LRV..Y.VPEG.......TYFLMAELP...........................G...........WDAFRLVEEAR.....VALIP.AS
d1v72a1 --VEV..L.GGTE.......ANILFCRLD...........................S...........AMIDALLKA--.....-----.GF
d1vefa1 --SPK..I.REVR.......GMGLMVGLElk.........................Ekaa........PYIARLEKEHR.....VLALQ.AG
d1vp4a_ PGVKW..V.KSEG.......GLFIWLTLP...........................Egfdt.......WEMFEYAKRKK.....VFYVP.GR
d1wyua1 -----..-.----.......---------...........................-...........-----------.....-----.--
d1wyub1 -----..-.----.......---------...........................-...........-----------.....-----.--
d1xi9a_ --IST..T.KPQG.......AFYIFPKIEvgpwkn.....................Dk..........EFVLDVLHNAH.....VLFVH.GS
d1yiza1 --MNP..T.VPQG.......GYFMVADWSsldskvdltqet...............Darkdy......RFTKWMTKSVG.....LQGIP.PS
d1z7da1 -----..-.----.......---------...........................-...........-----------.....-----.--
d1zoda1 ERFDC..I.GDVR.......GRGLLLGVEivkdrrtkepa................Dglgakit....RECMNLGLSMN.....IVQLP.GM
d2a7va1 -----..-.----.......---------...........................-...........-----------.....-----.--
d2aeua1 -----..-.----.......---------...........................-...........-----------.....-----.--
d2bkwa1 --QPF..V.LAGS.......GTLGWDIFA...........................S...........NFILSKAPNKN.....VLVVS.TG
d2bwna1 --MPI..I.-DHG.......SHIVPVVIG...........................Dpvhtk......AVSDMLLSDYG.....VYVQP.IN
d2c7ta_ -----..-.----.......---------...........................-...........-----------.....-----.--
d2csta_ GTWNH..I.TDQI.......GMFSFTGLN...........................P...........KQVEYMIKEKH.....IYLMA.SG
d2ctza1 -----..-.----.......---------...........................-...........-----------.....-----.--
d2cy8a_ --WLA..Y.GRFS.......GFHLMPGLP...........................P...........N----------.....-----.--
d2doub_ --LSL..L.PPRA.......TMYLWGRLP...........................Egvddl......EFGLRLVER-G.....VALAP.GR
d2dr1b_ --LDI..L.AEPGhesptitAVLTPPGIK...........................G...........DEVYEAMRKRG.....FELAK.GY
d2e7ja1 -----..-.----.......---------...........................-...........-----------.....-----.--
d2e7ua_ KGLPH..T.VNRV.......GSMITVFFTegpvvtfq...................Darrtdtelf..KRFFHGLLDRG.....IYWPP.SN
d2fnua1 -----..-.----.......---------...........................-...........-----------.....-----.--
d2gb3a1 --KRF..T.KPSG.......AFYITAELPveda.......................E...........EFARWMLTDFNmdgetTMVAP.LR
d2gsaa_ GHAAC..G.GQVS.......GMFGFFFTEgpvhnyedak.................Ksdlqkf.....SRFHRGMLEQG.....IYLAP.S-
d2huib_ -----..-.----.......---------...........................-...........-----------.....-----.--
d2o0ra1 --FAV..H.DSYG.......TYFLCADPR...........................Plgyddst....EFCAALPEKVG.....VAAIP.MS
d2o1ba_ --LPF..V.HAKG.......GIYVWLETP...........................Pgydse......QFEQFLVQEKS.....ILVAP.GK
d2x5dd_ --WMV..E.NPKA.......SMYVWAKIP...........................Epyahlgsl...EFAKKLLQDAK.....VSVSP.GI
d2z61a_ --WEV..N.NPIG.......AYYVFPNIG...........................Edgr........EFAYKLLKEKF.....VALTP.GI
d2z67a1 -----..-.----.......---------...........................-...........-----------.....-----.--
d2zc0d_ --AEF..T.KPIA.......GMFVMFFLP...........................Egadgi......SFANELMEREG.....VVVVP.GK
d3a2ba_ --FDLg.A.TESP.......ILPIFIRSN...........................Ekt.........FWVTKMLQDDG.....VFVNP.VV
d3aepa_ -----..-.----.......---------...........................-...........-----------.....-----.--
d3asaa_ --FEV..F.GGEH.......APYLWVKPTqanis......................Dr..........DLFDFFLREYH.....IAITP.GI
d3bc8a1 -----..-.----.......---------...........................-...........-----------.....-----.--
d3cq4b1 --YAV..V.PSES.......NFVFFGDFS...........................Dq..........HAAWQAFLDRG.....VLIRD.VG
d3drdb_ -----..-.----.......---------...........................-...........-----------.....-----.--
d3dzza_ --VKV..L.DSNA.......SYLAWVDISalgmna.....................E...........DFCKYLREKTG.....LIISA.GN
d3e2fb_ --LKP..I.VPDG.......GYFIIADVSslgadlsdmns................Depydy......KFVKWMTKHKK.....LTAIP.VS
d3eucb1 --VTV..F.-PSA.......ANFLLARVP...........................Da..........AQTFDRLLARK.....VLIKN.VS
d3ezsb_ --YPY..-.----.......SFYVYLPVQng.........................E...........NFAKTLYQNEG.....IITLP.AL
d3f0ha1 -----..-.----.......---------...........................-...........-----------.....-----.--
d3fdba1 --AKI..T.PMQA.......TYLMWIDFR...........................Dttieg......SPSEFFIEKAK.....VAMND.GA
d3ffhb1 ----L..Y.-PAN.......GNFVLIDLGi..........................Ea..........GTIFSYLEKNG.....YITRS.GA
d3ffra1 -----..-.----.......---------...........................-...........-----------.....-----.--
d3fkdb_ --VEV..H.-PSG.......TTFFLLRLK...........................Kgtaa.......ELKKYMLEEYN.....MLIRD.AS
d3ftba_ --IKR..V.FSPH.......ANFVLCRLE...........................Nisg........EKLYDSLLKED.....IVIRR.CC
d3getb_ --IKI..I.-DSY.......TNFITYFFD...........................Ekns........TDLSEKLLKKG.....IIIRN.LK
d3h14a1 --TRI..A.PPDG.......AFYVYADVS...........................Dltddsr.....AFAAEILEKAG.....VAVTP.GL
d3hdob_ --YDV..I.-PSQ.......GNYLFATPP...........................Drdg........KRVYDGLYARK.....VLVRH.FS
d3hl2a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d3i5tb_ -----..-.----.......---------...........................-...........-----------.....-----.--
d3jtxa1 --FDV..K.LPDA.......SFYIWLKVP...........................Dgddl.......AFARNLWQKAA.....IQVLP.GR
d3ju7a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d3k7ya_ YDWNV..Y.KKQR.......GLFSFVPLL...........................A...........KIA-EHLKTHH.....IYIIN.NG
d3l8ab_ --IKV..M.EPEG.......TYLVWLDFSayaiaq.....................P...........QLSEKLQNEAK.....VVLND.GA
d3lg0d_ -----..-.----.......---------...........................-...........-----------.....-----.--
d3mebb_ GTWDH..I.LTAI.......GMFTFTGLT...........................P...........EHVDYLKEKWS.....IYLVKaGG
d3n5mb1 --HPL..V.GDIR.......GKGLLVGIElvndketkepi................Dndki.......ASVVNACKEKG.....LIIGR.NG
d3ndnb_ RWV--..-.----.......---------...........................-...........-----------.....-----.--
d3nx3b_ --FDF..C.KKRK.......GLGFMQGLSl..........................Dksvkv......AKVIQKCQENA.....LLLIS.CG
d3nyuc_ -----..-.----.......---------...........................-...........-----------.....-----.--
d3p1ta_ --YRV..A.-SSE.......ANFVLVENA...........................Ag..........ERTLRFLRERG.....IQVKD.AG
d3pdxa_ --LQP..V.RPSG.......AMYLMVGIEmehfpef....................Endv........EFTERLIAEQS.....VHCLP.AT
d3q8nd_ --DPR..I.GEVR.......GRGAMIAVElvkpgttep..................Dadlt.......KRVAAAAHAQG.....LVVLT.CG
d3ri6a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d3t32a_ --LSV..M.KPEG.......SFLLWIDCSalnlsq.....................D...........ERTKLLEEKGK.....IIVEP.GE
d3tqxb_ --FQL..V.PGN-.......HPIIPVMLG...........................Daqla.......TNMADHLLQEG.....IYVVG.FS
d3uwca_ -----..-.----.......---------...........................-...........-----------.....-----.--
d4cvqa_ --VSC..V.KPRG.......ALYMFPKIDakrfnih....................Ddq.........KMVLDFLLQEK.....VLLVQ.GT
d4cxqb_ -----..-.----.......---------...........................-...........-----------.....-----.--
d4eb5b_ GHPEK..R.LPNN.......VNVRFSYIE...........................G...........ESIVLSLDMAG.....IQAST.GS
d4f5kb1 RDFSF..I.IKQN.......GMFSFSGLT...........................K...........EQVLRLREEFG.....VYAVA.SG
d4ge9a1 GLAEW..H.VPAA.......GMFLWIKVK...........................Gindvk......ELIEEKAVKMG.....VLMLP.GN
d4grxc_ --RPN..I.GEYR.......GIGFMW---...........................-...........-----------.....-----.--
d4h51a_ GSWEH..V.INQI.......GMFSFLGLS...........................K...........AQCEYC-QNHN.....IFITV.SG
d4isyd1 ADDPM..R.LAGN.......AHFTFRGCE...........................G...........DALLMLLDANG.....IECST.GS
d4ix8a_ --ISM..E.APQA.......SMFVMLKLNlsyfqdlks..................Dm..........EFYEKLLDEEN.....VQVLP.GE
d4lc3a_ -----..-.----.......---------...........................-...........-----------.....-----.--
d4lw2a_ RSFRC..Q.DSSL.......LAFDFAGVH...........................H...........SDMVTLLAEYG.....IALRA.GQ
d4my5d_ --FKI..I.KPDG.......AFYIFAKIPvaqgq......................Dsf.........KFLQDFAKEKA.....VAFIP.GV
d4oc9l_ -----..-.----.......---------...........................-...........-----------.....-----.--
d4piwb_ -----..-.----.......---------...........................-...........-----------.....-----.--
d4r5zd1 --FTL..P.-PSQ.......ANFVWLPLG...........................Srt.........QDFVEQAADAR.....IVVRP.YG
d4rjyd_ -----..-.-RQD.......TNMLFVRVG...........................Eena........AALGEYMKARN.....VLINA.S-
d4u1tf_ GA---..-.----.......---------...........................-...........-----------.....-----.--
d4uhoa_ K----..-.----.......---------...........................-...........-----------.....-----.--
d4wbtb1 ---AP..L.-PSA.......TNFVAVDCG...........................Kdasyar.....AIVDRLMSDHG.....IFIRM.PG
d4xaub1 -----..-.----.......---------...........................-...........-----------.....-----.--
d4ysna1 GDVRM..W.GLNG.......GIELVKDPKtkep.......................Dsdaa.......TKVIYYAFAHG.....VVIIT.LA
d4zm4a_ EKRPV..H.INRV.......GTLMSVALLkgsaepsaeprdlrqlaalv.......Dfprh.......RRLQTLAQKEG.....VYFHP.N-
d5b89a1 -----..-.----.......---------...........................-...........-----------.....-----.--
d5g0aa_ DGY--..-.----.......GLLWIVDIVnaktktpyvkldrnfthgmn.......Pnqipt......QIIMKKALEKG.....VLIGG.VM
d5i90a_ RLVTP..-.----.......---------...........................-...........-----------.....-----.--
d5jaya1 --LPV..D.----.......---------...........................-...........-----------.....-----.--
d5lhaa_ ERYAV..V.GEVR.......GKGLMIALDlvsdkrtrqpldpaagq..........P...........SRIADEARRAG.....VLVRP.IG
d5ti8a_ GEARG..V.GMV-.......---------...........................-...........-----------.....-----.--
d5u23a1 -----..-.----.......---------...........................-...........-----------.....-----.--
d5uida_ -----..-.----.......---------...........................-...........-----------.....-----.--
d5wt5a_ GDRIH..R.VPNT.......TLVSVRGIE...........................G...........EAMLWDLNRSN.....IAAST.GS


                390                    400           410                                            
                  |                      |             |                                            
d1ajsa_ RINM......C...........GL..TTKNLDYVA....TSIHEAVTKI-q.........................................
d1b9ha_ ----......-...........--..---------....-----------rwqgkrvgeldsiatfsfqngklmtageggavvfpdgeteky
d1bs0a_ ----......-...........--..---------....-----------ftladscsaiqplivgdnsralqlaeklrqqgcwvtairppt
d1bt4a_ ----......-...........--..---------....-----------gfyrgcvdvdsrsdmnitfrlaseelekefvkaseqegfvgl
d1bw0a_ IFHA......-...........-P..GFTRLTTTRpv..EVYREAVERIKafcqrhaa..................................
d1c0na_ HCAM......P...........LM..AYYNVP---....-----------amcraslamyntheevdrlvtglqrihrllg...........
d1c4ka2 ----......-...........--..---------....-----------pygfiggiydsdfdekkirelaakvdperakwkrpfrlaviq
d1c7na_ IFGD......G...........GI..GFERINLAAps..SVIQESLERL-nkalkdlk..................................
d1cl1a_ ----......-...........--..---------....-----------aagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcw
d1cs1a_ ----......-...........--..---------....-----------plvkklyhpslpenqgheiaarqqkgfgamlsfeldgdeqtl
d1d2fa_ TYGE......E...........GR..GFVRLNAGCpr..SKLEKGV----aglinairavr...............................
d1dfoa_ ----......-...........--..---------....-----------sggtdnhlflvdlvdknltgkeadaalgranitvnknsvpnd
d1elua_ D---......-...........-P..DCIRACCHYitdeEEINHLLARL-adfgp.....................................
d1fc4a_ YPVVp.....K...........GQ..ARIRTQMSAahtpEQITRAVE---aftrigkqlgvia.............................
d1fg7a_ K-QP......S...........LS..GCLRITVGTr...EESQRVIDAL-raeqv.....................................
d1gdea_ AFGK......A...........GE..GYVRISYATay..EKLEEAMDRM-ervlkerklv................................
d1h0ca_ ----......-...........--..---------....-----------aslggtplymdrqgidilysgsqkalnappgtslisfsdkak
d1iaya_ SFEC......Q...........EP..GWFRVCFANmdd.GTVDIALARI-rrfvgvek..................................
d1iuga_ ----......-...........--..---------....-----------knpeglvgadmvtsllvgevaleamgvdaaasgsqkglmcpp
d1jg8a_ ----......-...........--..---------....-----------dteirlvthkdvsrndieealnifeklfrkfs..........
d1js3a_ ----......-...........--..---------....-----------ficpefrhllngvefadsfnfnphkwllvnfdcsamwvkrrt
d1lc5a_ NYPG......L...........DS..RYYRVAIRSa...AQNERLLAAL-rnvl......................................
d1lk9a_ GFEA......S...........-S..RYVRLSLIKtq..DDFD-------qlmyylkdmvkak.............................
d1m32a_ VSQS......D...........CF..RIGNIGEVYa...ADIT-------alltairtamywt.............................
d1mdoa_ ----......-...........--..---------....-----------sykgrhigargtaifsfhaiknitcaeggivvtdnpqfadkl
d1n8pa_ ----......-...........--..---------....-----------lthrglktlhlrvrqaalsankiaeflaadkenvvavnypgl
d1o4sa_ AFLK......-...........-P..GFVRLSFATsi..ERLTEALDRI-edflns....................................
d1o69a_ ----......-...........--..---------....-----------ealgsfyknkalgtfgefgvysyngnkiittsgggmligknk
d1ohwa_ ----......-...........--..---------....-----------napyrifntwlgdpsknlllaeviniikredllsnaahagkv
d1p3wa_ EHGA......-...........-P..NILNVSFNYveg.ESLIM------alkdlavssgsactsaslepsyvlralglndelahssirfsl
d1pmma_ ----......-...........--..---------....-----------ictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvp
d1qgna_ ----......-...........--..---------....-----------pkvrhvyypglqshpehhiakkqmtgfggavsfevdgdlltt
d1qisa_ RVNV......A...........GM..TPDNMAPLC....EAIVAVL----..........................................
d1qj5a_ K---......-...........--..---------....-----------liylmppyiilpqqlqrltaavnravqdetffcq........
d1qz9a_ ----......-...........--..---------....-----------agavpvdlhqagadyaigctykylnggpgsqafvwvspqlcd
d1sffa_ PY--......-...........-Y..NVLRILVPLtiedAQIRQGLEI--isqcfdeakq................................
d1svva_ ----......-...........--..---------....-----------eplkdgtcimrlctswateekechrfvevlkrl.........
d1tpla_ ----......-...........--..---------....-----------smergiisagrnnvtgehhrpkletvrltiprrvytyahmdv
d1u08a_ VFCAdp....F...........PH..KLIRLCFAKke..STLLAAAERL-rql.......................................
d1uu1a_ ----......-...........-R..EGVRITIGKr...EENDMILREL-evfk......................................
d1v2da_ AFYL......E...........DPpkDLFRFAFCKte..EELHLALERL-grvv......................................
d1v72a1 GFYHdr....W...........GP..NVVRFV---....-----------tsfattaedvdhllnqvrlaa.....................
d1vefa1 ----......-...........-P..TVIRFLPPLviekEDLERVV----eavravla..................................
d1vp4a_ VFKVyd....E...........PS..PSMRLSFCLppd.EKIVEGIKRL-revvleygkekhll............................
d1wyua1 ----......-...........--..---------....-----------nflgaledlgpfaeaahgagalfvavadplslgvlkppgayg
d1wyub1 ----......-...........--..---------....-----------lpvplvergeegfyldfdrpksigrvrsfygnflalvraway
d1xi9a_ GFGE......Y...........GA..GHFRAVFLPpi..EILEEAMDRF-ekfmker...................................
d1yiza1 AFYSepnkh.L...........GE..DFVRYCFFKkd..ENLQKAAEIL-rkwkgss...................................
d1z7da1 ----......-...........--..---------....-----------kdskivrdvrgkgllcaiefknelvnvldiclklkenglitr
d1zoda1 ----......-...........-G..GVFRIAPPL....-----------tvsedeidlglsllgqaieral....................
d2a7va1 ----......-...........--..---------....-----------yslvsggtdnhlvlvdlrpkgldgaraervlelvsitanknt
d2aeua1 ----......-...........--..---------....-----------erirkaferaknfdlskieklnkelkaiddninivyertptg
d2bkwa1 TFSD......R...........FA..DCLR-----....-----------sygaqvdvvrplkigesvpleliteklsqnsygavtvthvdt
d2bwna1 FPTVp.....R...........GT..ERLRFTPS-....-----------pvhdlkqidglvhamdllw.......................
d2c7ta_ ----......-...........--..---------....-----------gsvwnnqragtigdigafscqqgkvltageggiivtknprlf
d2csta_ RINM......C...........GL..TTKNLDYVA....KSIHEAVTKI-q.........................................
d2ctza1 ----......-...........--..---------....-----------nfpweggryplltepqpgyhglrlteafgelafivkarvdgl
d2cy8a_ ----......-...........--..---------....-----------ttdtgsitraevarpdvkmiaamrmalilegvdiggrgsvfl
d2doub_ GFGP......G...........GK..GFVRIALVRpl..EELLEAAKRI-real......................................
d2dr1b_ GSVK......-...........-E..KTFRIGHMGymkfEDIQEML----dnlrevinelkkqkgi..........................
d2e7ja1 ----......-...........--..---------....-----------hdlmffhaevlyeiskkakggrfflyrelksrkihgikpglt
d2e7ua_ ----......-...........--..---------....-----------feaaflsvahreedvektlealrkal................
d2fnua1 ----......-...........--..---------....-----------algseyqnkkvggfalasvfsfhaikpittaeggavvtndse
d2gb3a1 GFYLtpg...L...........GK..KEIRIACVLek..DLLSRAID---vlmeglkmfcs...............................
d2gsaa_ ----......-...........--..---------....-----------qfeagftslahteedidatlaaartvmsal............
d2huib_ ----......-...........--..---------....-----------aslggapmfmdrweidamytgsqkvlgappgitpvsfshrav
d2o0ra1 AFCD......PaagqasqqadvWN..HLVRFTFCKrd..DTLDEAIRRL-svlae.....................................
d2o1ba_ PFGE......N...........GN..RYVRISLALdd..QKLDEAAIR--ltelaylye.................................
d2x5dd_ GFGD......Y...........GD..DHVRFALIEnr..DRLRQAVRGI-kamfradgl.................................
d2z61a_ GFGS......K...........GK..NYIRISYANsy..ENIKEGLERIKefln......................................
d2z67a1 ----......-...........--..---------....-----------dlskktggkfldvespiascisvnsdpveiaaklynlrvtgp
d2zc0d_ PFYTde....S...........GK..NAIRLNFSRpsk.EEIPIGIK---klaklykekf................................
d3a2ba_ SPAVp.....A...........EE..SLIRFSLMAthtyDQIDEAIEK--mvkvfkqa..................................
d3aepa_ ----......-...........--..---------....-----------aktaediatikfyrkdagslmapmdaflcargmktlpirmqi
d3asaa_ GFGR......S...........GS..GFVRFSSLGkr..EDILAACERL-qm........................................
d3bc8a1 ----......-...........--..---------....-----------rllqtphnpislamtlktidghhdkavtqlgsmlftrqvsga
d3cq4b1 I---......-...........-A..GHLRTTIGVp...EENDAFLD---aaaeiiklnl................................
d3drdb_ ----......-...........--..---------....-----------alphvgdirqlgfmcgaelvrsketkepypadrrigykvslk
d3dzza_ GYRG......N...........GH..EFVRINLACpk..ELVIDGMQRLKqgvlnln...................................
d3e2fb_ AFCDskskp.H...........FE..KLVRFCFIKk...DSTLDAAE---eifrawn...................................
d3eucb1 KMHP......L...........LA..NCLRVTVSTp...EENAQFLEA--faaslq....................................
d3ezsb_ YLGRnr....I...........GA..DYVRLALVYdt..PLLEKPLEII-etyrenh...................................
d3f0ha1 ----......-...........--..---------....-----------nmnecgadvmitgsqkvlacppgisvivlaprgvervekskv
d3fdba1 WFGE......D...........GT..GFCRLNFATsr..EVLEEAIDRM-akavshht..................................
d3ffhb1 ALGF......-...........-P..TAVRITIGKe...EDNSAVIALL-ekll......................................
d3ffra1 ----......-...........--..---------....-----------yhtipsmlekarvnqtpetpnamnifllgkvtgdmlqisadg
d3fkdb_ NFRG......L...........DE..SYVRITTQRp...AQNQLFI----kaletflek.................................
d3ftba_ NFIG......L...........DD..SFVRFAIKDe...KKNTKFLRAL-kgvennl...................................
d3getb_ SYG-......-...........-L..NAIRITIGTs...YENEKF-----ftefdkilr.................................
d3h14a1 DFDPe.....R...........GA..GTLRFSYARat..ADIEEGLDRL-eafmqar...................................
d3hdob_ DPLL......-...........-A..HGMRISIGTr...EEMEQTLAAL-keig......................................
d3hl2a_ ----......-...........--..---------....-----------htphnpislamtlktldehrdkavtqlgsmlftrqvsgarvv
d3i5tb_ ----......-...........--..---------....-----------dlpgvaetrsvglvgcvqclldptradgtaedkaftlkider
d3jtxa1 FLAR......Dteqgnp.....GE..GYVRIALVAdv..ATCVKAA----edivslyr..................................
d3ju7a_ ----......-...........--..---------....-----------nrectmmgfnckmseyaaaigiatmkkwddklkertrisewy
d3k7ya_ RINV......S...........GI..TKNNVDYIA....DKIC-------lslsqi....................................
d3l8ab_ HFGK......E...........GK..YFARLNVATpk..NTVQEALSRI-isvfgk....................................
d3lg0d_ ----......-...........--..---------....-----------kdskvvrevrgkgllcaiefkndlvnvwdiclkfkenglitr
d3mebb_ RMSM......C...........GL..TESNCDYVA....EAIHDAVTKL-pfk.......................................
d3n5mb1 MTTA......G...........--..---------....-----------ynniltlapplvisseeiafvigtlktameri..........
d3ndnb_ ----......-...........--..---------....-----------rypylpshpqydlakrqmsgggtvvtfaldcpedvakqrafe
d3nx3b_ ----......-...........-E..NDLRFLPPLilqkEHIDEM-----seklrkalksf...............................
d3nyuc_ ----......-...........--..---------....-----------hgqdrryhhirvgvnsrldtlqaaillpkleifeeeialrqk
d3p1ta_ QFGL......-...........-H..HHIRISIGRe...EDNDRLLAAL-aeysd.....................................
d3pdxa_ CFEY......-...........-P..NFFRVVITVpe..VMMLEACSRI-qefceqhy..................................
d3q8nd_ TYG-......-...........--..---------....-----------nvlrflpplsmpdhlldegldilaavfaevk...........
d3ri6a_ ----......-...........--..---------....-----------pslapyyakagpmaflykarkevfqnlgpslsphnaylqslg
d3t32a_ KYGL......G...........GE..EHIGINIGCpr..SVLEEILNRL-rhtfs.....................................
d3tqxb_ YPVVp.....M...........GK..ARIRVQMSAvhtqQQLDRAIEA--fgqvgkklgai...............................
d3uwca_ ----......-...........--..---------....-----------grindkfvgswgqfacfslhplknlnvwsdagviithsdeya
d4cvqa_ AFNW......P...........WP..DHFRIVTLPrv..DDIE-------lslskfarflsgyhq...........................
d4cxqb_ ----......-...........--..---------....-----------velllgqdwrtritelaagltagldtaralpavtdvrvcgai
d4eb5b_ AC--......-...........--..---------....-----------ssktlqpshvlmacglkheeahgtllltlgryntdedvdrll
d4f5kb1 RINV......A...........GM..TPDNMAPLC....EAIVAVL----..........................................
d4ge9a1 AFYVdss...A...........PS..PYLRASFSSasp.EQMDVAFQVL-aqlikesl..................................
d4grxc_ ----......-...........--..---------....-----------aleavkdkptktpfdanlsvseriantctdlglicrplgqsi
d4h51a_ RANM......A...........GL..THE------....-----------talmlaqtindavr............................
d4isyd1 ACTAgv....A...........QP..SHVLIAMG-....-----------vdaasargslrlslghtsveadvdaalevlpgavararraal
d4ix8a_ IFGM......-...........-S..GFLRATVSRps..AVLNEAVDRI-iefcerhkk.................................
d4lc3a_ ----......-...........--..---------....-----------aqkyrlqgitrtgfdgmdcdvlggkynltdvaarvglgqlph
d4lw2a_ HCAQpllaelG...........VT..GTLRASFAP....-----------yntksdvdalvnavdralellv....................
d4my5d_ AFGK......Y...........GE..GYLRISYAAsm..ETIKEAMKRLKefme......................................
d4oc9l_ ----......-...........--..---------....-----------hglnlntldlpifsirviitwlrdlgaslapqnawlllqgle
d4piwb_ ----......-...........--..---------....-----------kgtnrsqffrgqvdkytwrdigssylmsdlqaaylwaqleaa
d4r5zd1 ----......-...........-T..DGVRVTVAAp...EENDAFLR---farrwrsdq.................................
d4rjyd_ ----......-...........--..---------....-----------pivrlvthldvsraqlaevaahwrafla..............
d4u1tf_ ----......-...........--..---------....-----------vhypglpehpqhavvkaqmsapgaivsfdylggpaerlldrf
d4uhoa_ ----......-...........--..---------....-----------nvidirncglagaiqiaardgdaivrpfeasmklwkegfyvr
d4wbtb1 VAPL......-...........-N..RCIRISTAPdaemD----------llaaalpevirsla............................
d4xaub1 ----......-...........--..---------....-----------wgasyrgvplgshgnmcvfsfqalkhltcgdgglltlpgdel
d4ysna1 ----......-...........-G..NILRFQPPLviprEQLDQALQVL-ddaftavengevtip...........................
d4zm4a_ ----......-...........--..---------....-----------alepwflstahtrdvidkvagalqrslvgl............
d5b89a1 ----......-...........--..---------....-----------eppligggtiedvsldgykltepperfeagtpniggaiglaa
d5g0aa_ ----......-...........-P..NTMRIGASLnvsrGDIDKAMDAL-dyaldylesgewq.............................
d5i90a_ ----......-...........--..---------....-----------tspelssgftffrvegrdceavakhlmahrvisdavdrdvgp
d5jaya1 ----......-...........--..---------....-----------shtavqpliigandatleiaatldraglwvpairpptvptgt
d5lhaa_ N---......-...........--..---------....-----------kiilsppltltrdeaglmvsaleaafarcg............
d5ti8a_ ----......-...........--..---------....-----------galelvknkktrerfengvgmlcrehcfrnglimravgdtmi
d5u23a1 ----......-...........--..---------....-----------ldednnkrknianfylqnikneniilpsnkfdhvwhlfvvkt
d5uida_ ----......-...........--..---------....-----------vasqvdgracgtlgdvgvwsfdamkilvtgdggmlcfrdpel
d5wt5a_ ACAS......-...........--..---------....-----------edleanpvmvaigaskelahtairlslsrfnteaeidktiev


                                                                                                    
                                                                                                    
d1ajsa_ ............................................................................................
d1b9ha_ etaflrhscgrprddrryfhkiagsnmrlnefsasvlraqlarldeqiavrderwtllsrllgaidgvvpqggdvradrnshymamfripgl
d1bs0a_ vpagtarlrltltaahemqdidrllevlhgng............................................................
d1bt4a_ kghrsvgglrasiynavpyescealvqfmehfkrsrg.......................................................
d1bw0a_ ............................................................................................
d1c0na_ ............................................................................................
d1c4ka2 lgtydgtiynahevvkrighlcdyiefdsawvgyeqfipmmrnssplliddlgpedpgiivvqsvhkqqagfsqtsqihkkdshikgqlryc
d1c7na_ ............................................................................................
d1cl1a_ eqlrenaylmgqmvdadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrdftgssglfsfvlkkklnne
d1cs1a_ rrflgglslftlaeslggveslishaatmthagmapearaaagisetllristgiedgedliadlengfraankg.................
d1d2fa_ ............................................................................................
d1dfoa_ pkspfvtsgirvgtpaitrrgfkeaeakelagwmcdvldsindeavierikgkvldicarypvya...........................
d1elua_ ............................................................................................
d1fc4a_ ............................................................................................
d1fg7a_ ............................................................................................
d1gdea_ ............................................................................................
d1h0ca_ kkmysrktkpfsfyldikwlanfwgcddqprmyhhtipvislyslreslaliaeqglenswrqhreaaaylhgrlqalglqlfvkdpalrlp
d1iaya_ ............................................................................................
d1iuga_ glgfvalspralerlkprgyyldlarelkaqkegesawtpainlvlavaavleevlprleehlalkawqnallygvgeegglrpvpkrfspa
d1jg8a_ ............................................................................................
d1js3a_ dltgafkldpvylkhshqgsglitdyrhwqlplgrrfrslkmwfvfrmygvkglqayirkhvqlshefeafvlqdprfevcaevtlglvcfr
d1lc5a_ ............................................................................................
d1lk9a_ ............................................................................................
d1m32a_ ............................................................................................
d1mdoa_ rslkfhglgvdawdrqsggrapqaevlapgykynlpdlnaaialaqlqkldalnarraaiaaqyhqamadlpfqplslpswehihawhlfii
d1n8pa_ kthpnydvvlkqhrdalgggmisfrikggaeaaskfasstrlftlaeslggiesllevpavmthggipkeareasgvfddlvrisvgiedtd
d1o4sa_ ............................................................................................
d1o69a_ ekiekarfystqarenclhyehldygynyrlsnvlgaigvaqmevleqrvlkkreiyewykeflgeyfsfldelensrsnrwlstalinfdk
d1ohwa_ lltglldlqarypqfisrvrgrgtfcsfdtpdesirnklisiarnkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladf.......
d1p3wa_ grftteeeidytielvrksigrlrdlsplwemykq.........................................................
d1pmma_ aftlggeatdivvmrimcrrgfemdfaellledykaslkylsdhp...............................................
d1qgna_ akfvdalkipyiapsfggcesivdqpaimsywdlsqsdrakygimdnlvrfsfgvedfddlkadilqaldsi....................
d1qisa_ ............................................................................................
d1qj5a_ ............................................................................................
d1qz9a_ lvpqplsgwfghsrqfamepryepsngiarylcgtqpitslamvecgldvfaqtdmaslrrkslaltdlfielveqrcaaheltlvtpreha
d1sffa_ ............................................................................................
d1svva_ ............................................................................................
d1tpla_ vadgiiklyqhkedirglkfiyepkqlrfftarfdyi.......................................................
d1u08a_ ............................................................................................
d1uu1a_ ............................................................................................
d1v2da_ ............................................................................................
d1v72a1 ............................................................................................
d1vefa1 ............................................................................................
d1vp4a_ ............................................................................................
d1wyua1 adiavgdgqslglpmgfggphfgflatkkafvrqlpgrlvsetvdvegrrgfiltlqareqyirrakaksnittnaqltalmgamylaalgp
d1wyub1 irtlgleglkkaaalavlnarylkellkekgyrvpydgpsmhefvaqppegfraldlakgllelgfhpptvyfplivkealmvepteteake
d1xi9a_ ............................................................................................
d1yiza1 ............................................................................................
d1z7da1 dvhdktirltpplcitkeqldecteiivktvkffd.........................................................
d1zoda1 ............................................................................................
d2a7va1 cpgdrsaitpgglrlgapaltsrqfreddfrrvvdfidegvniglevksktaklqdfksfllkdsetsqrlanlrqrveqfarafpmpgfde
d2aeua1 fvikrvykddtinikklieigfnllknygiititvagmpgaskslridltsrdaeriddnyiikaivesikmafks................
d2bkwa1 stavlsdlkaisqaikqtspetffvvdavcsigceefefdewgvdfaltasqkaigapaglsislcssrfmdyalndsknghvhgyfsslrr
d2bwna1 ............................................................................................
d2c7ta_ eliqqlradsrvycddsselmhgdmqlvkkgdiqgsnyclsefqsailldqlqelddknaireknamflndalskidgikvmkrppqvsrqt
d2csta_ ............................................................................................
d2ctza1 rdqgqalgpfeawvvllgmetlslraerhventlhlahwlleqpqvawvnypglphhphhdraqkyfkgkpgavltfglkggyeaakrfisr
d2cy8a_ saqherehvehlvttfdrvldrladenllswqgt..........................................................
d2doub_ ............................................................................................
d2dr1b_ ............................................................................................
d2e7ja1 ryfklstyglsdeevdyvlnafkeiiekys..............................................................
d2e7ua_ ............................................................................................
d2fnua1 lhekmklfrshgmlkkdffegevksighnfrlneiqsalglsqlkkapflmqkreeaaltydrifkdnpyftplhpllkdkssnhlypilmh
d2gb3a1 ............................................................................................
d2gsaa_ ............................................................................................
d2huib_ erykrrntkvkvyywdmslvgdywgcfgrpriyhhtisstllyglreaiamaceeglpaliarhedcakrlyrglqdagfelyadpkdrlst
d2o0ra1 ............................................................................................
d2o1ba_ ............................................................................................
d2x5dd_ ............................................................................................
d2z61a_ ............................................................................................
d2z67a1 rgikktdhfgncylgtythdyivmnaaigvrtedivnsvskleki...............................................
d2zc0d_ ............................................................................................
d3a2ba_ ............................................................................................
d3aepa_ hmenglkvakfleqhekivkvnhpglesfpghdiakkqmtgygstflfemksfeaakklmehlkvctlavslgcvdtliehpasmthaavpe
d3asaa_ ............................................................................................
d3bc8a1 ravplgnvqtvsghtfrgfmshadnypcaylnaaaaigmkmqdvdlfikrldkclnivrkeqtr............................
d3cq4b1 ............................................................................................
d3drdb_ mrelgmltrplgdviaflpplastaeelsemvaimkqaihevtsle..............................................
d3dzza_ ............................................................................................
d3e2fb_ ............................................................................................
d3eucb1 ............................................................................................
d3ezsb_ ............................................................................................
d3f0ha1 rtmyfdlkdalknqergqtpftpavgillqinerlkeikkhggadaevariasqaadfrakikdlpfelvsespangvtsvhpttanaydif
d3fdba1 ............................................................................................
d3ffhb1 ............................................................................................
d3ffra1 irkqteekaalintyiesskvfsfgvedaklrsmttivanttmlpgeinkilepfdmavgagygskketqirianfpahsleqvhklvqtlk
d3fkdb_ ............................................................................................
d3ftba_ ............................................................................................
d3getb_ ............................................................................................
d3h14a1 ............................................................................................
d3hdob_ ............................................................................................
d3hl2a_ plgsmqtvsgytfrgfmshtnnypcaylnaasaigmkmqdvdlfikrldrclkavrk...................................
d3i5tb_ cfelglivrplgdlcvisppliisraqidemvaimrqaitevsaahgl............................................
d3jtxa1 ............................................................................................
d3ju7a_ kqllqsnglmkkgwqlqkteaviqqfmpilcpeevrnkqviedlkkqkiearlyfspschqqvlfrnykstdltrtnkiakrivslplwegm
d3k7ya_ ............................................................................................
d3l8ab_ ............................................................................................
d3lg0d_ svhdktvrltpplcitkeqldecteiivktvkffddnl......................................................
d3mebb_ ............................................................................................
d3n5mb1 ............................................................................................
d3ndnb_ vldkmrlidisnnlgdakslvthpattthramgpegraaiglgdgvvrisvgledtddliadidrals........................
d3nx3b_ ............................................................................................
d3nyuc_ vaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslkaagvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyld
d3p1ta_ ............................................................................................
d3pdxa_ ............................................................................................
d3q8nd_ ............................................................................................
d3ri6a_ letmalrierscqnaqelahwllsipqvkcvnhpslpdspfyaiakrqfryagsiltfeleskeasyrfmdalklirratnihdnkslilsp
d3t32a_ ............................................................................................
d3tqxb_ ............................................................................................
d3uwca_ eklrlyrnhglinrdvcveygincrmdtiqavianrlmnqletitekrrgiahlydqsfvdlsefidvpvrregvyhvfhiyvlrvkyrdql
d4cvqa_ ............................................................................................
d4cxqb_ gviecdrpvdlavatpaaldrgvwlrpfrnlvyamppyictpaeitqitsamvevarlvgs...............................
d4eb5b_ evlpgvierlrsmsp.............................................................................
d4f5kb1 ............................................................................................
d4ge9a1 ............................................................................................
d4grxc_ vlcppfilteaqmdemfeklekaldkvfaeva............................................................
d4h51a_ ............................................................................................
d4isyd1 aaa.........................................................................................
d4ix8a_ ............................................................................................
d4lc3a_ lerftaqrralarayfaafdggaaaklgvglpvaefengnwhmflvtlplerltitraefmaqmkergigtgihypaihlftlyrargfkeg
d4lw2a_ ............................................................................................
d4my5d_ ............................................................................................
d4oc9l_ tlavriekhsqnaekvanflnshpdikgvnyptlasnayhnlfkkyfdknfasgllsfeakdyeharricdktqlfllaanlgdsksliihp
d4piwb_ drinqqrlalwqnyydalaplakagrielpsipdgcvqnahmfyiklrdiddrsalinflkeaeimavfhyiplhgcpagehfgefhgedry
d4r5zd1 ............................................................................................
d4rjyd_ ............................................................................................
d4u1tf_ tlftcgvslggvhslvecpalmthrplsaeararrgigeslirlsvgiedpqdlaedlsralag............................
d4uhoa_ fggdtlqfgptfnakpedldrlfdavgealngva..........................................................
d4wbtb1 ............................................................................................
d4xaub1 heramlrrfygidrtadrlrgaydvaewglkwhmtdlnaaiglanletvdeqlrlhrenaafydkeltgvpglellqrspdregsfyvydvk
d4ysna1 ............................................................................................
d4zm4a_ ............................................................................................
d5b89a1 giryieriglgrierqehklvkrttegldelevpwygprnlkkhagvvsfnvpglhphdvaailddhsimvrsghhcalpvmkklgingtvr
d5g0aa_ ............................................................................................
d5i90a_ vvrlapsllndeaeidrvleilapqla.................................................................
d5jaya1 srlrislsaahsqadldrleaglqql..................................................................
d5lhaa_ ............................................................................................
d5ti8a_ ispplvitkpeidelitlarkcldqtaaval.............................................................
d5u23a1 klrdelqhylnnhdiqtiihypipphkqkcykdlnhlklpitenihqevlslpisptmkendfkkvadilnkwkv.................
d5uida_ aerarklaslgmaqssgfanatadaearwwefevtafgrrsisndvaasigsvqlrrlpefvrrrreiaerydqglstvdglrcppplpagh
d5wt5a_ fsqaavrlrniss...............................................................................


                                                                                                    
                                                                                                    
d1ajsa_ ............................................................................................
d1b9ha_ teerrnalvdrlveaglpafaafraiyrtdafwelgapdesvdaiarrcpntdaissdcvwlhhrvllagepelhataeiiadavara....
d1bs0a_ ............................................................................................
d1bt4a_ ............................................................................................
d1bw0a_ ............................................................................................
d1c0na_ ............................................................................................
d1c4ka2 dhkhfnnsfnlfmstspfypmyaaldvnaamqegeagrklwhdllittiearkklikagsmfrpfvppvvngkkwedgdtedmannidywrf
d1c7na_ ............................................................................................
d1cl1a_ elanyldnfslfsmayswggyeslilanqpehiaairpqgeidfsgtlirlhigledvddliadldagfariv...................
d1cs1a_ ............................................................................................
d1d2fa_ ............................................................................................
d1dfoa_ ............................................................................................
d1elua_ ............................................................................................
d1fc4a_ ............................................................................................
d1fg7a_ ............................................................................................
d1gdea_ ............................................................................................
d1h0ca_ tvttvavpagydwrdivsyvidhfdieimgglgpstgkvlrigllgcnatrenvdrvtealraalqhcpkkk....................
d1iaya_ ............................................................................................
d1iuga_ vaafylpegvpyarvkeafaqrgaviaggqgplkgkvfrlslmgaydryealgvagmfrevleeil..........................
d1jg8a_ ............................................................................................
d1js3a_ lkgsdglneallerinsarkihlvpcrlrgqfvlrfaicsrkvesghvrlawehirglaaella............................
d1lc5a_ ............................................................................................
d1lk9a_ ............................................................................................
d1m32a_ ............................................................................................
d1mdoa_ rvdearcgitrdalmaslktkgigtglhfraahtqkyyrerfptltlpdtewnsericslplfpdmtesdfdrvitalhqiag.........
d1n8pa_ dlledikqalkqatn.............................................................................
d1o4sa_ ............................................................................................
d1o69a_ nelnacqkdinisqknitlhpkiskliedlknkqietrplwkamhtqevfkgakaylngnselffqkgiclpsgtamskddvyeisklilks
d1ohwa_ ............................................................................................
d1p3wa_ ............................................................................................
d1pmma_ ............................................................................................
d1qgna_ ............................................................................................
d1qisa_ ............................................................................................
d1qj5a_ ............................................................................................
d1qz9a_ krgshvsfehpegyaviqalidrgvigdyreprimrfgftplyttftevwdavqilgeildrktwa..........................
d1sffa_ ............................................................................................
d1svva_ ............................................................................................
d1tpla_ ............................................................................................
d1u08a_ ............................................................................................
d1uu1a_ ............................................................................................
d1v2da_ ............................................................................................
d1v72a1 ............................................................................................
d1vefa1 ............................................................................................
d1vp4a_ ............................................................................................
d1wyua1 eglrevalksvemahklhalllevpgvrpftpkpffnefalalpkdpeavrralaergfhgatpvpreygenlalfaatelheeedllalre
d1wyub1 tleafaeamgallkkpkewlenapystpvrrldelrankhpkltyfd.............................................
d1xi9a_ ............................................................................................
d1yiza1 ............................................................................................
d1z7da1 ............................................................................................
d1zoda1 ............................................................................................
d2a7va1 h...........................................................................................
d2aeua1 ............................................................................................
d2bkwa1 wtpimenyeagkgayfatppvqlinsldvalkeileeglhkrwdlhremsdwfkdslvnglqltsvsrypsnmsahgltavyvadppdviaf
d2bwna1 ............................................................................................
d2c7ta_ yygyvfrfdpvkfgglnadqfceilreklnmgtfylhppylpvhknplfcpwtknrylksvrkteaywrglhypvserasgqsivihhaill
d2csta_ ............................................................................................
d2ctza1 lklishlanvgdtrtlaihpastthsqlspeeqaqagvspemvrlsvglehvedlkaelkeala............................
d2cy8a_ ............................................................................................
d2doub_ ............................................................................................
d2dr1b_ ............................................................................................
d2e7ja1 ............................................................................................
d2e7ua_ ............................................................................................
d2fnua1 qkfftckklileslhkrgilaqvhykpiyqyqlyqqlfntaplksaedfyhaeislpchanlnlesvqniahsvlktfesf...........
d2gb3a1 ............................................................................................
d2gsaa_ ............................................................................................
d2huib_ vttikvpqgvdwlkaaqyamktylveisgglgptagqvfriglmgqnattervdrvlqvfqeavaavkp.......................
d2o0ra1 ............................................................................................
d2o1ba_ ............................................................................................
d2x5dd_ ............................................................................................
d2z61a_ ............................................................................................
d2z67a1 ............................................................................................
d2zc0d_ ............................................................................................
d3a2ba_ ............................................................................................
d3aepa_ nimrkqgitpelvrisvgienvddiiadlkqalelw........................................................
d3asaa_ ............................................................................................
d3bc8a1 ............................................................................................
d3cq4b1 ............................................................................................
d3drdb_ ............................................................................................
d3dzza_ ............................................................................................
d3e2fb_ ............................................................................................
d3eucb1 ............................................................................................
d3ezsb_ ............................................................................................
d3f0ha1 lklkdeygiwicpnggemkdtifrvghigalthednttlvnafkdlqkrnll........................................
d3fdba1 ............................................................................................
d3ffhb1 ............................................................................................
d3ffra1 ekig........................................................................................
d3fkdb_ ............................................................................................
d3ftba_ ............................................................................................
d3getb_ ............................................................................................
d3h14a1 ............................................................................................
d3hdob_ ............................................................................................
d3hl2a_ ............................................................................................
d3i5tb_ ............................................................................................
d3jtxa1 ............................................................................................
d3ju7a_ tkeiveqiviclgq..............................................................................
d3k7ya_ ............................................................................................
d3l8ab_ ............................................................................................
d3lg0d_ ............................................................................................
d3mebb_ ............................................................................................
d3n5mb1 ............................................................................................
d3ndnb_ ............................................................................................
d3nx3b_ ............................................................................................
d3nyuc_ tasikiicaalt................................................................................
d3p1ta_ ............................................................................................
d3pdxa_ ............................................................................................
d3q8nd_ ............................................................................................
d3ri6a_ yhviyalnsheerlkleispammrlsvgieeiedlkedilqalc................................................
d3t32a_ ............................................................................................
d3tqxb_ ............................................................................................
d3uwca_ fqylkdngievkihypiamhlqpaakslgyqqgdfpmaekhgeavitlpahpylteeeinyiikkvrefylekhyn................
d4cvqa_ ............................................................................................
d4cxqb_ ............................................................................................
d4eb5b_ ............................................................................................
d4f5kb1 ............................................................................................
d4ge9a1 ............................................................................................
d4grxc_ ............................................................................................
d4h51a_ ............................................................................................
d4isyd1 ............................................................................................
d4ix8a_ ............................................................................................
d4lc3a_ mfphaerygastvtlplftqmtegdvrrvvdavnqiceqygk..................................................
d4lw2a_ ............................................................................................
d4my5d_ ............................................................................................
d4oc9l_ astthsqlseeelqkagitkatirlsiglensddliadlkqaies...............................................
d4piwb_ ttkeserllrlplfynlspvnqrtviatllnyf...........................................................
d4r5zd1 ............................................................................................
d4rjyd_ ............................................................................................
d4u1tf_ ............................................................................................
d4uhoa_ ............................................................................................
d4wbtb1 ............................................................................................
d4xaub1 vddrpafhrkmeaagimaglvsrrndehscvahlrtslpgldsvydrmvslpvgwwlteqdrehvvatirsgw...................
d4ysna1 ............................................................................................
d4zm4a_ ............................................................................................
d5b89a1 asfhvynsleevetflgvmeelvkgl..................................................................
d5g0aa_ ............................................................................................
d5i90a_ ............................................................................................
d5jaya1 ............................................................................................
d5lhaa_ ............................................................................................
d5ti8a_ ............................................................................................
d5u23a1 ............................................................................................
d5uida_ tssyyfywvrmdasvrdamarrlydrgvyttfryaplhlvsayghegslpgaeraaeetlclplhqalsdsdvetvigevraglaalt....
d5wt5a_ ............................................................................................


                                                                                                    
                                                                                                    
d1ajsa_ ............................................................................................
d1b9ha_ ............................................................................................
d1bs0a_ ............................................................................................
d1bt4a_ ............................................................................................
d1bw0a_ ............................................................................................
d1c0na_ ............................................................................................
d1c4ka2 ekgakwhayegygdnqyyvdpnkfmlttpginpetgdyedfgvpativanylrdhgiipeksdlnsilflmtpaetpakmnnlitqllqlqr
d1c7na_ ............................................................................................
d1cl1a_ ............................................................................................
d1cs1a_ ............................................................................................
d1d2fa_ ............................................................................................
d1dfoa_ ............................................................................................
d1elua_ ............................................................................................
d1fc4a_ ............................................................................................
d1fg7a_ ............................................................................................
d1gdea_ ............................................................................................
d1h0ca_ ............................................................................................
d1iaya_ ............................................................................................
d1iuga_ ............................................................................................
d1jg8a_ ............................................................................................
d1js3a_ ............................................................................................
d1lc5a_ ............................................................................................
d1lk9a_ ............................................................................................
d1m32a_ ............................................................................................
d1mdoa_ ............................................................................................
d1n8pa_ ............................................................................................
d1o4sa_ ............................................................................................
d1o69a_ ik..........................................................................................
d1ohwa_ ............................................................................................
d1p3wa_ ............................................................................................
d1pmma_ ............................................................................................
d1qgna_ ............................................................................................
d1qisa_ ............................................................................................
d1qj5a_ ............................................................................................
d1qz9a_ ............................................................................................
d1sffa_ ............................................................................................
d1svva_ ............................................................................................
d1tpla_ ............................................................................................
d1u08a_ ............................................................................................
d1uu1a_ ............................................................................................
d1v2da_ ............................................................................................
d1v72a1 ............................................................................................
d1vefa1 ............................................................................................
d1vp4a_ ............................................................................................
d1wyua1 alkevl......................................................................................
d1wyub1 ............................................................................................
d1xi9a_ ............................................................................................
d1yiza1 ............................................................................................
d1z7da1 ............................................................................................
d1zoda1 ............................................................................................
d2a7va1 ............................................................................................
d2aeua1 ............................................................................................
d2bkwa1 lkshgvviaggihkdigpkyirighmgvtacnknlpymkncfdliklalqrk........................................
d2bwna1 ............................................................................................
d2c7ta_ aepshlsllvdavaelarkfcvt.....................................................................
d2csta_ ............................................................................................
d2ctza1 ............................................................................................
d2cy8a_ ............................................................................................
d2doub_ ............................................................................................
d2dr1b_ ............................................................................................
d2e7ja1 ............................................................................................
d2e7ua_ ............................................................................................
d2fnua1 ............................................................................................
d2gb3a1 ............................................................................................
d2gsaa_ ............................................................................................
d2huib_ ............................................................................................
d2o0ra1 ............................................................................................
d2o1ba_ ............................................................................................
d2x5dd_ ............................................................................................
d2z61a_ ............................................................................................
d2z67a1 ............................................................................................
d2zc0d_ ............................................................................................
d3a2ba_ ............................................................................................
d3aepa_ ............................................................................................
d3asaa_ ............................................................................................
d3bc8a1 ............................................................................................
d3cq4b1 ............................................................................................
d3drdb_ ............................................................................................
d3dzza_ ............................................................................................
d3e2fb_ ............................................................................................
d3eucb1 ............................................................................................
d3ezsb_ ............................................................................................
d3f0ha1 ............................................................................................
d3fdba1 ............................................................................................
d3ffhb1 ............................................................................................
d3ffra1 ............................................................................................
d3fkdb_ ............................................................................................
d3ftba_ ............................................................................................
d3getb_ ............................................................................................
d3h14a1 ............................................................................................
d3hdob_ ............................................................................................
d3hl2a_ ............................................................................................
d3i5tb_ ............................................................................................
d3jtxa1 ............................................................................................
d3ju7a_ ............................................................................................
d3k7ya_ ............................................................................................
d3l8ab_ ............................................................................................
d3lg0d_ ............................................................................................
d3mebb_ ............................................................................................
d3n5mb1 ............................................................................................
d3ndnb_ ............................................................................................
d3nx3b_ ............................................................................................
d3nyuc_ ............................................................................................
d3p1ta_ ............................................................................................
d3pdxa_ ............................................................................................
d3q8nd_ ............................................................................................
d3ri6a_ ............................................................................................
d3t32a_ ............................................................................................
d3tqxb_ ............................................................................................
d3uwca_ ............................................................................................
d4cvqa_ ............................................................................................
d4cxqb_ ............................................................................................
d4eb5b_ ............................................................................................
d4f5kb1 ............................................................................................
d4ge9a1 ............................................................................................
d4grxc_ ............................................................................................
d4h51a_ ............................................................................................
d4isyd1 ............................................................................................
d4ix8a_ ............................................................................................
d4lc3a_ ............................................................................................
d4lw2a_ ............................................................................................
d4my5d_ ............................................................................................
d4oc9l_ ............................................................................................
d4piwb_ ............................................................................................
d4r5zd1 ............................................................................................
d4rjyd_ ............................................................................................
d4u1tf_ ............................................................................................
d4uhoa_ ............................................................................................
d4wbtb1 ............................................................................................
d4xaub1 ............................................................................................
d4ysna1 ............................................................................................
d4zm4a_ ............................................................................................
d5b89a1 ............................................................................................
d5g0aa_ ............................................................................................
d5i90a_ ............................................................................................
d5jaya1 ............................................................................................
d5lhaa_ ............................................................................................
d5ti8a_ ............................................................................................
d5u23a1 ............................................................................................
d5uida_ ............................................................................................
d5wt5a_ ............................................................................................


             
             
d1ajsa_ .....
d1b9ha_ .....
d1bs0a_ .....
d1bt4a_ .....
d1bw0a_ .....
d1c0na_ .....
d1c4ka2 lieed
d1c7na_ .....
d1cl1a_ .....
d1cs1a_ .....
d1d2fa_ .....
d1dfoa_ .....
d1elua_ .....
d1fc4a_ .....
d1fg7a_ .....
d1gdea_ .....
d1h0ca_ .....
d1iaya_ .....
d1iuga_ .....
d1jg8a_ .....
d1js3a_ .....
d1lc5a_ .....
d1lk9a_ .....
d1m32a_ .....
d1mdoa_ .....
d1n8pa_ .....
d1o4sa_ .....
d1o69a_ .....
d1ohwa_ .....
d1p3wa_ .....
d1pmma_ .....
d1qgna_ .....
d1qisa_ .....
d1qj5a_ .....
d1qz9a_ .....
d1sffa_ .....
d1svva_ .....
d1tpla_ .....
d1u08a_ .....
d1uu1a_ .....
d1v2da_ .....
d1v72a1 .....
d1vefa1 .....
d1vp4a_ .....
d1wyua1 .....
d1wyub1 .....
d1xi9a_ .....
d1yiza1 .....
d1z7da1 .....
d1zoda1 .....
d2a7va1 .....
d2aeua1 .....
d2bkwa1 .....
d2bwna1 .....
d2c7ta_ .....
d2csta_ .....
d2ctza1 .....
d2cy8a_ .....
d2doub_ .....
d2dr1b_ .....
d2e7ja1 .....
d2e7ua_ .....
d2fnua1 .....
d2gb3a1 .....
d2gsaa_ .....
d2huib_ .....
d2o0ra1 .....
d2o1ba_ .....
d2x5dd_ .....
d2z61a_ .....
d2z67a1 .....
d2zc0d_ .....
d3a2ba_ .....
d3aepa_ .....
d3asaa_ .....
d3bc8a1 .....
d3cq4b1 .....
d3drdb_ .....
d3dzza_ .....
d3e2fb_ .....
d3eucb1 .....
d3ezsb_ .....
d3f0ha1 .....
d3fdba1 .....
d3ffhb1 .....
d3ffra1 .....
d3fkdb_ .....
d3ftba_ .....
d3getb_ .....
d3h14a1 .....
d3hdob_ .....
d3hl2a_ .....
d3i5tb_ .....
d3jtxa1 .....
d3ju7a_ .....
d3k7ya_ .....
d3l8ab_ .....
d3lg0d_ .....
d3mebb_ .....
d3n5mb1 .....
d3ndnb_ .....
d3nx3b_ .....
d3nyuc_ .....
d3p1ta_ .....
d3pdxa_ .....
d3q8nd_ .....
d3ri6a_ .....
d3t32a_ .....
d3tqxb_ .....
d3uwca_ .....
d4cvqa_ .....
d4cxqb_ .....
d4eb5b_ .....
d4f5kb1 .....
d4ge9a1 .....
d4grxc_ .....
d4h51a_ .....
d4isyd1 .....
d4ix8a_ .....
d4lc3a_ .....
d4lw2a_ .....
d4my5d_ .....
d4oc9l_ .....
d4piwb_ .....
d4r5zd1 .....
d4rjyd_ .....
d4u1tf_ .....
d4uhoa_ .....
d4wbtb1 .....
d4xaub1 .....
d4ysna1 .....
d4zm4a_ .....
d5b89a1 .....
d5g0aa_ .....
d5i90a_ .....
d5jaya1 .....
d5lhaa_ .....
d5ti8a_ .....
d5u23a1 .....
d5uida_ .....
d5wt5a_ .....


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0035073 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Candidatus Phytoplasma mali
NoYes   Aster yellows witches'-broom phytoplasma AYWB
NoYes   Onion yellows phytoplasma OY-M
NoYes   Mesoplasma florum L1
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma leachii 99/014/6
NoYes   Mycoplasma mycoides subsp. capri LC str. 95010
NoYes   Mycoplasma capricolum subsp. capricolum ATCC 27343
NoYes   Mycoplasma haemocanis str. Illinois
NoYes   Mycoplasma wenyonii str. Massachusetts
NoYes   Mycoplasma suis KI3806
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma conjunctivae HRC/581
NoYes   Mycoplasma haemofelis Ohio2
NoYes   Mycoplasma bovis HB0801
NoYes   Mycoplasma penetrans HF-2
NoYes   Mycoplasma putrefaciens KS1
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma arthritidis 158L3-1
NoYes   Mycoplasma agalactiae PG2
NoYes   Mycoplasma synoviae 53
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma pneumoniae 309
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma hyopneumoniae 168
NoYes   Mycoplasma hominis ATCC 23114
NoYes   Mycoplasma genitalium G37
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Tropheryma whipplei TW08/27
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Veillonella parvula DSM 2008
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Weissella koreensis KACC 15510
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus sanfranciscensis TMW 1.1304
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Candidatus Cardinium hertigii
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Candidatus Sulcia muelleri DMIN
NoYes   Candidatus Sulcia muelleri SMDSEM
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Blattabacterium sp. (Nauphoeta cinerea)
NoYes   Blattabacterium sp. (Blattella germanica) str. Bge
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Chlamydophila pecorum E58
NoYes   Chlamydia muridarum Nigg
NoYes   Chlamydophila pneumoniae TW-183
NoYes   Chlamydophila caviae GPIC
NoYes   Chlamydophila felis Fe/C-56
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Chlamydia trachomatis B/Jali20/OT
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Aminobacterium colombiense DSM 12261
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Flexistipes sinusarabici DSM 4947
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Thermovibrio ammonificans HB-1
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Thermocrinis albus DSM 14484
NoYes   Aquifex aeolicus VF5
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Elusimicrobium minutum Pei191
NoYes   uncultured Termite group 1 bacterium phylotype Rs-D17
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division WWE3 bacterium RAAC2_WWE3_1
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharibacteria bacterium RAAC3_TM7_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter mustelae 12198
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Neisseria meningitidis alpha14
NoYes   Neisseria meningitidis FAM18
NoYes   Neisseria lactamica 020-06
NoYes   Neisseria gonorrhoeae NCCP11945
NoYes   syncytium symbiont of Diaphorina citri
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   Candidatus Tremblaya princeps PCIT
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Candidatus Zinderia insecticola CARI
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Taylorella asinigenitalis MCE3
NoYes   Taylorella equigenitalis MCE9
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   alpha proteobacterium HIMB59
NoYes   Candidatus Pelagibacter sp. IMCC9063
NoYes   Candidatus Midichloria mitochondrii IricVA
NoYes   Neorickettsia sennetsu str. Miyayama
NoYes   Neorickettsia risticii str. Illinois
NoYes   Wolbachia endosymbiont of Culex quinquefasciatus Pel
NoYes   Wolbachia sp. wRi
NoYes   Ehrlichia chaffeensis str. Arkansas
NoYes   Ehrlichia canis str. Jake
NoYes   Ehrlichia ruminantium str. Gardel
NoYes   Anaplasma phagocytophilum HZ
NoYes   Anaplasma marginale str. Florida
NoYes   Anaplasma centrale str. Israel
NoYes   Orientia tsutsugamushi str. Boryong
NoYes   Rickettsia bellii OSU 85-389
NoYes   Rickettsia canadensis str. McKiel
NoYes   Rickettsia typhi str. Wilmington
NoYes   Rickettsia prowazekii str. BuV67-CWPP
NoYes   Rickettsia philipii str. 364D
NoYes   Rickettsia heilongjiangensis 054
NoYes   Rickettsia peacockii str. Rustic
NoYes   Rickettsia felis URRWXCal2
NoYes   Rickettsia slovaca 13-B
NoYes   Rickettsia parkeri str. Portsmouth
NoYes   Rickettsia massiliae MTU5
NoYes   Rickettsia japonica YH
NoYes   Rickettsia africae ESF-5
NoYes   Rickettsia rhipicephali str. 3-7-female6-CWPP
NoYes   Rickettsia montanensis str. OSU 85-930
NoYes   Candidatus Rickettsia amblyommii str. GAT-30V
NoYes   Rickettsia australis str. Cutlack
NoYes   Rickettsia akari str. Hartford
NoYes   Rickettsia rickettsii str. 'Sheila Smith'
NoYes   Rickettsia conorii str. Malish 7
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Candidatus Hodgkinia cicadicola Dsem
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Candidatus Liberibacter asiaticus str. psy62
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Bartonella tribocorum CIP 105476
NoYes   Bartonella clarridgeiae 73
NoYes   Bartonella henselae str. Houston-1
NoYes   Bartonella grahamii as4aup
NoYes   Bartonella quintana str. Toulouse
NoYes   Bartonella bacilliformis KC583
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Haemophilus somnus 129PT
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus ducreyi 35000HP
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Haemophilus influenzae PittEE
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Candidatus Carsonella ruddii PV
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Dichelobacter nodosus VCS1703A
NoYes   Rhodanobacter denitrificans
NoYes   Frateuria aurantia DSM 6220
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Halothiobacillus neapolitanus c2
NoYes   Spiribacter sp. UAH-SP71
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Coxiella burnetii Dugway 5J108-111
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   Baumannia cicadellinicola str. Hc (Homalodisca coagulata)
NoYes   gamma proteobacterium HdN1
NoYes   Candidatus Ruthia magnifica str. Cm (Calyptogena magnifica)
NoYes   Candidatus Vesicomyosocius okutanii HA
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia symbiotica str. 'Cinara cedri'
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Halyomorpha halys symbiont
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis
NoYes   Buchnera aphidicola BCc
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Escherichia blattae DSM 4481
NoYes   Candidatus Moranella endobia PCIT
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Candidatus Riesia pediculicola USDA
NoYes   secondary endosymbiont of Ctenarytaina eucalypti
NoYes   Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)
NoYes   Candidatus Blochmannia floridanus
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Psychrobacter sp. G
NoYes   Psychrobacter sp. PRwf-1
NoYes   Psychrobacter arcticus 273-4
NoYes   Psychrobacter cryohalolentis K5
NoYes   Moraxella catarrhalis RH4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Acinetobacter sp. ADP1