SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Periplasmic binding protein-like I alignments in Mus musculus 63_37 (longest transcript per gene)

These alignments are sequences aligned to the 0039493 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                              10                                   2
                                                               |                                    
d1jdpa_               .............................eal---PPQKIEVLVLLPQD........................D.S..
ENSMUSP00000037255  ...............................a--RMDGDVIIGALFSVHhqppaekvperkcg..........E.I..
ENSMUSP00000129181  ..............................va--HMPGDIIIGALFSVHhqptvdkvherkc...........G.Av.
ENSMUSP00000131856  ..............................fy---HEGDVTIGAFFPLHiyytgnkvpdkympysfqdyh...V.Q..
ENSMUSP00000126650  ..............................hv----KGDVKIGAFFSLHiyytgnnipdtidpyyfkdvh...L.Q..
ENSMUSP00000029540  ................................------DLTVAVVLPLT........................NtS..
ENSMUSP00000125817  ...............................y---HEGDLTIGAFFPLHiystrnhvpheldpyyfqdmy...L.E..
ENSMUSP00000113819  ...............................i----DGDITLGGLFPVHgrgsegkac...............G.El.
ENSMUSP00000129576  ..............................fy---HEGDVTIGAFFPLHifytgnkipdkflpynfkdyh...I.Q..
ENSMUSP00000126966  ..............................fy---REGDVTIGAFFPLHiyytgnkvpgkylpysfqdyr...V.Q..
ENSMUSP00000129089  ..............................yq----EGDVTIGAFFPLHsyythdhvsheielyyfqdmy...L.K..
ENSMUSP00000128493  ..............................fy---HEGDVTIGALFPLHilytgntltdqsfpynfqdyh...I.Q..
ENSMUSP00000069080  ...............................a--QKKGDIILGGLFPIHfgvaakdqdlksrpesvec.....I.R..
ENSMUSP00000064404  ...............................i----EGDVTLGGLFPVHakgpsgvpc...............G.Di.
ENSMUSP00000129068  ..............................yy----EGDVTIGAFFPLHsyythdhvpheidpyffqdmf...T.Q..
ENSMUSP00000129308  ..............................yy----EGDVTIGAFFPLHsyythdhvpheidpyffqdmf...T.Q..
ENSMUSP00000087998  ..............................rl----DGDIILGGLFPVHakgergvpc...............G.Dl.
ENSMUSP00000129762  ...............................f--HHKGDVVIGAFFPIHtyhtmnkscdikaiflllilchl.H.R..
ENSMUSP00000000631  ..............................rl----AGGLTLGGLFPVHargaagrac...............G.Tl.
ENSMUSP00000129296  ..........................rihpnk-----------------........................-.-..
ENSMUSP00000129895  ...............................f--HHEEDVMIGAFFPLHtlytekkkphstkpyvyldyy...I.Q..
ENSMUSP00000048706  ...............................f--HHEGDVMIGAFFPVHtfytekkrphstipyqyldgy...I.Q..
ENSMUSP00000029406  ...............................h------SLVIAGLFPIHsriipvdeailepvspmc......E.G..
ENSMUSP00000126559  ...............................f--HHEGDVVVGAFFPLHtfytekkmphktvpyqyldnr...I.Q..
ENSMUSP00000127465  ...............................f--HHEGDVLIGAFFPLHtfytgkkmpnsavpyqyldny...I.Q..
ENSMUSP00000129347  ...............................f--HHEGDVVIGAFFPIHtyyspnkvphpsvpykymdny...L.Q..
ENSMUSP00000131426  ...............................l--HHDGTVVIGAFFPILkslpvsetidwktlsfdidnv...L.E..
ENSMUSP00000128685  ...............................f--HHEGDVLIGAFFPLHtfytgkkmpnsavpykyldny...I.Q..
ENSMUSP00000132641  ...............................f--HHDGDVMIGAFFPIHtyyteykiphpflpyqymdny...L.L..
ENSMUSP00000004076  ...............................e-----GDLVLGGLFPINekgtgteec...............G.Ri.
ENSMUSP00000124192  ...............................e----NHSVVIGGLFPVHyrtmptsdsdeeiespmc......E.G..
ENSMUSP00000128975  ...................egpidekfynyvi----------------N........................F.R..
ENSMUSP00000126106  ...............................f--HHEGDVVIGAFLPLHtfhtgkkkphstipyyyldnk...I.Q..
ENSMUSP00000023959  ...............................l----EGDLVLGGLFPVHqkggpaeec...............G.Pv.
ENSMUSP00000126534  ...............................f--HHEGDVMIGAFFPIHtyysakkiphpflpyyyldnh...I.Q..
ENSMUSP00000126756  ...............................f--HHEGDVVVGAFFPLHtfytekkmphktvlyqyldnq...I.Q..
ENSMUSP00000078200  ...............................f--HHEGDFMIGAFFPLHtfytekkmphstipytyldgy...V.Q..
ENSMUSP00000129313  ...............................f--HREGDVVIGAFFPLHtfyslkkmqhstipyyyldnv...I.Q..
ENSMUSP00000130373  ...............................f--HHEGDVVIGAFFPLHtyytknkiphsylpyyykdny...L.Q..
ENSMUSP00000128350  ...............................f--HHEGDVVIGAFFPLHtfytekkmphstlpyqyldny...I.Q..
ENSMUSP00000094994  ...............qpvekeyfshilniqtq-----------------........................-.-..
ENSMUSP00000090148  ...........havqqpvekeyfshilniqtq-----------------........................-.-..
ENSMUSP00000131261  ...............................f--HREGDVVIGAFFPLHtfyslkkmqhstipyyyldnv...I.Q..
ENSMUSP00000131925  ..............................kt-----------------........................-.-..
ENSMUSP00000130114  ..............................hs----DGTVVIGAFFPILhnsrvskiidwryfpmdsddy...F.G..
ENSMUSP00000131583  ...............................f--HHEGDVVVGAFFPLHtfytekkmphstvpyeyldnq...I.Q..
ENSMUSP00000126885  ...........qrpvekeyfshilniqthten-----------------........................-.-..
ENSMUSP00000127981  ...........qwpvekeyfssilntqthten-----------------........................-.-..
ENSMUSP00000132299  ..............................hy----DGTVVIGAFFPILhnspislttewkylpmdtdny...F.G..
ENSMUSP00000131447  ....tfmihavqrpvekeyfshilniqthten-----------------........................-.-..
ENSMUSP00000128106  ............qpvkkeyfshilniqthten-----------------........................-.-..
ENSMUSP00000077109  ..............................kt-----------------........................-.-..
ENSMUSP00000020547  ..............................ys----DGTVVIGAFFPILhnslvrtttdwkyfpmdsdny...F.G..
ENSMUSP00000131450  ...............gfflftseepikedfyh-------------FCID........................F.R..
ENSMUSP00000125126  ..................kpiednfynsllkf-----------------........................-.R..
ENSMUSP00000126386  ...............................m---------IGAFFPLHtfytekkrphsakpyqyldny...V.Q..
ENSMUSP00000127505  ....tfmihavqrpvekeyfshilniqthaen-----------------........................-.-..
ENSMUSP00000124065  ......................piednfynsv---------------LN........................F.R..
ENSMUSP00000132478  ..........hgyvkndyfsenldkkvtlkti-----------------........................-.-..
ENSMUSP00000127838  ...............lftyegpieekfynnvi----------------H........................F.R..
ENSMUSP00000127513  ..............................kt-----------------........................-.-..
ENSMUSP00000129215  ..................ekpmeddfynvrfd-----------------........................F.R..
ENSMUSP00000126953  ............................ivdf-----------------........................-.R..
ENSMUSP00000071670  ..............................dl----------------N........................F.R..
ENSMUSP00000131831  ..............................kt-----------------........................-.-..
ENSMUSP00000133218  .............................vdf-----------------........................-.R..
ENSMUSP00000092079  .....................klmkddfynvw---------------LD........................F.R..
ENSMUSP00000126698  .................yfsenldkkvtlkti-----------------........................-.-..
ENSMUSP00000128015  ..........................dfripa-----------------........................-.-..
ENSMUSP00000129540  .....................dkkvtlktiyl-----------------........................-.-..
ENSMUSP00000126596  ....................klmkddfynvrl----------------D........................F.R..
ENSMUSP00000128333  ............................isdf-----------------........................-.R..
ENSMUSP00000128792  ..................klmkddfynvrldf-----------------........................-.R..
ENSMUSP00000129520  .............................vdf-----------------........................-.R..
ENSMUSP00000052977  ............................isdf-----------------........................-.R..
ENSMUSP00000078162  .............................lri-----------------........................-.-..
ENSMUSP00000132467  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000129566  ...............................w-----------------........................-.-..
ENSMUSP00000036551  ..............pllndpfngnpdillttr-----------------........................-.-..
ENSMUSP00000126007  .......rgyvkndyfswnldkqvtpktnhli-----------------........................-.-..
ENSMUSP00000083386  ...............................w-----------------........................-.-..
ENSMUSP00000129960  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000066737  ...............................a-----QKIEVLVLLPRD........................D.S..
ENSMUSP00000074613  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000129578  ......lavvqkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000122645  .............ndyfscnldkqvtpktihl-----------------........................-.-..
ENSMUSP00000104194  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000132834  ...............................w-----------------........................-.-..
ENSMUSP00000093612  ...........................nisnf-----------------........................-.R..
ENSMUSP00000126979  ...............................s-----------------........................-.-..
ENSMUSP00000126973  .......qgyvkndyfswnldkkvtpktnhli-----------------........................-.-..
ENSMUSP00000127309  ...................fsgnldkqlttkn-----------------........................-.-..
ENSMUSP00000126165  ..............................nh------HFVIGGQFPVHyrtipttspfltqieasgsqmlflS.R..
ENSMUSP00000131128  ..............papkdflkylfksclpsk-----------------........................-.-..
ENSMUSP00000131990  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000127337  ...........qtptekdyfnktlnflktttn-----------------........................-.-..
ENSMUSP00000030191  ...............................n-------LTLAVVLPEH........................NlS..
ENSMUSP00000133007  ..........qkpiekeyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000131780  ...........qtptekdyfnktlnflktttn-----------------........................-.-..
ENSMUSP00000132457  ...........qtptekdyfnktlnflktttn-----------------........................-.-..
ENSMUSP00000076687  .fsisakhgyirndyfswnldkhvtpktnhli-----------------........................-.-..
ENSMUSP00000128102  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000132539  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000129411  .sistrhgyvkndyfswnldkkvtpktnhlif-----------------........................-.-..
ENSMUSP00000132726  lfsistkqgyvkndyfswnidkkvtpktnhli-----------------........................-.-..
ENSMUSP00000132327  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000030792  ..............................pg-FSLPGDFLLAGLFSLHadclqvrhrplvtscdrs......D.S..
ENSMUSP00000133014  .....................rvtpktnhlif-----------------........................-.-..
ENSMUSP00000126917  ...........hgyvkndyfrwnldkkvtpkt-----------------........................-.-..
ENSMUSP00000128337  ...........qtptekdyfnktlnflktttn-----------------........................-.-..
ENSMUSP00000132332  ...........qtptekdyfnktlnflktttn-----------------........................-.-..
ENSMUSP00000133265  ...........qtptekdyfnktlnflktttn-----------------........................-.-..
ENSMUSP00000126863  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000127146  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000130631  ...........qtptekdyfnktlnflktttn-----------------........................-.-..
ENSMUSP00000132337  lfsistkqgyvkndyfswnldkqvtpkinhli-----------------........................-.-..
ENSMUSP00000072566  ...........tpiendyfnktlnvlkttknh-----------------........................-.-..
ENSMUSP00000129466  ...........tpiendyfnktlnvlkttknh-----------------........................-.-..
ENSMUSP00000075833  ...........tpiendyfnktlnvlkttknh-----------------........................-.-..
ENSMUSP00000087221  ....................kpieddfynivy----------------N........................F.R..
ENSMUSP00000124342  ...........................gyyqd-----ADFVIGGLFSLRvtdgntfisrsgiedtshipeyv.F.A..
ENSMUSP00000104190  ..........qtpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000083463  ..........qtpiekdyfnttlnflkttknh-----------------........................-.-..
ENSMUSP00000126682  ............................pgyy---QDGDFVIGGLFSLRvtagdtrsrfgftdtihipeyv..Y.G..
ENSMUSP00000079827  ..........qtptekdyfnktlnvlkttknh-----------------........................-.-..
ENSMUSP00000074476  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000069647  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000083477  ..........qmpmekdyfketlnvlkttknh-----------------........................-.-..
ENSMUSP00000073604  ............................pgyy---QDGDFVIGGLFSLRvmirrfiskfsfkdafylsefl..Y.A..
ENSMUSP00000072296  ..........qtptekdyfnktlnvlkttknh-----------------........................-.-..
ENSMUSP00000129703  .....fsistkhgyvkndyfswnldkqvtpkt-----------------........................-.-..
ENSMUSP00000083478  ..........qkpiekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000083468  ..........qtptekdyfnktlnvlkttknh-----------------........................-.-..
ENSMUSP00000132043  ...........................pgyyq----DGDFVIGGFFSLKlsgrhsknkftsgneynipeyvy.I.-..
ENSMUSP00000092462  ..........qtptekdyfnktlnflkttknh-----------------........................-.-..
ENSMUSP00000092460  ..........qtptekdyfnktlnvlkttknh-----------------........................-.-..
ENSMUSP00000130160  ..........qtptekdyfnktlnvlkttknh-----------------........................-.-..
ENSMUSP00000098528  ...........................pgynq----DGDFLIGGFFSLRvtgredrtefcfnetmnmty....G.Syf
ENSMUSP00000030949  ...............................a----QGDYILGGLFPLGsteeatlnqrtqpnsipc......N.R..
ENSMUSP00000129352  ...........mpmekynfketlnvsktnknh-----------------........................-.-..
ENSMUSP00000132206  ............qwpvekeyfssilntqthte-----------------........................-.-..
ENSMUSP00000032238  ............................gyyq----DADFVIGGLFSLRvtdgdtfisrsgvedtshiaeyv.F.A..
ENSMUSP00000127506  ...............................t-----------------........................-.-..
ENSMUSP00000074602  .............................gyy---QDGDFVIGGLFSLRmtlgghlkpkilfkdktdtldvv.H.V..
ENSMUSP00000128981  ...........................pgyyq----DGDFVIGGLLSLKvsgrhnknkftsgneynlpeyvy.I.-..
ENSMUSP00000020062  ..............................ai--TSPGHIMIGGLFAIHekmlssddhprrpqiqkc......A.G..
ENSMUSP00000129145  ...........................pgyyq----DGDFVIGGLLSLKvsgrhnknkftsgneynlpeyvy.I.-..
ENSMUSP00000030510  ..............................fh---LAGDYLLGGLFTLHanvksvshlsylqvpkcne.....Y.N..
ENSMUSP00000128600  ......hgyvkndyfgwnldkqvtpktnhlif-----------------........................-.-..
ENSMUSP00000025338  ................................-------VYIGALFPMS........................G.G..
ENSMUSP00000092459  ..........qtpiekdyfnktlnvlkttknh-----------------........................-.-..
ENSMUSP00000044521  ................................-------YKIGVIGPWT........................C.D..
ENSMUSP00000127895  ...............................h-----------------........................-.-..
ENSMUSP00000068253  ...............................k-------LTVGFHAPWN........................I.S..
ENSMUSP00000103378  ..............................ps----SPPLSIMGLMPLT........................K.Eva
ENSMUSP00000131564  ................................-----------------........................-.-..
ENSMUSP00000131156  ................................-----------------........................-.-..
ENSMUSP00000077758  .............................hvl--------RFGGIFEYV........................E.S..
ENSMUSP00000095875  ................................------TFTLGVLGPWD........................C.D..
ENSMUSP00000072107  ...............................e-----------------........................-.-..
ENSMUSP00000030676  ...............................g---MPHVIRIGGIFEYAd.......................G.P..
ENSMUSP00000027020  ...............................a---FPSSVQIGGLFIRN........................T.D..
ENSMUSP00000032338  ............................lmmd----------------N........................S.A..
ENSMUSP00000109949  ..............................ac---DPKIVNIGAVLSTR........................-.-..
ENSMUSP00000044494  ...............................n---FPNNIQIGGLFPNQ........................Q.S..
ENSMUSP00000103375  ...............................s----SNSIQIGGLFPRG........................A.D..
ENSMUSP00000075687  ...............................g---FPNTISIGGLFMRN........................T.V..
ENSMUSP00000021259  ................................------VFKVGVLGPWA........................C.D..
ENSMUSP00000034515  .............................csp-----HSLRIAAILDDP........................-.-..
ENSMUSP00000003468  ............................qtvc-----------------........................-.-..
ENSMUSP00000093536  .............................ata----DSIIHIGAIFDES........................-.-..
ENSMUSP00000044009  .............................rad-----SIIHIGAIFEEN........................A.-..
ENSMUSP00000129679  ..........................hhkgei-----------------........................-.-..
ENSMUSP00000062284  ...........................amnet-----------------........................-.-..
ENSMUSP00000002848  ..................alvfsgpayaaeaa-----------------........................-.-..
ENSMUSP00000091381  ..............................rd-----------------........................-.-..
ENSMUSP00000032331  ................tglpldvnvvallmnr-----------------........................-.-..
ENSMUSP00000097013  ....................dchfctpqstse-----------------........................-.-..
ENSMUSP00000003351  ...tnpssiltqicgllgaarvhgivfednvd-----------------........................-.-..
ENSMUSP00000105373  ....................dchfctpqstse-----------------........................-.-..
ENSMUSP00000093345  ....................dchfctpqstse-----------------........................-.-..


                      0        30        40        50        60                          70         
                      |         |         |         |         |                           |         
d1jdpa_               YLFSLTRVRPAIEYALRSVEGNGTGRRLLPPGTRFQVAYEDSD..................CGNRALFSLV.......
ENSMUSP00000037255  REQYGIQRVEAMFHTLDKINADP----VLLPNITLGSEIRDSC..................WHSS--VALE.......
ENSMUSP00000129181  REQYGIQRVEAMLHTLERINSDP----TLLPNITLGCEIRDSC..................WHSA--VALE.......
ENSMUSP00000131856  YKFKNYQFVLALLFAIEEINRNP----DLLPNTTIGYGIYNIP..................YTEK--NILY.......
ENSMUSP00000126650  YKFKNYQFLLALLFAIEEINKNP----HLLPNITLGFDFYNVR..................FTEK--SILEgpltwlt
ENSMUSP00000029540  YPWSWARVGPAVELALGRVKARP----DLLPGWTVRMVLGSSEnaagv.............CSDT--AAPL.......
ENSMUSP00000125817  YNFMNYQFLLALMFTIQEINRNP----HLLPNTTLGFEHHNIK..................FSEK--NILLgpflwls
ENSMUSP00000113819  KKEKGIHRLEAMLFALDRINNDP----DLLPNITLGARILDTC..................SRDT--HALE.......
ENSMUSP00000129576  YKFKNYQFVLALVFAIEEINRNP----HLLPNTTIGYDIYNIP..................FTEK--NILY.......
ENSMUSP00000126966  YKFKNYQFVLALVFAIEEINRNP----DLLPNTTIGYDIYNIP..................FTEK--NILRsiflwrt
ENSMUSP00000129089  YNFMNYQFLLALVFTIEEINRNP----HLLPNTTLGFEHHNIK..................FSEK--NILLgpflwla
ENSMUSP00000128493  YKFKNYLFVLALVFAIEEINRNP----DLLPNITIGYDIYNIP..................FTEK--NILYsaflwrt
ENSMUSP00000069080  YNFRGFRWLQAMIFAIEEINSSP----ALLPNMTLGYRIFDTC..................NTVS--KALE.......
ENSMUSP00000064404  KRENGIHRLEAMLYALDQINSDP----NLLPNVTLGARILDTC..................SRDT--YALE.......
ENSMUSP00000129068  YNFMNYQLLLALVFTIEEINRNP----HLLPNTTLGFEHHNIK..................FSEK--NILLgpflwlt
ENSMUSP00000129308  YNFMNYQLLLALVFTIEEINRNP----HLLPNTTLGFEHHNIK..................FSEK--NILLgpflwla
ENSMUSP00000087998  KKEKGIHRLEAMLYAIDQINKDP----DLLSNITLGVRILDTC..................SRDT--YALE.......
ENSMUSP00000129762  YNFKSYQYILALLFAIEEINGNP----NLLPNISLGFDFYNVR..................FTEK--DTLM.......
ENSMUSP00000000631  KKEQGVHRLEAMLYALDRINADP----ELLPGVRLGARLLDTC..................SRDT--YALE.......
ENSMUSP00000129296  -----YQYVIALNFAIEEINKNI----HLLPNISLGYDMYSIVqyqatilehsirfl....TGLK--EAIP.......
ENSMUSP00000129895  YNFKNYQYILALLFAIEEINRNP----NILPNISLGFDFYNNE..................YTER--NILR.......
ENSMUSP00000048706  YNFKNYQYILALLFAIEEINGNP----NLLPNISLGFDFYNVR..................FTEK--ETLM.......
ENSMUSP00000029406  FNFRGFRWMKTMIHTIKEINERK----DILPNHTLGYQIFDSC..................YTIS--KAME.......
ENSMUSP00000126559  YNFKNYKYILALQFAIEEINRNP----NLLPNTSLGFDFYNVR..................FTEK--YTLD.......
ENSMUSP00000127465  YNFKNYRYILALLFAIEEINGNP----NLLPNTSLGFDFYNVR..................FTEK--DTLD.......
ENSMUSP00000129347  YNFKNYQYILALVFAIEEINENP----NLLPNISLGFDFYNVR..................FTEK--ETLM.......
ENSMUSP00000131426  MNVHNYQLVLTMLFAINEINLNS----HILPNTSLGLEIYNVP..................YLQR--NALR.......
ENSMUSP00000128685  YNFKNYRYILALLFAIEEINGNP----NLLPNTSLGFDFYNVR..................FTEK--DTLD.......
ENSMUSP00000132641  YNFKNYQYILALVFAIEEINGNP----SLLPNISLGFDFYNVR..................FTEK--ETLM.......
ENSMUSP00000004076  NEDRGIQRLEAMLFAIDEINKDN----YLLPGVKLGVHILDTC..................SRDT--YALE.......
ENSMUSP00000124192  FNFRGFRWMKTMIHTIKEINERK----DILPNHTLGYQIFDNC..................FSIT--KAME.......
ENSMUSP00000128975  IPARRYEYFLVMFFATDEINKNP----YLLPNMSFVFSLIAGM..................CEDT--LGFIdkrhspq
ENSMUSP00000126106  YNFKNYQYILALQFAIEEINGNP----NLLPNISLGFDFYNVR..................FTGK--YILD.......
ENSMUSP00000023959  NEHRGIQRLEAMLFALDRINRDP----HLLPGVRLGAHILDSC..................SKDT--HALE.......
ENSMUSP00000126534  YNFKNYQYILALLFAIEEINGNP----NILPNISLGFDFYNVR..................FTEK--DTLM.......
ENSMUSP00000126756  YNFKNYKYILALQFSIEEINRNP----NLLPNTSLGFDFYNVR..................FTEK--YTLD.......
ENSMUSP00000078200  YNFKNYQYILALQFAIEEINGNP----NLLPNISLGFDFYNVR..................FTEK--DTLM.......
ENSMUSP00000129313  YNFKNYQYILALQFAIEEINGNP----NLLPNISLGFDFYNVR..................FTGK--YIHS.......
ENSMUSP00000130373  YNFKNYQYILALVFAIEEINDNP----NLLPNISLGFDFYNVR..................FIEK--DTLM.......
ENSMUSP00000128350  YNFKNYQYILALLFAIEEINGNP----NLLPNISLGFDFYNVR..................FTEK--DTLM.......
ENSMUSP00000094994  --TENRKYALALAFSINEINRNP----DLLPNMSLIFKFSAENcvwenklmslmh......S--------Slqnydil
ENSMUSP00000090148  --TENRKYALALAFSINEINRNP----DLLPNMSLIFKFSAHN..................CVWE--SEIMnlmllsl
ENSMUSP00000131261  YNFKNYQYILALQFAIEEINGNP----NLLPNISLGFDFYNVR..................FTGK--YILD.......
ENSMUSP00000131925  -----------MIHTIKEINERK----DILPNHTLGYQIFDTC..................FSVS--KAME.......
ENSMUSP00000130114  INARNYQLVLAMLFAVNEINLNS----HILPNTSLGLEIYNLPaigrnifrtvfswl....TGLS--SVIP.......
ENSMUSP00000131583  YNFKNYQYILALQFAIEEINGNP----NLLPNISLGFDFYNVR..................FTEK--FTLD.......
ENSMUSP00000126885  -----HKYALALAFSIYEINRNP----DILPNMSLTFKFSNYN..................CHWK--SKYN.......
ENSMUSP00000127981  -----HKYALVLAFSINEVNRNS----DLLPNMSLIFTFSALI..................CDYE--SQLK.......
ENSMUSP00000132299  MSERNYQLVLAMLFAINEINLNS----HILPNTSLGLEIYNLPaigrnifrtvfswl....TGLS--SVIP.......
ENSMUSP00000131447  -----HKYALALAFSIYEINMNP----DILPNMSLIFEFSVHN..................CVWE--SKLMsfmhvsl
ENSMUSP00000128106  -----HKYALALAFSIYEINRNP----DLLPNMSLIFIFSADS..................CEWE--SELSlirfglq
ENSMUSP00000077109  -----------MIHTIKEINERK----DILPNHTLGYQIFDTC..................FSVS--KAME.......
ENSMUSP00000020547  MSGRNYQLVLAMLFAINEINLNS----HILPNTSLGLEIYNLPaigrnifrtvfswl....TGLS--SVIP.......
ENSMUSP00000131450  IPARRYEVFLVMFFATDEINRNP----YLLPNMSLIFCLIVGM..................CGDT--LGYLeethspn
ENSMUSP00000125126  IAASEYEFLLVMFFATDEINKNP----YLLPNITLMFSIIGGN..................CHDLL-RGLDqaytqin
ENSMUSP00000126386  YNFKNYQYILALLFAIEEINGNP----YILPNISLGFDFYNTK..................YTER--DTLVftflwl.
ENSMUSP00000127505  -----YKNVLALAFSIYEINRNP----DILPNMSVRFTISKYN..................CYWE--SELMslihlsl
ENSMUSP00000124065  ISASEYEFLLVMFFATDEINKNP----YLLPNITLIFSIVGGH..................CHDLL-RGLDqsytqin
ENSMUSP00000132478  ------HLISSVYFAAEEINRNS----YILPNTSLIVKIECNLiadnvkriws........LKKK--EIIP.......
ENSMUSP00000127838  IPARRYEFLLVMYFATDEINRNP----YLLPNMSLIFSLIVGM..................CEDT--LGYIeekyspq
ENSMUSP00000127513  -----------MIHTIKEINERK----DILPNHTLGYQIFDNC..................FSIT--KAME.......
ENSMUSP00000129215  IPASEYEFVLVMFFATDEINKNP----DLLPNTSLVFSVIGGK..................CQDS--LGLLgeeyili
ENSMUSP00000126953  IPARRYEYFLVLFFATDEINKNP----DLLPNMSLIVWLLSGQ..................CGDE--WSVLhknysqe
ENSMUSP00000071670  IAASEYELLLVIFFATDEINKNS----YLLPNMTLMFSIIGGN..................CHDL--LRSLdqeytei
ENSMUSP00000131831  -----------MIHTIKEINERK----DILPNHTLGYQIFDNC..................FSTT--KAME.......
ENSMUSP00000133218  IPTRRYEFFLVLFFATDEINKNP----DLLPNISLIFWLFGGQ..................CEDE--WGVL.......
ENSMUSP00000092079  IPASEYEFVLVMFFATNEINKNP----DLLPNTSLVFSVMAGN..................CQDS--LGNLdiqymlt
ENSMUSP00000126698  ------HLISSVYFAAEEINKNI----YILPNISLIVKIECNLiadnvkriws........LKKK--EIIP.......
ENSMUSP00000128015  ---RRHEFFLVLFFATDEINKNP----YLLPNMSLIFPEDPGQ..................CEKL--LGELdkihsea
ENSMUSP00000129540  --------ISSVYFAIEEINRNI----HILPNISLLVKIDCNLiednvervws........LKKK--EIIP.......
ENSMUSP00000126596  IPASEYEFVLVMFFATDEINKNP----DLLPNTSLVFSVMAGK..................CQDS--LGNLdiqymli
ENSMUSP00000128333  IPARRYEFFLVMFFATDEINKNP----YLLPNMSLISPVDHGQ..................CEET--LGLLdeiylek
ENSMUSP00000128792  MPAREYEFVLVMFFATDEINKNP----DLLPNTSLVFSVMADK..................CQDS--LGILdlkymlv
ENSMUSP00000129520  IPARRYEFFLVLFFATDEINKNP----DLLPNMSLIVWLLGGQ..................CGDE--WSVLyknysqe
ENSMUSP00000052977  IPARRYEFFLVLFFATDEINKNP----YLLPNMSLISPITSGQ..................CEKT--LGDLdkiysek
ENSMUSP00000078162  -PARRYEFFLVMFFATDEINKNP----YLLPNMSLIFPINHGQ..................CEKT--LGDLdkiysek
ENSMUSP00000132467  ------KYALALAFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000129566  ----GYRVAQSFVFAIEEINRST----HLLPNLTLGFSIRNSG..................DSAH--GALYetmgflt
ENSMUSP00000036551  ----NIHLILALLFAIKQINRNI----HILPNISLIVNVNCAKkedlqmtnmy........SNRD--ATIP.......
ENSMUSP00000126007  ---------FSVYLALEEINMNF----HILPNISLVVNIECLRkk................YDEK--TGLAlqteefi
ENSMUSP00000083386  ----GYRVTQSFVFAIEEINRSA----HLLPNLTLGFSIRNSG..................DSVH--GALYetmgflt
ENSMUSP00000129960  ------KYALALAFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKTVI--Ptpylfhk
ENSMUSP00000066737  YLFSLARVRPAIEYALRSVEGNGTGRKLLPPGTRFQVAYEDSD..................CGNRALFSLV.......
ENSMUSP00000074613  ------KYALALAFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000129578  ------KYALALAFAMDEINRNS----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000122645  --------IFSVYLAIEEINKDY----HILPNISLLVNIECDQriydkksglg........LKSK--EIIP.......
ENSMUSP00000104194  ------KYALALAFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000132834  ----GYRVAQSFVFAIEEINRSA----HLLPNLTLGFSIRNSG..................DSVH--GALYetmgflt
ENSMUSP00000093612  IPARRYEFFLVLFFATDEINKNP----YLLPNMSLISPIASGQ..................CEKT--LENLdkiysek
ENSMUSP00000126979  -----YRVAQSFVFAIEEINRSA----HLLPNLTLGFSIRNSG..................DSVH--GALYetmgflt
ENSMUSP00000126973  ---------FSVYLAMEEINKNG----HILPNISLLVNIECGLelygertgla........FKSE--EFIP.......
ENSMUSP00000127309  -----IHLILSLYFAIEEINMSP----HLLPNISLLVKVECKLladg..............SKVS--L--Ssrrgdyf
ENSMUSP00000126165  FNFRGFRWMKTMIHTIKEINERK----DILPEHTLGYQIFDNC..................FSTT--KAME.......
ENSMUSP00000131128  ----IHQYLLSLYFAMEEINSNP----YLLPNVSLGIEYFKGK..................CNGY--LSLF.......
ENSMUSP00000131990  ------KYALALAFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000127337  -----HKYALALVFAMDEINRNP----DLLPNMSLIIRYALGH..................CDGK--TVTPtpylfhk
ENSMUSP00000030191  YAWAWPRVGPAVALAVEALGRAL------PVDLRFVSSELDGA..................CSEY--LAPL.......
ENSMUSP00000133007  ------KYALALVFSMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000131780  -----HKYALALVFAMDEINRNP----DLLPNMSLIIRYALGH..................CDGK--TVTPtpylfhk
ENSMUSP00000132457  -----HKYALALVFAMDEINRNP----DLLPNMSLIIRYALGH..................CDGK--TVTPtpylfhk
ENSMUSP00000076687  ---------FSVYLALEEINKNS----HILPNISLVVNIECVLlk................YGEK--TGLGlkheefi
ENSMUSP00000128102  ------KYALALAFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000132539  ------KYALALAFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000129411  ----------SVYLALDEINMNI----HILPNISMVANIECFL..................QKDGEKTGLAlqrkefi
ENSMUSP00000132726  ---------FSVYLALEEVNKNC----HILPNISLLVNIECNGrk................YDEK--TGLAlkienii
ENSMUSP00000132327  ------KYALALAFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000030792  FNGHGYHLFQAMRFTVEEINNST----ALLPNITLGYELYDVC..................SESSNVYATL.......
ENSMUSP00000133014  ----------SVYLALEEINMNF----HILPNISLVVNVECLRqk................YDEK--TGLAlqskefi
ENSMUSP00000126917  -----RHLIFSVYLALEEINKNC----HILPNISLVVNIECVLdk................HDEKT-DFLFksedlip
ENSMUSP00000128337  -----HKYALALVFAMDEINRNP----DLLPNMSLIIRYALGH..................CDGK--TVTPtpylfhk
ENSMUSP00000132332  -----HKYALALVFAMDEINRNP----DLLPNMSLIIRYALGH..................CDGK--TVTPtpylfhk
ENSMUSP00000133265  -----HKYALALVFAMDEINRNP----DLLPNMSLIIRYALGH..................CDGKT--LTPtpylfhk
ENSMUSP00000126863  ------KYALALAFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000127146  ------KYALALAFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGKT--VIPtpylfhk
ENSMUSP00000130631  -----HKYALALVFAMDEINRNP----DLLPNMSLIIRYALGH..................CDGK--TVTPtpylfhk
ENSMUSP00000132337  ---------FSVYLALEEINKNC----HILPNISLLVNTECNGrk................YDEK--TGLAlksekiv
ENSMUSP00000072566  ------KYALALVFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGK--TVIPtpylfrk
ENSMUSP00000129466  ------KYALALVFAMDEINRNP----DLLPNMSLIIRYSLGH..................CDGK--TVIPtpylfrk
ENSMUSP00000075833  ------KYALALVFAMDEINRNP----DLLPNMSLIIRYTLGR..................CDGK--TVIPtpylfrk
ENSMUSP00000087221  IAASEYEILLIMFFATDEINKNP----YLLPNITLIFTIIGGH..................CHDL--LGGLdeaytqi
ENSMUSP00000124342  DLIKHYQHILAMVFAIEKINKDP----NILFNKSLGFFLFNVN..................FIEM--KAVE.......
ENSMUSP00000104190  ------KYALALVFAMDEINRYP----DLLPNMSLIIRYSLGH..................CDGKT--VTPtpylfhr
ENSMUSP00000083463  ------KYALALVFAMDEINRYP----DLLPNMSLIIRYSLGH..................CDGKT--VTPtpylfhr
ENSMUSP00000126682  DLTKHYQHMLAMVFAIEKINKDP----NILFNMTLGFSLFNVD..................FIEM--KAVE.......
ENSMUSP00000079827  ------KYALALVFAMDEINRNP----DLLPNMSLIIRYTLGL..................CDGKTVTPTPylfhkkk
ENSMUSP00000074476  ------KYALALVFSMDEINRNP----DLLPNMSLIIRYTLGR..................CDGK--TGIPtpyllhk
ENSMUSP00000069647  ------KYALALVFSMDEINRNP----DLLPNMSLIIRYTLGR..................CDGK--TGIPtpyllhk
ENSMUSP00000083477  ------KYALALAFSMDEINRNP----DLLPNMSLIIKYNLGR..................CDGKTMTNTAdfldqkk
ENSMUSP00000073604  HLTKHYQHILAMVFATEKINKDP----NILFNMSLGFYLFNVD..................YLEM--KAME.......
ENSMUSP00000072296  ------KYALALVFAMDEINRNP----DLLPNMSLIIRYTLGL..................CDGKTVT--Ptpylfhk
ENSMUSP00000129703  -----RHLIFSVYLALEEINDSF----HILPNISLVVNIECVLqk................YGEK--TGLLlrsekli
ENSMUSP00000083478  ------KYALALVFSMDEINRNP----NLLPNMSLIIRYTLGR..................CDGK--TGIPtpyllhk
ENSMUSP00000083468  ------KYALALVFAMDEINRNP----DLLPNMSLIIRYTLGL..................CDGKTVTPTPylfhkkk
ENSMUSP00000132043  DFTKHYQHILAMVFAIEKINKDP----NILFNMSLGFHVFNAD..................FTEM--KAMK.......
ENSMUSP00000092462  ------KYALALVFAMDEINRYP----DLLPNMSLIIRYSLGH..................CDGKTVTPTPylfhrkk
ENSMUSP00000092460  ------KYALALVFAMDEINRNP----DLLPNMSLIIRYTLGL..................CDGKTVTPTPylfhkkk
ENSMUSP00000130160  ------KYALALVFAMDEINRNP----DLLPNMSLIIRYTLGL..................CDGKTVTPTPylfhkkk
ENSMUSP00000098528  NLPKHYQHILAMVFAVETINKDP----NILFNMSLGFYLFDVD..................FIVM--KAME.......
ENSMUSP00000030949  FSPLGLFLAMAMKMAVEEINNGS----ALLPGLRLGYDLFDTC..................SEPV--VTMKsslmfla
ENSMUSP00000129352  ------KYALALAFSMDEINRNP----DLLPNMSLIIKYNLGH..................CDGKTMTNTAdfldrkk
ENSMUSP00000132206  ----NHKYALVLAFSINEVNRNS----DLLPNMSLIFTFSALI..................CDYE--SQLK.......
ENSMUSP00000032238  DLIKYYQHILAMVFAIEKINKDP----NILFNKSLGFFLFNVN..................FIEM--KAAE.......
ENSMUSP00000127506  -----------LYFAIDEINKDT----HLLPNVTLGFHIYNAFnfhprtlegplmwl....S--------Grnefip.
ENSMUSP00000074602  DLTRHYQHILAIVFAIENINKDP----HILFNMSLGFYLFNVN..................FIET--KAME.......
ENSMUSP00000128981  DFTKHYQHILAMVFAIEKINKDP----NILFNMSLGFHVFNVD..................FTEM--KAMK.......
ENSMUSP00000020062  FEISVFLQTLAMIHSIEMINNST-----LLSGVKLGYEIYDTC..................TEVT--AAMA.......
ENSMUSP00000129145  DFTKHYQHILAMVFAIEKINKDP----NILFNMSLGFHVFNVD..................FTEM--KAMK.......
ENSMUSP00000030510  MKVLGYNLMQAMRFAVEEINNCS----SLLPGVLLGYEMVDVC..................YLSNNIQPGL.......
ENSMUSP00000128600  ----------SVYLAMEEINKND----HILPNISLLVNIECGLelygertdla........LKSK--ELIP.......
ENSMUSP00000025338  WP-GGQACQPAVEMALEDVNSRR----DILPDYELKLIHHDSK..................CDPG--QATK.......
ENSMUSP00000092459  ------KYALALVFAMDEINRNP----DLLPNMSLIIRYTLGH..................CDRK--TGIPtpylfhk
ENSMUSP00000044521  PFFSKALPEVAAALAIERISRDK----TFDRSYSFEYVILNED..................CQTS--KALA.......
ENSMUSP00000127895  -------YALALVFAMDEINRNP----DLLPNMSLIIRYTLGL..................CDGKTVTPTPylfhkkk
ENSMUSP00000068253  HPFSVQRLGAGLQTVVDKLNSEP----VGLGNVSWEFTYTNST..................CSAK--ESLA.......
ENSMUSP00000103378  KGSIGRGVLPAVELAIEQIRNES-----LLRPYFLDLRLYDTE..................CDNA--KGLK.......
ENSMUSP00000131564  -------------------------------------------..................----------.......
ENSMUSP00000131156  -------------------------------------------..................----------.......
ENSMUSP00000077758  GPMG--AEELAFRFAVNTINRNR----TLLPNTTLTYDTQKINl.................YDSF--EASK.......
ENSMUSP00000095875  PIFAQALPSIATQLAVDQVNQDA----SLLPGSQLDFKVLPTG..................CDTP--HALA.......
ENSMUSP00000072107  ---------LAFKFAVTSINRNR----TLMPNTTLTYDIQRINl.................FDSF--EASR.......
ENSMUSP00000030676  NAQVMNAEEHAFRFSANIINRNR----TLLPNTTLTYDIQRIHf.................HDSF--EATK.......
ENSMUSP00000027020  QEYT------AFRLAIFLHNTSP-----NASEAPFNLVPHVDN..................IETANSFAVT.......
ENSMUSP00000032338  YKEPMQNLREAVEEGLDIVRKRL---READLNVTVNATFIYSDglihksgd..........CRSSTCEGLD.......
ENSMUSP00000109949  ------KHEQMFREAVNQANKRH-----GSWKIQLNATSVTHK..................PNAIQ-MALS.......
ENSMUSP00000044494  Q------EHAAFRFALSQLTEPP----KLLPQIDIVNISDS--..................---F--EMTY.......
ENSMUSP00000103375  QEYSAFRVGM------V-----------QFSTSEFRLTPHIDN..................LEVANSFAVT.......
ENSMUSP00000075687  ------QEHSAFRFAVQLYNTNQ---NTTEKPFHLNYHVDHLD..................SSNS--FSVT.......
ENSMUSP00000021259  PIFARARPDLAARLAANRLNRDF----ALDGGPRFEVALLPEP..................CLTP--GSLG.......
ENSMUSP00000034515  -MECSRGERLSITLAKNRINRAP----ERLGKAKVEVDIFELL..................RDSE--YETA.......
ENSMUSP00000003468  ----GRGERLALALAREQINGII----EVPAKARVEVDIFELQ..................RDSQ--YETT.......
ENSMUSP00000093536  ----AKKDDEVFRTAVGDLNQNE----EILQTEKITFSVTFVDg.................NNPF--QAVQ.......
ENSMUSP00000044009  -----AKDDRVFQLAVSDLSLND----DILQSEKITYSIKVIEa.................NNPF--QAVQ.......
ENSMUSP00000129679  -------------------------------------------..................----------.......
ENSMUSP00000062284  -------------------------------------------..................-DPK--SIIT.......
ENSMUSP00000002848  ------RLGPAVAAAV------------RSPGLDVRPVALVLNg.................SDPR--SLVL.......
ENSMUSP00000091381  ----------ALLFAVENLNRVE---GLLPYNLSLEVVMAIEAglgdlplmpfsspsspwsSDPF--SFLQ.......
ENSMUSP00000032331  -------------------------------------------..................TDPK--SLIT.......
ENSMUSP00000097013  -------------------------------------------..................----------.......
ENSMUSP00000003351  -------------------------------------------..................----------.......
ENSMUSP00000105373  -------------------------------------------..................----------.......
ENSMUSP00000093345  -------------------------------------------..................----------.......


                                     80                                                           90
                                      |                                                            |
d1jdpa_               .........DRVAAARG............................AK...............P..DLIL.....G.PV
ENSMUSP00000037255  .........QSIEFIRDslisirdekdglnrclpdgqtlppgrtkKP...............I..AGVI.....G.PG
ENSMUSP00000129181  .........QSIEFIRDslisseeeeglvrcvdgsssfrsk....KP...............I..VGVI.....G.PG
ENSMUSP00000131856  .........RAFIWHTGkinsfpnfdcghkr..............KS...............P..AILT.....G.P-
ENSMUSP00000126650  ..mlpyaipNYSCENKS............................NP...............P..AALT.....G.T-
ENSMUSP00000029540  .........AAVDLKWE............................HS...............P..AVFL.....G.PG
ENSMUSP00000125817  ..glsnqlvNYNCGQKR............................NL...............P..AALT.....G.T-
ENSMUSP00000113819  .........QSLTFVQAliekdgtevrcgsggppiitkp......ER...............V..VGVI.....G.AS
ENSMUSP00000129576  .........HAFIWHTGkinsipncdyghkr..............KS...............P..AILT.....G.P-
ENSMUSP00000126966  ..riinplpNCDCGQKR............................KS...............P..VVLT.....G.P-
ENSMUSP00000129089  ..glsnqlvNYNCGQKR............................NL...............P..AALT.....G.T-
ENSMUSP00000128493  ..gishplpNCDCGHKR............................TS...............P..AVLT.....G.P-
ENSMUSP00000069080  .........ATLSFVAQnkidslnldefcncsehi..........PS...............T..IAVV.....G.AT
ENSMUSP00000064404  .........QSLTFVQAliqkdtsdvrctngeppvfvkp......EK...............V..VGVI.....G.AS
ENSMUSP00000129068  ..glsnqliNYNCGQKR............................NL...............P..AALT.....G.T-
ENSMUSP00000129308  ..glsnqliNYNCGQKR............................NL...............P..AALT.....G.T-
ENSMUSP00000087998  .........QSLTFVQAliekdasdvkcangdppiftkp......DK...............I..SGVI.....G.AA
ENSMUSP00000129762  .........NVCMWLTA............................HRekfilpnyncekkyfT..AALT.....G.T-
ENSMUSP00000000631  .........QALSFVQAlirgrgdgeeasvrcpggvpplraapp.ER...............V..VAVV.....G.AS
ENSMUSP00000129296  .........NYTCRKES............................KL...............I..AVVT.....G.T-
ENSMUSP00000129895  .........FTCRWLTAhvkramipnytckr..............RN...............Vi.AALT.....G.S-
ENSMUSP00000048706  .........NTVIWLTAhvqrkvlpnynckks.............NF...............T..AAIT.....G.T-
ENSMUSP00000029406  .........SSLVFLTGqeefkpnfrnstg...............ST...............L..AALV.....G.SG
ENSMUSP00000126559  .........NAFIWLTAlvnrkyfpnynckkr.............NF...............T..AALT.....G.T-
ENSMUSP00000127465  .........NVFIWLSAlvqrnylpnynckkr.............NF...............T..AALT.....G.T-
ENSMUSP00000129347  .........NVCFWLTG............................QGqkkilpnyncaknnfT..TALT.....G.T-
ENSMUSP00000131426  .........NVFYWLTGlstfipnyscrkns..............KS...............A..ATLT.....G.I-
ENSMUSP00000128685  .........NVFIWLSAlvqrnylpnynckkr.............TF...............T..AALT.....G.T-
ENSMUSP00000132641  .........NACFWLIS............................QGqkkilpnyncakrnfT..AALT.....G.T-
ENSMUSP00000004076  .........QSLEFVRAsltkvdeaeymcpdgsyaiqenip....LL...............I..AGVI.....G.GS
ENSMUSP00000124192  .........SSSVFLTGqeeykpnwrnstg...............KF...............L..IGII.....G.AG
ENSMUSP00000128975  ..kyasnflNYNCGLRK............................RC...............D..VVLT.....G.PS
ENSMUSP00000126106  .........ITFNWLTAlgdgnhipnynckk..............RNf..............T..AALR.....G.T-
ENSMUSP00000023959  .........QALDFVRAslsrgadgsrhicpdgsyatlsdap...TA...............I..TGVI.....G.GS
ENSMUSP00000126534  .........NAFNWFTNrrkkkilpnyncnk..............KKf..............S..AALT.....G.T-
ENSMUSP00000126756  .........NVFIWLTAlvhrkyfpnynckkr.............NF...............T..AALT.....G.T-
ENSMUSP00000078200  .........NAGIWLTShvhkmvfpnytcgkk.............KF...............T..AALT.....G.S-
ENSMUSP00000129313  .........NTFNWLTAlgdgnyipnynckkr.............NF...............T..AALT.....G.T-
ENSMUSP00000130373  .........NVCFWLTG............................QGqknilpnyncgksnfA..TALT.....G.T-
ENSMUSP00000128350  .........NAGIWLTAhverkvlpnynckkr.............NF...............T..AAFT.....G.T-
ENSMUSP00000094994  ........pNYLCEEYT............................EC...............V..MALT.....S.L-
ENSMUSP00000090148  ..qnydifpNYLCKEYT............................KC...............A..MALT.....N.L-
ENSMUSP00000131261  .........ITFNWLTAlgernyipnynckkr.............NF...............T..AALT.....G.T-
ENSMUSP00000131925  .........TAMTLLTGqeekkpnyrnstg...............KY...............L..VGII.....G.SG
ENSMUSP00000130114  .........NYTCRKES............................KS...............A..ATLT.....G.L-
ENSMUSP00000131583  .........NAFIWLTAlvqrkylpnysckkr.............NF...............T..AALT.....G.T-
ENSMUSP00000126885  .........SFIHLSLQnhdilpnymckeft..............KC...............A..MALT.....R.L-
ENSMUSP00000127981  .........SLIHLSLQnheifpnyicndd...............VC...............A..VALT.....G.L-
ENSMUSP00000132299  .........NYTCRKES............................NS...............A..VTLT.....G.V-
ENSMUSP00000131447  ..qnydifpNYLCKEYT............................KC...............A..MALT.....S.LN
ENSMUSP00000128106  ...nsdnlpNYLCEELT............................KC...............I..LALT.....N.MN
ENSMUSP00000077109  .........TALAFLTGqeenkpnfrnstg...............KY...............L..VGII.....G.AG
ENSMUSP00000020547  .........NYTCRKES............................NS...............A..ATLT.....G.V-
ENSMUSP00000131450  ...ntwnsiNYNCEIRP............................IC...............D..IELT.....G.PS
ENSMUSP00000125126  ...ghmnfvNYFCYLDD............................SC...............A..IGLT.....G.PS
ENSMUSP00000126386  .........T------Ahverkvlpnynckkr.............NF...............T..AALT.....G.T-
ENSMUSP00000127505  ..qnhdilpNYMCKELT............................RC...............T..MALTrl...N.WV
ENSMUSP00000124065  ...grvnfvNYFCYLDD............................SC...............N..IGLT.....G.PS
ENSMUSP00000132478  .........NYYCKNQR............................RY...............L..IVLT.....G.P-
ENSMUSP00000127838  ..knrlnfiNYNCGIPQ............................TC...............N..IQIT.....G.PS
ENSMUSP00000127513  .........SSSVFLTGqeeykpnwrnstg...............KF...............L..VGII.....G.AG
ENSMUSP00000129215  ..ndslnyvNYVCKADD............................TC...............V..IDLT.....G.PS
ENSMUSP00000126953  ..ninvkfiN------Ydclsp.......................AC...............Y..IDLT.....G.PS
ENSMUSP00000071670  ..kghmnfvNYFCYLDD............................SC...............A..IGFT.....G.PS
ENSMUSP00000131831  .........SSSVFLTG............................QDeyksnwrnstgkf..L..VGII.....G.AG
ENSMUSP00000133218  .........DTNYSQNNinvkfinydclsp...............NC...............Y..IDLT.....G.PS
ENSMUSP00000092079  ..ndslnyvNYVCDIDD............................SC...............A..IGLT.....G.PS
ENSMUSP00000126698  .........NYYCKNQR............................RY...............L..IVLT.....G.P-
ENSMUSP00000128015  ..kftvdftDYICAGYG............................TC...............Y..IGLI.....G.PS
ENSMUSP00000129540  .........NYYCKNQR............................RY...............L..IVLT.....G.P-
ENSMUSP00000126596  ..ndslnyvNYVCDIDD............................SC...............A..IGLT.....G.PS
ENSMUSP00000128333  ..nnsveftDYICVFYG............................TC...............Y..IGLI.....G.PS
ENSMUSP00000128792  ..ndtlnyvNYVCEADD............................SC...............A..IGLT.....G.PS
ENSMUSP00000129520  ..ninvefiN------Ydclsp.......................DC...............Y..IHLT.....G.PS
ENSMUSP00000052977  ..nitveftDNICVFYG............................AC...............Y..ISFI.....G.PS
ENSMUSP00000078162  ..nytveftDYICVSFG............................TC...............F..IALI.....G.PS
ENSMUSP00000132467  ..kkqspipNYFCNEET............................MC...............S..FLLT.....G.P-
ENSMUSP00000129566  ..gqeepipNYTCQH-G............................SP...............Q..AALV.....G.DT
ENSMUSP00000036551  .........NYNCKH-G............................RR...............Il.TVLT.....G.P-
ENSMUSP00000126007  ........pNYYCTD-E............................RR...............Y..LIIF.....T.AP
ENSMUSP00000083386  ..gqkepipNYTCQH-G............................SP...............Q..AALV.....G.DT
ENSMUSP00000129960  ..knqspipNYFCNEET............................MC...............S..FLLT.....G.P-
ENSMUSP00000066737  .........DRVAAARG............................AK...............P..DLIL.....G.PV
ENSMUSP00000074613  ..kkqspipNYFCNEET............................MC...............S..FLLT.....G.P-
ENSMUSP00000129578  ..kkqspipNYFCNEET............................MC...............S..FLLT.....G.P-
ENSMUSP00000122645  .........NYYCRN-Q............................RR...............Y..LIVL.....T.IP
ENSMUSP00000104194  ..kkqspipNYFCNEET............................MC...............S..FLLT.....G.P-
ENSMUSP00000132834  ..gqeepipNYTCQH-G............................SP...............Q..AALV.....G.DT
ENSMUSP00000093612  ..nhtvqftDNICVFYE............................TC...............Y..ISLI.....G.PS
ENSMUSP00000126979  ..gqeepipNYTCQH-G............................SP...............Q..AALV.....G.DT
ENSMUSP00000126973  .........NYYCRNHR............................KY...............L..IVLT.....T.P-
ENSMUSP00000127309  ........pNYNCGNHR............................RY...............L..IVLT.....G.P-
ENSMUSP00000126165  .........SSMVFLTGqdeykpkwrnstg...............KY...............L..IGII.....G.AG
ENSMUSP00000131128  .........TNLNIMTKyyhtfpnyicdpg...............AC...............E..IALT.....G.P-
ENSMUSP00000131990  ..ktkspipNYFCNEET............................MC...............S..FLLT.....G.TH
ENSMUSP00000127337  ..kkkspipNYFCNEES............................MC...............S..FLIS.....G.PN
ENSMUSP00000030191  .........RAVDLKLY............................HD...............P..DLLL.....G.PG
ENSMUSP00000133007  ..ktkspipNYFCNEET............................MC...............S..FLLT.....G.TH
ENSMUSP00000131780  ..kkkspipNYFCNEES............................MC...............S..FLIS.....G.PN
ENSMUSP00000132457  ..kkkspipNYFCNEES............................MC...............S..FLIS.....G.PN
ENSMUSP00000076687  ........pNYYCANER............................RY...............L..IVLT.....A.P-
ENSMUSP00000128102  ..ktkspipNYFCNEET............................MC...............S..FLLT.....G.TH
ENSMUSP00000132539  ..ktkspipNYFCNEET............................MC...............S..FLLT.....G.TH
ENSMUSP00000129411  ........pNYYCTD-E............................RR...............Y..LIIF.....T.AP
ENSMUSP00000132726  ........pNYSCTNER............................TY...............L..IVLT.....A.P-
ENSMUSP00000132327  ..ktkspipNYFCNEET............................MC...............S..FLLT.....G.TH
ENSMUSP00000030792  .........RVLAQQGTghlemqrdlrnhs...............SK...............V..VALI.....G.PD
ENSMUSP00000133014  ........pNYSCTN-E............................RR...............Y..LIIF.....T.AP
ENSMUSP00000126917  .........NYYCKNER............................RY...............L..IVLT.....A.P-
ENSMUSP00000128337  ..rkkspipNYFCNEES............................MC...............S..FLIS.....G.PN
ENSMUSP00000132332  ..rkkspipNYFCNEES............................MC...............S..FLIS.....G.PN
ENSMUSP00000133265  ..rkkspipNYFCNEES............................MC...............S..FLIS.....G.PN
ENSMUSP00000126863  ..ktkspipNYFCNEET............................MC...............S..FLLT.....G.TH
ENSMUSP00000127146  ..ktkspipNYFCNEET............................MC...............S..FLLT.....G.TH
ENSMUSP00000130631  ..rkkspipNYFCNEES............................MC...............S..FLIS.....G.PN
ENSMUSP00000132337  ........pNYSCTNER............................RY...............L..IVLT.....A.PI
ENSMUSP00000072566  ..kkespipNYFCNEET............................MC...............S..YLLT.....G.PH
ENSMUSP00000129466  ..kkespipNYFCNEET............................MC...............S..YLLT.....G.PH
ENSMUSP00000075833  ..kkespipNYFCNEET............................MC...............S..YLLT.....G.PH
ENSMUSP00000087221  ..ngrvkfvNYFCYSDD............................SC...............L..IGLT.....G.PS
ENSMUSP00000124342  .........GSMALLSGesppipnyscrpekt.............DK...............L..VAVI.....G.GI
ENSMUSP00000104190  ..kkqspipNYFCNEES............................MC...............S..FLLS.....G.PN
ENSMUSP00000083463  ..kkqspipNYFCNEES............................MC...............S..FLLS.....G.PN
ENSMUSP00000126682  .........SSVSLLSGesppipnyscrpekt.............DK...............L..VAVI.....G.GI
ENSMUSP00000079827  ....qspipNYFCNEET............................MC...............S..FQLS.....G.PK
ENSMUSP00000074476  ..kkqspipNYFCNEES............................MC...............S..FLLT.....G.P-
ENSMUSP00000069647  ..kkqspipNYFCNEES............................MC...............S..FLLT.....G.P-
ENSMUSP00000083477  ....ykripNYFCNEET............................MC...............S..FLLT.....G.PD
ENSMUSP00000073604  .........SSMALISGesppipnyscrpekt.............DK...............L..VAVI.....G.GI
ENSMUSP00000072296  ..kkqspipNYFCNEET............................MC...............S..FLLS.....G.PK
ENSMUSP00000129703  ........pNYYCINER............................RY...............L..IVLT.....A.PT
ENSMUSP00000083478  ..kkqspipNYFCNEES............................MC...............S..FLLR.....G.P-
ENSMUSP00000083468  ....qspipNYFCNEET............................MC...............S..FQLS.....G.PK
ENSMUSP00000132043  .........SSMVLLSGesppipnyscrpekt.............DK...............L..VAVI.....G.GI
ENSMUSP00000092462  ....qspipNYICNEES............................MC...............S..FLLS.....G.PN
ENSMUSP00000092460  ....qspipNYFCNEET............................MC...............S..FQLS.....G.PK
ENSMUSP00000130160  ....qspipNYFCNEET............................MC...............S..FQLS.....G.PK
ENSMUSP00000098528  .........SCMVLISGerppipnyscrpekt.............NK...............P..VAVI.....G.GY
ENSMUSP00000030949  kvgsqsiaaYCNYTQYQ............................PR...............V..LAVI.....G.PH
ENSMUSP00000129352  ....ykripNYFCNEET............................KC...............S..FLLT.....G.PD
ENSMUSP00000132206  .........SLIHLSLQnheifpnyicndd...............VC...............A..VALT.....G.L-
ENSMUSP00000032238  .........GSMALLSGesppipnyscrpekt.............DK...............L..VAVI.....G.GI
ENSMUSP00000127506  .........NYKCKT-Q............................YK...............A..LGII.....S.GT
ENSMUSP00000074602  .........SSMGLLSGesppipnytcrpekt.............DK...............L..VAVI.....G.GI
ENSMUSP00000128981  .........SSMVLLSGesppvpnyscrpekt.............DK...............L..VAVI.....G.GI
ENSMUSP00000020062  .........ATLRFLSKfncsretvvfqcdyssym..........PR...............V..KAVI.....G.AG
ENSMUSP00000129145  .........SSMVLLSGesppvpnyscrpekt.............DK...............L..VAVI.....G.GI
ENSMUSP00000030510  .........YFLSQIDDflpilkdysqyr................PQ...............V..VAVI.....G.PD
ENSMUSP00000128600  .........NYYCRNHR............................RY...............L..IVLT.....T.P-
ENSMUSP00000025338  .........YLYELLYN............................DP...............I..KIIL.....M.PG
ENSMUSP00000092459  ......kkqS-------............................-Pihdyfcneetm....C..SFLL.....S.ES
ENSMUSP00000044521  .........SFISH--Q............................QM...............A..SGFV.....G.PA
ENSMUSP00000127895  ....qspipNYFCNEET............................MC...............S..FQLS.....G.PK
ENSMUSP00000068253  .........VFIDQVQK............................EH...............I..SALF.....G.PA
ENSMUSP00000103378  .........AFYDAI-K............................YG...............PnhLMVF.....G.GV
ENSMUSP00000131564  .........--------............................--...............-..----.....-.--
ENSMUSP00000131156  .........--------............................--...............-..----.....-.--
ENSMUSP00000077758  .........KACDQL-S............................LG...............V..AAIF.....G.PS
ENSMUSP00000095875  .........TFVAH--K............................NI...............V..AAFV.....G.PV
ENSMUSP00000072107  .........RACDQL-A............................LG...............V..AALF.....G.PS
ENSMUSP00000030676  .........KACDQL-A............................LG...............V..VAIF.....G.PS
ENSMUSP00000027020  .........NAFCSQYS............................RG...............V..FAIF.....G.LY
ENSMUSP00000032338  .........LLREITRD............................HK...............Mg.CALM.....G.PS
ENSMUSP00000109949  .........VCEDLI-S............................SQ...............V..YAILvshppT.PN
ENSMUSP00000044494  .........RFCSQF-S............................KG...............V..YAIF.....G.FY
ENSMUSP00000103375  .........NAFCSQFS............................RG...............V..YAIF.....G.FY
ENSMUSP00000075687  .........NAFCSQFS............................RG...............V..YAIF.....G.FY
ENSMUSP00000021259  .........AVSSAL--............................SR...............V..SGLV.....G.PV
ENSMUSP00000034515  .........ETMCQILP............................KG...............V..VAVL.....G.PS
ENSMUSP00000003468  .........DTMCQILP............................KG...............V..VSVL.....G.PS
ENSMUSP00000093536  .........EACELM-N............................QG...............I..LALV.....S.SI
ENSMUSP00000044009  .........EACDLM-T............................QG...............I..LALV.....T.ST
ENSMUSP00000129679  .........--------............................--...............-..----.....-.--
ENSMUSP00000062284  .........RICDLMSD............................RK...............I..QGVVf....A.DD
ENSMUSP00000002848  .........QLCDLLSG............................LR...............V..HGVV.....F.E-
ENSMUSP00000091381  .........SVCHTVVV............................QG...............V..SALL.....AfPQ
ENSMUSP00000032331  .........HVCDLMSG............................AR...............I..HGLVf....G.DD
ENSMUSP00000097013  .........--------............................--...............-..----.....-.--
ENSMUSP00000003351  .........--------............................--...............-..----.....-.--
ENSMUSP00000105373  .........--------............................--...............-..----.....-.--
ENSMUSP00000093345  .........--------............................--...............-..----.....-.--


                                      100                        110                 120            
                                        |                          |                   |            
d1jdpa_               CEYAA.........APVAR..LASHW...D....LPM........LS..........AGALAAGFQ...........H
ENSMUSP00000037255  SSSVA.........IQVQN..LLQLF...D....IPQ........IA..........YSATSID-L...........S
ENSMUSP00000129181  SSSVA.........IQVQN..LLQLF...N....IPQ........IA..........YSATSMD-L...........S
ENSMUSP00000131856  SWSTS.........AHIGT..FLQLY...K....IPQ........VT..........FGPFDSI-L...........N
ENSMUSP00000126650  SWSTS.........AHIGT..LLQLY...K....IPQ........LT..........FGPFDSI-L...........N
ENSMUSP00000029540  CVYSA.........APVGR..FTAHW...R....VPL........LT..........AGAPALG-I...........G
ENSMUSP00000125817  SWAIS.........AHIGT..LLQLY...K....IPQ........FT..........FGHFDSN-M...........N
ENSMUSP00000113819  GSSVS.........IMVAN..ILRLF...K....IPQ........IS..........YASTAPD-L...........S
ENSMUSP00000129576  SWSTS.........AHIGT..FLQLY...K....IPQ........LT..........FGPFDSI-L...........N
ENSMUSP00000126966  SWSAS.........AHIGT..FLQLY...K....IPQ........VT..........FGPFDSI-L...........N
ENSMUSP00000129089  SWAIS.........AHIGT..LLQLY...K....IPQ........LT..........FAYFDSN-M...........N
ENSMUSP00000128493  SWSAS.........AHIGT..FLQLY...K....IPQ........LT..........FGPFDSI-L...........N
ENSMUSP00000069080  GSGVS.........TAVAN..LLGLF...Y....IPQ........VS..........YASSSRL-L...........S
ENSMUSP00000064404  GSSVS.........IMVAN..ILRLF...Q....IPQ........IS..........YASTAPE-L...........S
ENSMUSP00000129068  SWAIS.........AHIGT..LLQLY...K....IPQ........VStq........FGYFDSN-M...........N
ENSMUSP00000129308  SWAIS.........AHIGT..LLQLY...K....IPQ........VSklt.......FGYFDSN-M...........N
ENSMUSP00000087998  ASSVS.........IMVAN..ILRLF...K....IPQ........IS..........YASTAPE-L...........S
ENSMUSP00000129762  SWTIS.........AQIGT..LFQLF...K....FPQ........LS..........FGPYDPI-L...........S
ENSMUSP00000000631  ASSVS.........IMVAN..VLRLF...A....IPQ........IS..........YASTAPE-L...........S
ENSMUSP00000129296  SWEFP.........SRIST..ILGLY...K....YPQ........LT..........FGPFDPM-L...........S
ENSMUSP00000129895  SWITS.........AQIGT..LLQLF...K....FPQ........IT..........FGPYEPT-L...........S
ENSMUSP00000048706  SWITS.........AQIGT..LLQLF...K....FPQ........IT..........FGPYDPF-L...........S
ENSMUSP00000029406  GSSLS.........VAASR..ILGLY...Y....MPQ........VG..........YTSSCSI-L...........S
ENSMUSP00000126559  SWITS.........AQIGT..LLQLF...K....FPQ........IT..........FGPYDPL-L...........S
ENSMUSP00000127465  SWKTS.........AQIGT..LLQFL...K....FPQ........IT..........FGPYDPL-L...........S
ENSMUSP00000129347  SWTTS.........AQIGT..LLQLF...K....FPQ........LS..........FGPYDPI-L...........S
ENSMUSP00000131426  LWKTS.........ENIGT..VLDLY...K....FPQ........IT..........FGPFDHD-Q...........I
ENSMUSP00000128685  SWKTS.........AQIGT..LLQFL...K....FPQ........IT..........FGPYDPL-L...........S
ENSMUSP00000132641  SWTTS.........AQIGT..LLQLF...K....FPQ........LS..........FGPYDPI-L...........S
ENSMUSP00000004076  YSSVS.........IQVAN..LLRLF...Q....IPQ........IS..........YASTSAK-L...........S
ENSMUSP00000124192  GSTMS.........AAVSR..IVGIH...H....VPQ........VG..........YASSSSI-F...........S
ENSMUSP00000128975  QTISV.........----K..LAINY...R....RPK........VF..........FGPFNPN-L...........S
ENSMUSP00000126106  SWITS.........AQIGT..LLQLF...K....FPQ........IT..........FGPYDLL-L...........S
ENSMUSP00000023959  YSDVS.........IQVAN..LLRLF...Q....IPQ........IS..........YASTSAK-L...........S
ENSMUSP00000126534  SWTTS.........AQIST..LFQLF...K....FPQ........LS..........YGPYDPI-L...........S
ENSMUSP00000126756  SWIIS.........AQIGT..LLQLF...K....FPQ........IT..........FGPYDLL-L...........S
ENSMUSP00000078200  SWMAS.........AQIGT..LLHLF...K....FPQ........IT..........FGPYDPL-L...........S
ENSMUSP00000129313  SWITS.........AQIGT..LLQLF...K....FPQ........IS..........FGPYDLL-L...........S
ENSMUSP00000130373  AWTTS.........AQIGT..LLQLF...K....FPQ........LS..........FGPYDSI-L...........S
ENSMUSP00000128350  SWITS.........AQIGT..LLHLF...K....FPQ........IT..........FGPYDPL-L...........S
ENSMUSP00000094994  NWATT.........VTLYT..ILNNF...Mseq.FLQ........IT..........YGPFHPV-L...........S
ENSMUSP00000090148  NWATT.........VTLYT..ILNNIiseQ....FLQ........IT..........YGPFHPV-L...........S
ENSMUSP00000131261  SWITS.........AQIGT..LLQLF...K....FPQ........IN..........FGPYDLL-L...........S
ENSMUSP00000131925  GSSLS.........VTAAR..IFGLY...Y....MPQ........VG..........YTSSSAI-L...........S
ENSMUSP00000130114  SWKTS.........ETIWT..ILDLY...K....FPQ........LT..........FGPFDPV-Q...........I
ENSMUSP00000131583  SWVTS.........AQIGT..LLQLF...K....FPQ........IN..........FGPYDPL-L...........S
ENSMUSP00000126885  NWATT.........VKLNT..ILNNF...Msqq.FLQ........IT..........YGPFHPV-L...........S
ENSMUSP00000127981  NWTTT.........LTLYT..ILNNFishQ....FLH........LT..........YGPFHPV-L...........S
ENSMUSP00000132299  SWKTS.........ETIWT..ILDLY...K....FPQ........LT..........FGPFDPV-Q...........I
ENSMUSP00000131447  WATTV.........-KFNT..ILNNFisqQ....FFQ........IT..........YGPFHPV-L...........S
ENSMUSP00000128106  WATTV.........TLHTI..LSNFL...Sdq..LLH........IT..........YGTFHPA-L...........S
ENSMUSP00000077109  GSSLS.........VAAAR..ILGLY...Y....IPQ........VG..........YTSSCAV-L...........S
ENSMUSP00000020547  SWKTS.........ETIWT..ILDLY...K....FPQ........LT..........FGPFDPV-Q...........I
ENSMUSP00000131450  WTTSV.........----K..LAINS...R....KPK........VF..........FGPFNSH-L...........S
ENSMUSP00000125126  WKTSL.........----K..LAMHS...S....MPL........VF..........FGSFNPN-L...........H
ENSMUSP00000126386  SWITS.........AQIGT..LLQLF...K....FPQ........IT..........FGPYDTI-L...........S
ENSMUSP00000127505  TTVKL.........NTILN..NFISQ...Q....FFQ........IT..........YGPFHPV-L...........S
ENSMUSP00000124065  WKKSL.........----K..LAMDS...S....IPM........VF..........FGPFNPN-L...........R
ENSMUSP00000132478  IWITS.........YILGP..FLYFS...Q....TPE........LY..........CGHFHLL-L...........N
ENSMUSP00000127838  WTTSL.........----K..LAINS...R....RPK........VF..........FGPFNPN-L...........S
ENSMUSP00000127513  GSTMS.........VAVSR..IVGIH...R....VPQ........VG..........YASSSSI-F...........S
ENSMUSP00000129215  WKTSL.........----K..LAIDS...W....TPK........VF..........FGPFNPN-L...........S
ENSMUSP00000126953  WKTSL.........----K..MSIQS...R....TPK........VF..........FGPFNPD-L...........R
ENSMUSP00000071670  WKTSL.........----K..LGLHS...S....MPL........VF..........FGPFNPN-L...........R
ENSMUSP00000131831  GSTMS.........AAVSR..IVGIH...N....VPQ........VG..........YASSSSI-F...........S
ENSMUSP00000133218  WKTSLklpniltiiVLMWM..SHPLF...Y....ILQ........VF..........FGSFNPN-L...........S
ENSMUSP00000092079  WKTSL.........----K..LAIDS...W....TPT........VF..........FGPFNPK-L...........S
ENSMUSP00000126698  IWITS.........YILGP..FLYFS...Q....TPE........LY..........CGHFHFL-L...........N
ENSMUSP00000128015  WKTSV.........----K..LSTNS...G....TPR........VF..........FGPFNPK-L...........S
ENSMUSP00000129540  IWITS.........YILGP..FLYFS...R....TPE........LY..........CGYFHLL-L...........S
ENSMUSP00000126596  WKTSL.........----K..LAIDS...W....TPT........VF..........FGPFNPN-L...........S
ENSMUSP00000128333  WKTSV.........----K..LSIHS...R....TPRvrmcetrlVF..........FGPFNPN-L...........S
ENSMUSP00000128792  WKASL.........----K..LAIDT...W....APK........VF..........FGPFNPN-L...........S
ENSMUSP00000129520  WKTSL.........----K..MSIQS...R....TPK........LF..........FGPFNPN-L...........S
ENSMUSP00000052977  WKTSV.........----K..LSIHT...G....TPR........VF..........FGPFNPK-L...........S
ENSMUSP00000078162  WKTSI.........----K..LSINS...G....TPR........VF..........FGPFNPK-L...........S
ENSMUSP00000132467  NWGVS.........ISFWK..YLDSFlspR....ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000129566  RSSLS.........VSMAR..LLGLY...K....FPQ........VS..........YSSSLPS-L...........S
ENSMUSP00000036551  RWFSS.........AILGP..FLHIF...A....IPQ........LY..........YGPFHPL-L...........S
ENSMUSP00000126007  IWAVT.........TRLGT..FMFMY...S....IPE........LY..........CGHFHLS-L...........S
ENSMUSP00000083386  RSSLS.........VSMAR..LLGLY...K....FPQ........VS..........YSSSLPS-L...........S
ENSMUSP00000129960  NWGVS.........ISFWK..YLDSFlspR....ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000066737  CEYAA.........APVAR..LASHW...D....LPM........LS..........AGALAAGFQ...........H
ENSMUSP00000074613  NWGVS.........ISFWK..YLDSFlspR....ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000129578  NWGVS.........ISFWK..YLDSFlspR....ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000122645  EWTVS.........TSLGP..FLYIS...R....IPE........LY..........CGNFHLL-L...........N
ENSMUSP00000104194  NWGVS.........ISFWK..YLDSFlspR....ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000132834  RSSLS.........VSMAR..LLGLY...K....FSQ........VS..........YSSSLPS-L...........S
ENSMUSP00000093612  WKTSV.........----K..LSIHH...G....TPR........VF..........FGPFNPK-L...........S
ENSMUSP00000126979  RSSLS.........VSMAR..LLGLY...K....FPQ........VS..........YSSSLPS-L...........S
ENSMUSP00000126973  KWGVS.........TSLGP..LLYIS...R....VPE........LY..........CGHFHLL-L...........N
ENSMUSP00000127309  MWLPT.........AMLGP..LLYIS...R....TPEvrr.....LY..........YGPFHPL-L...........S
ENSMUSP00000126165  GSTMS.........LAGAR..ILLNY...K....YFQ........FQvg........YASSSSI-L...........T
ENSMUSP00000131128  LWISS.........AQVAT..ILQLK...F....IPQvrq.....IT..........YGPFYPL-L...........S
ENSMUSP00000131990  WEVSL.........SFWKY..LDSFL...Spr..ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000127337  WKVSL.........SFWKY..LDSFL...Spr..IFQ........LT..........YGPFSSI-F...........S
ENSMUSP00000030191  CVYPA.........ASVAR..FASHW...R....LPL........LT..........AGAVASGFA...........A
ENSMUSP00000133007  WEVSL.........SFWKY..LDSFL...Spr..ILQ........LT..........YGPFHSI-F...........S
ENSMUSP00000131780  WKVSL.........SFWKY..LDSFL...Spr..IFQ........LT..........YGPFSSI-F...........S
ENSMUSP00000132457  WKVSL.........SFWKY..LDSFL...Spr..IFQ........LT..........YGPFSSI-F...........S
ENSMUSP00000076687  IWAVS.........TKLGP..FLFMS...R....IPE........LY..........CGHFHLP-L...........S
ENSMUSP00000128102  WEVSL.........SFWKY..LDSFL...Spr..ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000132539  WEVSL.........SFWKY..LDSFL...Spr..ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000129411  IWAVT.........TRLGP..LMFMY...S....IPE........LY..........CGHFHLS-L...........N
ENSMUSP00000132726  IWAVS.........TKLGP..FLFMS...R....IPE........LY..........CGHFHPL-L...........S
ENSMUSP00000132327  WEVSL.........SFWKY..LDSFL...Spr..ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000030792  NTDHA.........VTTAA..LLSPF...L....MPL........VS..........YEASSVI-L...........S
ENSMUSP00000133014  IWAVT.........TRLGP..LMFMY...S....IPE........LY..........CGHFHLS-L...........S
ENSMUSP00000126917  LWAVS.........SSIGP..YLFMS...R....IPE........VSqly.......CGHFHLP-L...........S
ENSMUSP00000128337  WKVSL.........SFWDY..LDSFL...Spr..ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000132332  WKVSL.........SFWDY..LDSFL...Spr..ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000133265  WKVSL.........SFWDY..LDSFL...Spr..ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000126863  WEVSL.........SFWKY..LDSFL...Spr..ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000127146  WEVSL.........SFWKY..LDSFL...Spr..ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000130631  WKVSL.........SFWDY..LDSFL...Spr..ILQ........LT..........YGPFSSI-F...........S
ENSMUSP00000132337  WAVST.........KL---..-----...-....GPF........LS..........YCCLCPVFFqlycghfhlllS
ENSMUSP00000072566  WEVSL.........GFWKH..MNSFL...Spr..ILQ........LT..........YGPFHSI-F...........S
ENSMUSP00000129466  WEVSL.........GFWKH..VNSFL...Spr..ILQ........LT..........YGPFHSI-F...........S
ENSMUSP00000075833  WEVSL.........GFWKH..MNSFL...Spr..ILQ........LT..........YGPFHSI-F...........S
ENSMUSP00000087221  WKTSL.........----K..LAMDS...S....MPM........VF..........FGPFNPN-L...........C
ENSMUSP00000124342  STSIS.........IQISR..VLSLY...K....VPQ........IS..........YAPFDQI-L...........G
ENSMUSP00000104190  WDESL.........SFWKY..LDSFL...Spr..ILQ........LS..........YGSFSSI-F...........S
ENSMUSP00000083463  WDESL.........SFWKY..LDSFL...Spr..ILQ........LS..........YGSFSSI-F...........S
ENSMUSP00000126682  STGIS.........TQISQ..ILSLY...N....VPQ........IS..........YAPFDHS-L...........G
ENSMUSP00000079827  WDVSL.........SFWMY..LDSFL...Slr..ILQ........LT..........YGPFHSI-F...........S
ENSMUSP00000074476  -----.........-----..---NW...E....ILQ........LT..........YGPFHST-F...........S
ENSMUSP00000069647  -----.........-----..---NW...E....ILQ........LT..........YGPFHST-F...........S
ENSMUSP00000083477  MTTSLyf.......QMFLD..IFLSP...H....FLQ........LT..........YGPFSSI-I...........N
ENSMUSP00000073604  STGIS.........TQISR..VLSLY...N....IPQ........IS..........YAPFDQS-L...........G
ENSMUSP00000072296  WDVSL.........SFWMY..LDSFL...Spr..ILQ........LT..........YGPFHSI-F...........S
ENSMUSP00000129703  WAISTkl.......GPFLF..MSRIP...E....VNQ........LY..........CGHFHLP-L...........S
ENSMUSP00000083478  -----.........-----..---NW...E....ILQ........LT..........YGPFHST-F...........S
ENSMUSP00000083468  WDVSL.........SFWMY..LDSFL...Slr..ILQ........LT..........YGPFHSI-F...........S
ENSMUSP00000132043  STGIS.........TQISR..VLSLY...N....VPQ........IS..........YAPFDQS-L...........G
ENSMUSP00000092462  WDESL.........SFWKY..LDSFL...Sph..ILQ........LS..........YGSFSSI-F...........S
ENSMUSP00000092460  WDVSL.........SFWMY..LDSFL...Slr..ILQ........LT..........YGPFYSI-F...........S
ENSMUSP00000130160  WDVSL.........SFWMY..LDSFL...Slr..ILQ........LT..........YGPFYSI-F...........S
ENSMUSP00000098528  SKAIT.........AQISQ..VLSLY...N....VPQ........IS..........YAPFDQS-L...........A
ENSMUSP00000030949  SSELA.........LITGK..FFSFF...L....MPQ........VS..........YSASMDR-L...........S
ENSMUSP00000129352  MTTSLyf.......QMFLD..IFLSP...H....FLQ........LT..........YGPYSSI-I...........N
ENSMUSP00000132206  NWTTT.........LTLYT..ILNNFishQ....FLH........LT..........YGPFHPV-L...........S
ENSMUSP00000032238  STSIS.........IQISR..VLSLY...N....VPQ........IS..........YAPFDQI-L...........G
ENSMUSP00000127506  RSEYS.........AGIGS..LLERY...K....IPQ........VSfalllqvn..YGPFDSM-L...........S
ENSMUSP00000074602  STSIS.........TQISR..VLSLY...N....IPQ........IS..........YAPFDQS-L...........G
ENSMUSP00000128981  STGIS.........TQISR..VLSLY...N....VPQ........IS..........YAPFDQS-L...........G
ENSMUSP00000020062  YSETS.........IAVSR..MLNLQ...L....MPQ........VS..........YESTAEI-L...........S
ENSMUSP00000129145  STGIS.........TQISR..VLSLY...N....VPQ........IS..........YAPFDQS-L...........G
ENSMUSP00000030510  NSESA.........ITVSN..ILSYF...L....VPQ........VT..........YSAITDK-L...........R
ENSMUSP00000128600  KWGVS.........TSIGQ..LLYIS...R....IPE........IS..........PKDTS----...........-
ENSMUSP00000025338  CSSVS.........TLVAE..AARMW...N....LIV........LS..........YGSSSPA-L...........S
ENSMUSP00000092459  NWEVS.........LSSWN..YLNSFlspR....LLM........LT..........YGPFQSV-F...........S
ENSMUSP00000044521  NPGFC.........EAASL..LGTSW...D....KGI........FS..........WACVNHE-L...........D
ENSMUSP00000127895  WDVSL.........SFWMY..LDSFL...Slr..ILQ........LT..........YGPFHSI-F...........S
ENSMUSP00000068253  CPEAA.........EVIGL..LASEW...N....IPL........FD..........FVGQMAA-L...........K
ENSMUSP00000103378  CPSVT.........SIIAE..SLQGW...N....LVQ........LS..........FAATTPV-L...........A
ENSMUSP00000131564  -----.........-----..-----...-....---........--..........---------...........-
ENSMUSP00000131156  -----.........-----..-----...-....---........--..........---------...........-
ENSMUSP00000077758  HSSSA.........NAVQS..ICNAL...G....VPH........IQ..........TRWKHQV-S...........D
ENSMUSP00000095875  NPGFC.........SAAAL..LAQGW...G....KSL........FS..........WACEAPE-G...........G
ENSMUSP00000072107  HSSSV.........SAVQS..ICNAL...E....VPH........IQ..........TRWKHPS-V...........D
ENSMUSP00000030676  QGSCT.........NAVQS..ICNAL...E....VPH........IQ..........LRWKHHP-L...........D
ENSMUSP00000027020  DKRSV.........HTLTS..FCSAL...H....ISL........IT..........PSFPTEG-E...........S
ENSMUSP00000032338  CTYST.........FQM-Y..LDTEL...N....YPM........IS..........AGSYG---L...........S
ENSMUSP00000109949  DHFTP.........TPVSY..TAGFY...R....IPV........LG..........LTTRMSI-Y...........S
ENSMUSP00000044494  ERRTV.........NMLTS..FCGAL...H....VCF........IT..........PSFPVDT-S...........N
ENSMUSP00000103375  DKKSV.........NTITS..FCGTL...H....VSF........IT..........PSFPTDG--...........-
ENSMUSP00000075687  DQMSM.........NTLTS..FCGAL...H....TSF........VT..........PSFPTDA--...........-
ENSMUSP00000021259  NPAAC.........RPAEL..LAQEA...G....VAL........VP..........WGCPGTR-A...........A
ENSMUSP00000034515  SSPASs........SIISN..ICGEK...E....VPH........FK..........VAPEEFVRF...........-
ENSMUSP00000003468  SSPASa........STVSH..ICGEK...E....IPH........IK..........VGPEETPRL...........-
ENSMUSP00000093536  GCTSA.........GSLQS..LADAM...H....IPH........LF..........IQRSTAG-Tprsgcgl....T
ENSMUSP00000044009  GCASA.........NALQS..LTDAM...H....IPH........LFvqrnpggsprT----ACHL...........N
ENSMUSP00000129679  -----.........-----..-----...-....---........--..........---------...........-
ENSMUSP00000062284  TDQEA.........IAQILdfISAQT...L....TPI........LG..........IHGGSSMIM...........A
ENSMUSP00000002848  DDSRA.........PAVAP..ILDFL...SaqtsLPI........VA..........VHGGAALVL...........T
ENSMUSP00000091381  SQGEM.........MELDL..VSSVL...H....IPV........LS..........IVRHE---F...........P
ENSMUSP00000032331  TDQEA.........VAQMLdfISSQT...F....IPI........LG..........IHGGASMIM...........A
ENSMUSP00000097013  -----.........-----..-----...-....---........--..........---------...........-
ENSMUSP00000003351  TEAVA.........QLLDF..VSSQT...H....VPI........LS..........ISGGSAVVL...........T
ENSMUSP00000105373  -----.........-----..-----...-....---........--..........---------...........-
ENSMUSP00000093345  -----.........-----..-----...-....---........--..........---------...........-


                            130         140              150          160          170       180    
                              |           |                |            |            |         |    
d1jdpa_               KDSEYSHLTRVAP..AYAKMGEMMLALFRH.......HHW.SRAALVY..SD.DKLE..RNCYFTLEGVHEVFQEE..
ENSMUSP00000037255  DKTLYKYFLRVVP..SDTLQARAMLDIVKR.......YNW.TYVSAVH..TE.GNYG..---ESGMDAFKELAAQE..
ENSMUSP00000129181  DKTLFKYFMRVVP..SDAQQARAMVDIVKR.......YNW.TYVSAVH..TE.GNYG..---ESGMEAFKDMSAKE..
ENSMUSP00000131856  DRGQFNSLYQMAP..KDTSLSLAIVLLLLH.......FHW.SWVGLIL..PD.DHRG..---TQILLDLRENMENH..
ENSMUSP00000126650  NQEQLNYVYQMAP..KDTFLSLAIVSLMLH.......FSW.SWVGLII..PD.DHKG..---TQILSDLRQVMERN..
ENSMUSP00000029540  VKDEYALTTRTGP..SHVKLGDFVTALHRR.......LGW.EHQALVL..YA.DRLGddRPCFFIVEGLYMRVRERl.
ENSMUSP00000125817  DQSQYKTLFQVAP..EDTYLSLALVSLMLY.......FSW.SWVGLIV..PN.DPRG..---TQILSDFREVMESN..
ENSMUSP00000113819  DNSRYDFFSRVVP..SDTYQAQAMVDIVRA.......LKW.NYVSTLA..SE.GSYG..---ESGVEAFIQKSRENg.
ENSMUSP00000129576  ERGQFNSLYQMAP..KDTSLSLAIVLLMLH.......FRW.YWVGLIL..PD.DHRG..---IQILSDLRENMESH..
ENSMUSP00000126966  DRGQFNSLYQMSP..KDTSLSLAIVFLLLQ.......FRW.SWVGLII..PD.DHRG..---TQILSDLRENMENH..
ENSMUSP00000129089  DQSQFKTLYQVAP..EDTYLSLALVSLMLH.......FSW.SWVGLIV..PN.DPRG..---TQILSEFRDVMESN..
ENSMUSP00000128493  DRAQFNSLYQMAP..EDTSLPFAIVFLLLH.......FSW.SWVGLIL..PD.DHRG..---TQILSDLRENMESH..
ENSMUSP00000069080  NKNQFKSFLRTIP..NDEHQATAMADIIEY.......FRW.NWVGTIA..AD.DDYG..---RPGIEKFREEAEER..
ENSMUSP00000064404  DDRRYDFFSRVVP..PDSFQAQAMVDIVKA.......LGW.NYVSTLA..SE.GSYG..---EKGVESFTQISKEAg.
ENSMUSP00000129068  DQSQFKTLYQVAP..EDTYLSLALVSLMLH.......FSW.SWVGLIV..PN.DPRG..---TQILSEFRDVMESN..
ENSMUSP00000129308  DQSQFKTLYQVAP..EDTYLSLALVSLMLH.......FSW.SWVGLIV..PN.DPRG..---TQILSEFRDVMESN..
ENSMUSP00000087998  DNTRYDFFSRVVP..PDSYQAQAMVDIVTA.......LGW.NYVSTLA..SE.GNYG..---ESGVEAFTQISREIg.
ENSMUSP00000129762  DRNQYSFLYQIAP..KSSSLSLGIVSLMVH.......FRW.SWVGLIL..PD.DHKG..---NKILSDFKNEMERK..
ENSMUSP00000000631  DSTRYDFFSRVVP..PDSYQAQAMVDIVRA.......LGW.NYVSTLA..SE.GNYG..---ESGVEAFVQISREAg.
ENSMUSP00000129296  DHVKFPFIYQMAP..EDTSLALGMVSLMVH.......FSW.TWVGLII..TE.NEKG..---IKFLSDLKREMKKN..
ENSMUSP00000129895  DDGQYSSLYQMAP..KDTSLSLAIVSFMVH.......FSW.SWIGLII..PD.NHKG..---NKILSEFREEMERN..
ENSMUSP00000048706  DRGQYPSLYQMAP..KDTSLSLAIVSLMVH.......FRW.SWVGLIL..PD.DHKG..---NKILSDFRKEMERK..
ENSMUSP00000029406  DKFQFPSYLRVLP..SDNLQSEAIVNLIKH.......FGW.VWVGAIA..AD.DDYG..---KYGVKTFKEKMESA..
ENSMUSP00000126559  DHGQYPSLYQMAP..KDTSLSLAIVSLIAH.......FRW.SWVGLIL..PD.DHKG..---NKIVSDFREEMERK..
ENSMUSP00000127465  DHSQYPSLYQMSP..RDTSLSLAIVSLMVH.......FRW.SWVGLII..PD.DHKG..---NKILSDFREEMERK..
ENSMUSP00000129347  DRGQYSSLYQMAP..KYSSISRGIVSLMVH.......FRW.SWVGLIL..PD.DHKG..---YIILSELREDMERK..
ENSMUSP00000131426  DRKQFPSLYQVAP..KDTSLLSGIASLMLH.......FNW.TWVGLLS..TD.DHRG..---AQFLSDLRKVLENN..
ENSMUSP00000128685  DHSQYPSLYQMSP..RDTSLSLAIVSLMVH.......FRW.SWVGLII..PD.DHKG..---NKILSDFREEMERK..
ENSMUSP00000132641  DRGQYSSLYQMAP..KYTLIPLGIVSLMVH.......FRW.SWVGLIL..PD.DHKG..---NIILSEFREDMDRK..
ENSMUSP00000004076  DKSRYDYFARTVP..PDFYQAKAMAEILRY.......FNW.TYVSTVA..SE.GDYG..---ETGIEAFEQEARLR..
ENSMUSP00000124192  NDIQFPYILRTIP..SDKFQSEAIVNLIRH.......FGW.VWVGAIA..SD.DDYG..---KYGVKFFREEMESA..
ENSMUSP00000128975  DHDQFPYVYQVAT..KDTYLSHGMVSLMLQ.......FRW.NWIGLVI..SD.DDQG..---IQFLSDLREEMQRH..
ENSMUSP00000126106  DHGQYPSLYQMAP..KDTSLSLAIVSLMVH.......FRW.SWVGLIL..PD.DHKG..---NKILSDFREEMERK..
ENSMUSP00000023959  DKSRYDYFARTVP..PDFFQAKAMAEILRF.......FNW.TYVSTVA..SE.GDYG..---ETGIEAFELEARAR..
ENSMUSP00000126534  DRSQYFSLYQMAP..KYTSLSHGIVSLMVH.......FRW.SWVGLIL..PD.DHKG..---NKILPEIKEDMQRK..
ENSMUSP00000126756  DHGQYPSLYQMAP..KDTSLSLAIVSLMAH.......FRW.SWVGLIL..PD.DHKG..---NNIVSDFREEMERK..
ENSMUSP00000078200  DHSQYSSLYQMAP..QDTSLTLAIVSLIVH.......FRW.LWVGLIL..PD.DHKG..---NKILSDFREEMERK..
ENSMUSP00000129313  DRGQYPYLYQMAP..KDTSLPLAIVSLIVH.......FRW.SWVGLIL..PD.DHKG..---NKILSDFREEMERN..
ENSMUSP00000130373  DRGQYSSLYQMAS..KYTSISLGIVSLMVH.......FRW.SWVGLIL..PD.NHKG..---NKILSEFREDMERK..
ENSMUSP00000128350  DRSQYSSLYQIAP..KDTSLTLAIVSLMVH.......FRW.SWVGLIL..PD.DHKG..---NKVLSDFKQEMERR..
ENSMUSP00000094994  DHEKFPYLHQMAS..DHTSLALALVSFIIH.......FGW.NWVGLVI..SD.SDQG..---IQFLSYLRREMEKY..
ENSMUSP00000090148  DHEKFPYLHQMAS..DHTSLALALVSFIIH.......FGW.NWVGLVI..SD.SDQG..---IQFLSYLRREMEKY..
ENSMUSP00000131261  DRGQYSSLYQISP..KDTSLSLAIVSLMVH.......FRW.SWIGLIL..PN.DHKG..---NKILSDFREEMERN..
ENSMUSP00000131925  DKFQFPSFYRSIP..SDKIQIEAMVTLIIH.......FGW.VWVGAIA..SE.DDYG..---KYGVKSFREKMETA..
ENSMUSP00000130114  DRNQFRSLYQVAP..KDTALLSGIASLMLH.......FNW.NWVGLLI..PA.DQRG..---AQFLSDFRKELDKT..
ENSMUSP00000131583  DRDQYPSLYQMAS..KDTYLSLAIVSLMVH.......FRW.SWVGLIL..PD.DHKG..---NKIVSDFRDEMERK..
ENSMUSP00000126885  DHEKFPYLYQMAS..DHTSLALALVSFIIH.......FSW.NWVGLVI..SD.NDED..---IQFLSYLRREMEKN..
ENSMUSP00000127981  DHEEFPYLYQMAS..EDTSLALAMVSFIIH.......FSW.NWVGLAI..SD.NDKG..---IQFLSYLRREMEKN..
ENSMUSP00000132299  DRNQFQSLYQMAP..KDTALLSGIASLMLH.......FSW.NWVGLII..TD.DHRG..---AQFLSDFRKELDKT..
ENSMUSP00000131447  DHEKFPYLHQMAS..DHTSLAFGLVSFIIH.......FGW.NWVGLVI..SD.NDQG..---IQFLSYLKTEMEKN..
ENSMUSP00000128106  DHEKFPYLHQMAS..DHTSLALALVSFIIH.......FGW.NWVGLVI..SD.SDQG..---IQFLSYLRREMEKY..
ENSMUSP00000077109  DTFQFPSFYRSTP..SDKFQSEGMVSLIQH.......FGW.VWVGTIA..SD.DDYG..---KYGVKSLRERMEFV..
ENSMUSP00000020547  DRNQFQSLYQVAP..KDTALLSGIASLMLH.......FNW.NWVGLLI..PD.DQRG..---AQFLSDFRKELDKT..
ENSMUSP00000131450  DHDQFPYIYQVAT..KDTHLSHGMVSLMLH.......FRW.TWIGLVI..SD.DDQS..---IQFLSDLREAMQRH..
ENSMUSP00000125126  DHDRLHHVHQVAT..KDTHLSHGIVSLMFH.......FRW.TWIGLVI..SD.DDKG..---IQFLSDLREESQRH..
ENSMUSP00000126386  EHGQYSSLYQIAS..KDTSLTLAIVSLMVH.......FRW.SWVGLIL..PD.NHKG..---NKILSDFREEMERN..
ENSMUSP00000127505  DHEKFPYLYQMAS..DHTSLALALVSFIIH.......FSW.NWVGLAI..SD.NDQG..---IQFLSYLRRVMEKN..
ENSMUSP00000124065  DHDRLPHVHQVAP..KDTHLSHGMVSLMFH.......FRW.TWIGLVI..SD.DDQG..---IQFLSDLREESQRH..
ENSMUSP00000132478  DQEQFPHLYQMTP..KDTSLPQGMVSLAVH.......FRW.NWVGVII..TD.DDHG..---IQFLSELRAGMESN..
ENSMUSP00000127838  DHDQFPYVHQVST..KDTHLSHAMVSLMLH.......FKW.TWIGLVI..SD.DEQG..---IQFLSGLREEMQTY..
ENSMUSP00000127513  NDYQFPYILRTIP..SDKFQSEAIVNLIRH.......FGW.VWVGAIA..SD.DDYG..---KYGVKFFREEMERA..
ENSMUSP00000129215  DHDRFPYVHQVAT..KDTHLSHGMVSLMLH.......FRW.TWIGLVI..SD.DDQG..---IQLHSDLREESQRH..
ENSMUSP00000126953  DHDQFPFVHQVAT..KDTYLSHAMVSLMHH.......FRW.MWIGLVI..SD.DDQG..---IQFLSDLREEMQRH..
ENSMUSP00000071670  DHDRLPHVHQVAT..KDTHLSHGMVSLMFH.......FRW.TWIGLVI..SD.DDQG..---IQFLSDLREESQRH..
ENSMUSP00000131831  NDIQFPYILRTIP..SDKFQSEAIVNLIRH.......FGW.VWVGAIA..SD.DDYG..---KYGVRFFREEMERA..
ENSMUSP00000133218  DHDQFPYVHQVAT..KDTLLSHAMVSLMLH.......FRW.TWIGMVI..SD.DDQG..---IQFLSDLREEMQRH..
ENSMUSP00000092079  DHDHFPYVHQIAT..KDTHLSHGMVSLMLH.......FRW.TWIGLVI..SD.DDQG..---VQLHSDLREESQRH..
ENSMUSP00000126698  DQEQFPHLYQMTP..KDTSLPQGMVSLAVH.......FRW.NWVGVII..TD.DDHG..---IQFLSELRTGMESN..
ENSMUSP00000128015  DHDQFPYVHQVAT..KDTHLSHGMITLMLH.......FRW.TWIGLVI..SD.DDQG..---IQFLSDLREEMQRH..
ENSMUSP00000129540  DQEQFPHLYQMTP..KDTSLPLAMVSLAVH.......FRW.NWVGVII..TD.DDHG..---IQFLSELRTGMERN..
ENSMUSP00000126596  DHDRFPNVHQIAT..KDTHLSHGMVSLMLH.......FRW.TWIGLVI..SD.DDQG..---IQLHSDLREESQRH..
ENSMUSP00000128333  DHDQFPYVHQVAI..KDTHLSHGMASLMLH.......FRW.TWIGLVI..SD.DDQS..---IQFLSDLREEMQRH..
ENSMUSP00000128792  DHDRFPNVHQIAT..KDTHLSHGMVSLMLH.......FRW.TWIGLVI..SD.DDQG..---VQLHSDLREESQRH..
ENSMUSP00000129520  DHDQFPYVHQVAT..KDTHLSHAMVSLMLH.......FRW.AWIGLVI..SD.DDQG..---IQFLSDLREEMQRH..
ENSMUSP00000052977  DHDQFPYVHQVAT..KDTHLSHGMVSLMLH.......FRW.TWIGLVI..SD.DDQG..---IQFLSDMREEMQRD..
ENSMUSP00000078162  DHDQFPYVHQVAT..KDTRLSHAMVSLMFH.......FTW.IWIGMVI..SD.DDQS..---IQFLSDMREEMQRH..
ENSMUSP00000132467  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQRENK..
ENSMUSP00000129566  DKIQFPSFIRTLT..SDLTSSHAVTQLIIH.......FQW.SWVIILA..HD.DDFG..---QQASSLASQVLTPA..
ENSMUSP00000036551  DREHYPYLYQMSP..KNTFLTLAMTALVVY.......FSW.NWVGLVI..SD.DELG..---IEFLFKLRGEMHKH..
ENSMUSP00000126007  DNEQFPHLYQISP..KDTSLPLAMVSLMVH.......FRW.NWIGAIV..TT.DDHG..---IQFLSELRGEMQKH..
ENSMUSP00000083386  DKIQFPSFLRTLT..SDITSSHAVTQLIIH.......FQW.SWVIILA..QD.DDFG..---QQASSLATQQLSPA..
ENSMUSP00000129960  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQRENK..
ENSMUSP00000066737  KDTEYSHLTRVAP..AYAKMGEMMLALFRH.......HHW.SRAALVY..SD.DKLE..RNCYFTLEGVHEVFQEE..
ENSMUSP00000074613  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000129578  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQKENK..
ENSMUSP00000122645  DNEQFPHLYQISP..KDTSLPLAMVSLVVH.......FRW.NWIGAIV..TN.DDHG..---IQFLSELRGEMQKH..
ENSMUSP00000104194  DDEQYSYLYQMAP..KDTSLALAMVSFILY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQRENK..
ENSMUSP00000132834  DKIQFPSFLRTLT..SDITSSHAVTQLIIH.......FQW.SWVIILA..QD.DDFG..---QQASSLATQQLSPA..
ENSMUSP00000093612  NHDLFPNVHQVAT..KDTHLSHGMVSLMLH.......FRW.TWIGLVI..SD.DDQC..---IQFLSDLREEMQGH..
ENSMUSP00000126979  DKIQFPSFIRTLT..SDLTCSHAVTQLVIH.......FQW.SWVIILA..HD.DDFG..---QQASSLATQMLTPA..
ENSMUSP00000126973  DNEQFPHLYQISP..KDTSLPLAMVSLVVH.......FRW.NWIGAIV..TN.DDHG..---IQFLSELRGEMQKH..
ENSMUSP00000127309  SFEHFPYLYQIAI..KDTSVAIGMVSLVIY.......FGW.NWVGLMI..SD.DGLG..---LQFASELREEMQRY..
ENSMUSP00000126165  ---EYLNVYRTIP..SDKFQTEAIVNLIRH.......FGW.VWIGAIA..SD.DDYG..---KHGVKSFRKILETN..
ENSMUSP00000131128  DQSKFPNLHQIAP..KNRFLPEAIVSLLFH.......FSW.IWVGLVI..QD.DDQG..---IQFLLDIKEEMQRN..
ENSMUSP00000131990  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FSW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000127337  DDEQYPYLYQMAP..KDTSLALAMVSFIHY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000030191  KNEHYRTLVRTGP..SAPKLGEFVVTLHGH.......FNWtARAALLY..LDaRTDD..RPHYFTIEGVFEALQGS..
ENSMUSP00000133007  DDEQYPYLYQMAP..KDTSLALAIVSFIHY.......FNW.NWIGLVI..PD.DDQG..---NQFFLELKKQCENK..
ENSMUSP00000131780  DDEQYPYLYQMAP..KDTSLALAMVSFIHY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000132457  DDEQYPYLYQMAP..KDTSLALAMVSFIHY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000076687  DNEQFPHLYQISP..KDTSLPLAMVSLVVH.......FRW.NWIGVII..TN.DNHG..---IQFLSELRGETQKQ..
ENSMUSP00000128102  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FSW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000132539  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FSW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000129411  DNEQFPHLYQISP..KDTSLPLAMVSLMVH.......FRW.NWIGAMI..TN.DDHG..---IQFLSKLRGEMQKH..
ENSMUSP00000132726  DNEEFPHLYQISP..KDTSLPLAMVSLVVH.......FRW.NWIGVIV..TS.DDQG..---IQFLSELKGEMQKN..
ENSMUSP00000132327  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FSW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000030792  GKRKFPSFLRTIP..SDKYQVEVIVRLLQS.......FGW.VWISLVG..SY.GDYG..---QLGVQALEELATPR..
ENSMUSP00000133014  DNEQFPHLYQISP..KDTSLPLAMVSLMVH.......FKW.NWIGAMI..TN.DDHG..---IQFLSKLRGEMQKH..
ENSMUSP00000126917  DNEQYPHLHQISR..KDTFLPLAMVSLVVH.......FRW.NWIGVIV..TN.DDHG..---IQFLSEFRGEMQNK..
ENSMUSP00000128337  DDEQYPYLYQMAP..KDTSLALAMVSFIHY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000132332  DDEQYPYLYQMAP..KDTSLALAMVSFIHY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000133265  DDEQYPYLYQMAP..KDTSLALAMVSFIHY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000126863  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FSW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000127146  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FSW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000130631  DDEQYPYLYQMAP..KDTSLALAMVSFIHY.......FNW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000132337  DKGQFPHLYQISP..KDTSLPLAMVSLFVH.......FRW.NWIGVII..TN.DDHG..---IQFLSELKGDMQKS..
ENSMUSP00000072566  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FSW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000129466  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FSW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000075833  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......FSW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000087221  DHDRLPHVHQVAP..KDSHLSHGMVSLMFH.......FTW.TWIGLVI..SD.DNQG..---IQFLSDLRKEMQRH..
ENSMUSP00000124342  TRVQLQSPYQFSM..HTAALYQGIVQLMLY.......FTW.IWVGLVV..PD.DMRG..---ELYLRDITEEMISH..
ENSMUSP00000104190  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......LKW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000083463  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......LKW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000126682  TRVQLQSPYQFPV..HTTALYQGIIQLLLY.......FTW.VWVGLVV..PD.DMRG..---ELFLRDITEEMTNH..
ENSMUSP00000079827  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......LKW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000074476  DDEQYPYLYQMAP..KDTSLALAMVSFIHY.......FNW.NWIGLLI..PD.DDQG..---NQFLLELKKQSGNK..
ENSMUSP00000069647  DDEQYPYLYQMAP..KDTSLALAMVSFIHY.......FNW.NWIGLLI..PD.DDQG..---NQFLLELKKQSGNK..
ENSMUSP00000083477  DSEKYPYVYQMAP..KDTSLALAMVYFILY.......FQW.NWVGLII..PD.DEDG..---YQFLSQLKKESKGK..
ENSMUSP00000073604  TRVQLQSPYQFPV..YTTALYQGIIQLLLY.......FTW.VWVALVV..PD.DMRG..---EFFLRDITEEIKNQ..
ENSMUSP00000072296  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......LKW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000129703  NNEQFPHLYQISK..KDTSLPLAMVSLVVH.......FRW.NWIGVII..TN.DDHG..---IQFLSELRGEMQNN..
ENSMUSP00000083478  DDEQYPYLYQMAP..KDTSLALAMVSFIHY.......FNW.NWIGLLI..PD.DDQG..---NQFLLELKKQSGNK..
ENSMUSP00000083468  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......LKW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000132043  TSVQLQSPYQFTV..HTAALYQGIIQLLLY.......FTW.VWVGLVV..PD.DIRG..---ELFLRDITEEMMNH..
ENSMUSP00000092462  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......LKW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000092460  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......LKW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000130160  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......LKW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000098528  SRVQLQSPYQFPV..HTAALYQGIIQLMLY.......FTW.VWVGLVV..PD.DMRG..---ELYITELTEDMTKH..
ENSMUSP00000030949  DRETFPSFFRTVP..SDRVQLQAVVTLLQN.......FSW.NWVAALG..SD.DDYG..---REGLSIFSSLANAR..
ENSMUSP00000129352  DIEQYPYVYQMAP..KDTSLALAMVYFILY.......FHW.NWVGLII..SD.DDEG..---YQFLSQLKKESKGK..
ENSMUSP00000132206  DHEEFPYLYQMAS..EDTSLALAMVSFIIH.......FSW.NWVGLAI..SD.NDKG..---IQFLSYLRREMEKN..
ENSMUSP00000032238  TRVQLQSPYQFSM..HTAALYQGIVQLLLY.......FTW.IWVGLVV..PD.DMRG..---ELYLRDITKEMISH..
ENSMUSP00000127506  DKDTFPSLYQMSP..KDTALTQGVISVLLH.......FGW.KWVGVIV..SD.DLKG..---MEFLSHLKAEMVSE..
ENSMUSP00000074602  TSVQLQSPYQFPV..HNVALYQGIIQLLLY.......FTW.VWVGLVV..PD.DMRG..---ELFLRDITEEMTNH..
ENSMUSP00000128981  TIVQLQSPYQFPV..HTAALYQGIIQLLLY.......FTW.VWVGLVV..PD.DIRG..---ELFLRDITEEMMNH..
ENSMUSP00000020062  DKIRFPSFLRTVP..SDFYQTKAMAHLIRQ.......SGW.NWIGAIT..TD.DDYG..---RLALNTFAIQAAEN..
ENSMUSP00000129145  TIVQLQSPYQFPV..HTAALYQGIIQLLLY.......FTW.VWVGLVV..PD.DIRG..---ELFLRDITEEMMNH..
ENSMUSP00000030510  DKRRFPAMLRTVP..SATHHIEAMVQLMVH.......FQW.NWIVVLV..SD.DDYG..---RENSHLLSQRLTNTg.
ENSMUSP00000128600  -------------..----LPLAMVSLVVH.......FRW.NWIGAIV..TN.DDHG..---IQFLSELRGEMQKH..
ENSMUSP00000025338  NRQRFPTFFRTHP..SATLHNPTRVKLFEK.......WGW.KKIATIQ..QT.TEVF..---TSTLDDLEERVKEA..
ENSMUSP00000092459  DDEQYPYLYQMAP..KGPSLALAMVSFILY.......FKW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000044521  NKHSFPTFSRTLP..SPI---RVLVTVMKY.......FQW.AHAGVIS..SD.EDIW..---MHTANRVSSALRSQ..
ENSMUSP00000127895  DDEQYPYLYQMAP..KDTSLALAMVSFILY.......LKW.NWIGLVI..PD.DDQG..---NQFLLELKKQSENK..
ENSMUSP00000068253  DHFWCDTCVTLVP..PKQEISAVLRESLRY.......LGW.EHIGVFGgsSA.DSSW..EQVDEMWGAVEDGLQFH..
ENSMUSP00000103378  DKKKYPYFFRTVP..SDNAVNPAILKLLKH.......FRW.RRVGTLT..QD.VQRF..---SEVRNDLTGVLYGE..
ENSMUSP00000131564  ----------MAP..KDTSLSLAIVSLMVH.......FRW.TWVGLIL..PN.DHKG..---NKILSDFREEMERN..
ENSMUSP00000131156  ----------MAP..KDISLSLAIVSLVVY.......FNW.SWVGLIL..PD.DHKG..---NIILSDFSEEMERK..
ENSMUSP00000077758  NKD--SFYVSLYP..DFSSLSRAILDLVQF.......FKW.KTVTVVY..DD.ST-G..---LIRLQELIKAPSRY..
ENSMUSP00000095875  -----GDLVPTLP..SAA---DVLLSVMRH.......FGW.ARWAIVS..SH.QDIW..---VTTAQQLATAFRTH..
ENSMUSP00000072107  NRDLF--YINLYP..DYAAISRAVLDLVLY.......YNW.KTVTVVY..ED.ST-G..---LIRLQELIKAPSRY..
ENSMUSP00000030676  NKDT--FYVNLYP..DYASLSHAILDLVQS.......LKW.RSATVVY..DD.ST-G..---LIRLQELIMAPSRY..
ENSMUSP00000027020  -----QFVLQLRP..SLR---GALLSLLDH.......YEW.NCFVFLY..-D.TDRG..---YSILQAIMEKAGQN..
ENSMUSP00000032338  CDYK-ETLTRILP..PARKLMYFLVDFWKVnnasfkpFSW.NS-SYVY..KN.GSEP..EDCFWYLNALEAGVSYF..
ENSMUSP00000109949  DKSIHLSFLRTVP..PYSHQSSVWFEMMRV.......YNW.NHIILLV..SD.DHEG..---RAAQKRLETLLEER..
ENSMUSP00000044494  -----QFVLQLRP..ELQ---EALISIIDH.......YKW.QTFVYIY..D-.ADRG..---LSVLQRVLDTAAEK..
ENSMUSP00000103375  ---THPFVIQMRP..DLK---GALLSLIEY.......YQW.DKFAYLY..-D.SDRG..---LSTLQAVLDSAAEK..
ENSMUSP00000075687  ---DVQFVIQMRP..ALK---GAILSLLGY.......YKW.EKFVYLY..-D.TERG..---FSILQAIMEAAVQN..
ENSMUSP00000021259  -----GTTAPAVT..PAA---DALYVLLRA.......FRW.ARVALIT..AP.QDLW..---VEAGRALSTALRAR..
ENSMUSP00000034515  -QLQRFTTLNLHP..SNTDISVAVAGILNF.......FNC.TTACLIC..AK.AECL..---LNLEKLLRQFLISK..
ENSMUSP00000003468  -QYLRFASVSLYP..SNEDVSLAVSRILKS.......FNY.PSASLIC..AK.AEC-..---LLRLEELVRGFLIS..
ENSMUSP00000093536  RSNRNDDYTLSVR..PPVYLNEVILRVVTE.......YAW.QKFIIFY..-D.SEYD..---IRGIQEFLDKVSQQ..
ENSMUSP00000044009  PSPDGEAYTLASR..PPVRLNDVMLRLVTE.......LRW.QKFVMFY..-D.SEYD..---IRGLQSFLDQASRL..
ENSMUSP00000129679  -------------..---------------.......---.-------..--.----..-----------------..
ENSMUSP00000062284  DKDESSMFFQFGP..SIEQQASVMLNIMEE.......YDW.YIFSIVT..TY.FPGY..---QDFVNKIRSTIENSfv
ENSMUSP00000002848  PKEKGSTFLQLGS..STEQQLQVIFEVLEE.......YDW.TSFVAVT..TR.APGH..---RAFLSYIEVLTDGS..
ENSMUSP00000091381  RESQNPLHLQLSLenSLSSDADVTVSILTM.......NNW.YNFSLLL..CQ.EDWN..---ITDFLLLTENNSKF..
ENSMUSP00000032331  DKDPTSTFFQFGA..SIQQQATVMLKIMQD.......YDW.HVFSLVT..TI.FPGY..---RDFISFIKTTVDNSfv
ENSMUSP00000097013  -------------..---------------.......---.-------..--.----..-----------------..
ENSMUSP00000003351  PKEPGSAFLQLGV..SLEQQLQVLFKVLEE.......YDW.SAFAVIT..SL.HPGH..---ALFLEGVRAVADASyl
ENSMUSP00000105373  -------------..---------------.......---.-------..--.----..-----------------..
ENSMUSP00000093345  -------------..---------------.......---.-------..--.----..-----------------..


                           190                       200                                 210        
                             |                         |                                   |        
d1jdpa_               GLHTSIYSFDET..........KDLD......LED.....................IVRNIQA.....SERVVIMCA.
ENSMUSP00000037255  GLCIAHSDKIYSna........GEKS......FDR.....................LLRKLRErlp..KARVVVCFC.
ENSMUSP00000129181  GICIAHSYKIYSna........GEQS......FDK.....................LLKKLRShlp..KARVVACFC.
ENSMUSP00000131856  GICIAFLKMISG..........TWNA......YSNeqwk.................NMEKIEEs....SANVIVIYG.
ENSMUSP00000126650  NICIASVQMIPG..........IWNS......FSNalwk.................SLVQTKEs....SANVTVVCG.
ENSMUSP00000029540  NITVNHQEFVEG..........DPDH......YTK.....................LLRTVQR.....KGRVIYICS.
ENSMUSP00000125817  RICLAFVKMIPG..........TWNS......YSDaiwk.................NMEKIQEs....SANVIIIYG.
ENSMUSP00000113819  GVCIAQSVKIPRep........KTGE......FDK.....................IIKRLLEts...NARAIIIFA.
ENSMUSP00000129576  RICIAFLKMISG..........TWNA......FSN.....................ALWKNMEtieesSANVILIYG.
ENSMUSP00000126966  GICIAFLKIISS..........AWNA......FSNelwk.................NMYKIEEs....SANVIVIYG.
ENSMUSP00000129089  RICLAFVKMIPG..........TWNS......YSDaiwk.................NMEKIQEs....SANVIVICG.
ENSMUSP00000128493  GICIAFLKMISG..........TWNA......FSNalwk.................SMEKIEEs....SANVIVIYG.
ENSMUSP00000069080  DICIDFSELISQys........DEEE......IQQ.....................VVEVIQNs....TAKVIVVFS.
ENSMUSP00000064404  GLCIAQSVRIPQerkd......RTID......FDR.....................IIKQLLDtp...NSRAVVIFA.
ENSMUSP00000129068  RICLAFVKMIPG..........TWNS......YSDsiwk.................NMEKIQEs....SANVIVIYG.
ENSMUSP00000129308  RICLAFVKMIPG..........TWNS......YSDsiwk.................NMEKIQEs....SANVIVIYG.
ENSMUSP00000087998  GVCIAQSQKIPRep........RPGE......FEK.....................IIKRLLEtp...NARAVIMFA.
ENSMUSP00000129762  GICIAFVKMIPA..........TWSS......HLN.....................QFWKNID.....ETNVIIIYG.
ENSMUSP00000000631  GVCIAQSIKIPRep........KPGE......FHK.....................VIRRLMEtp...NARGIIIFA.
ENSMUSP00000129296  SVCAAFVQMLSLkyry......NWND......LLS.....................TDPAIMGe....MVKVFIVFA.
ENSMUSP00000129895  KICIAFLKMIPA..........TWTS......YFT.....................RFWENMD.....ETNVIIIYG.
ENSMUSP00000048706  RICTAFVKMIPA..........TWTS......SFV.....................KFWENMD.....DTNIIIIYG.
ENSMUSP00000029406  NLCVAFSETIPKvy........SNEK......MQK.....................AVKAVKTs....TAKVIVLYT.
ENSMUSP00000126559  GICLAFVKMIPA..........TWTS......HFA.....................KFWEHMD.....ETNVTIVYG.
ENSMUSP00000127465  GICIAFVKMIPE..........TWNL......YFA.....................KFWENMD.....ETNVIIIYG.
ENSMUSP00000129347  GVCIAFVKMILL..........TLTS......YYN.....................KFWENMD.....KTNVIIIYG.
ENSMUSP00000131426  TVCIAFMETVSLwge.......SLNS......LQTh....................YQMHILEs....SANVIVIYG.
ENSMUSP00000128685  GICIAFVKMIPE..........TWNL......YFA.....................KFWENMD.....ETNVIIIYG.
ENSMUSP00000132641  GICIAFVKMIPD..........TWAS......YIN.....................KFWENMD.....ETNVIIIYG.
ENSMUSP00000004076  NICIATAEKVGR..........SNIRks....YDS.....................VIRELLQkp...NARVVVLFM.
ENSMUSP00000124192  NLCVAFSETIPKvy........SNEK......MKI.....................AVDAVKSs....TAKVIVLYA.
ENSMUSP00000128975  GICLAFVNMIPE..........TMQI......YMTrakt.................YDEQIMEs....TAKVVVIYG.
ENSMUSP00000126106  DICLAFVKMTSE..........TWTS......YFY.....................KFWENID.....ETNVTIIYG.
ENSMUSP00000023959  NICVATSEKVGRam........SRAA......FEG.....................VVRALLQkp...SARVAVLFT.
ENSMUSP00000126534  GVCIAFVKMIPA..........TWTS......HFS.....................KFWENMD.....EVNVIIIYG.
ENSMUSP00000126756  GICLAFVKMIPA..........TWTS......HFA.....................KFWEHMD.....ETNVTIVYG.
ENSMUSP00000078200  RICMAFVKMIPA..........TWTS......YFA.....................KFWKNMD.....ETNVIIIYG.
ENSMUSP00000129313  GICLAFVKMTSE..........TWTS......YVA.....................KFWENMH.....ETNVTIIYG.
ENSMUSP00000130373  GVCIAFVKMIPM..........TWNA......YYN.....................KFWENMD.....ETNVIIIYG.
ENSMUSP00000128350  RICIAFVKMIPA..........TWTS......YFT.....................KFWQNME.....ETNVIIIYG.
ENSMUSP00000094994  TVCFAFVNMIPV..........NMNL......YMSraev.................YYNQIMTs....STNVVIIYG.
ENSMUSP00000090148  TVCFAFVNMIPV..........NMNL......YMSraev.................YYNQIMTs....STNVVIIYG.
ENSMUSP00000131261  GICLAFVKMTSD..........TWTS......YVA.....................KFWENMD.....ETNVTIIYG.
ENSMUSP00000131925  NLCVAFSETIPKvy........SNER......MQK.....................AVKAIKSs....SAKVIVLYT.
ENSMUSP00000130114  RICIAFVQTVLYl.........GETLlrll..SQD.....................HIHILESs....TADVIVIYG.
ENSMUSP00000131583  GICLAFVKMIPG..........TWTS......HFA.....................KFWEHMD.....ETNVTIVYG.
ENSMUSP00000126885  TVCFAFVNMIPM..........SMNL......YMSraev.................YYNQIMTs....STNVVIIYG.
ENSMUSP00000127981  TVCFAFVSMIPV..........NMHL......YMTrtev.................YYNQIMTs....STNVVIIYG.
ENSMUSP00000132299  RICIAFVQTVLY..........LEET......LLHllsqn................LIHFLESs....TADVIVIYG.
ENSMUSP00000131447  TICFAFVNMIPM..........SMNL......YMSkaev.................YYNQIMTs....STNVVIIYG.
ENSMUSP00000128106  TLCFAFVNMIPL..........NINL......YMSraev.................YYNQIMTs....STNVVIIYG.
ENSMUSP00000077109  NLCVAFSETIPKvy........SNEK......MQK.....................AIKAIKSs....TAKVIVLFS.
ENSMUSP00000020547  KICIAFVKTVLYl.........GETLlrli..SQD.....................HIHIIESs....TADVIVIYG.
ENSMUSP00000131450  GICLAFVNMIPE..........NMQI......YMTrgki.................YDKQIMTs....SAKVVIIYG.
ENSMUSP00000125126  GICLAFVNMIPE..........NMQI......YMTrati.................YDKQIMTs....LAKVVIIYG.
ENSMUSP00000126386  RICIAFVKMIPA..........TWTA......YFT.....................SFWENME.....ETNVIIIYG.
ENSMUSP00000127505  AVCFAFVNMIPM..........SMNL......YMSraev.................YYNQIMTs....STNVVIIYG.
ENSMUSP00000124065  GICLAFVNMIPE..........NMQI......YMTrati.................YDKQIMTs....SAKVVIIYG.
ENSMUSP00000132478  TVCLAFVTIITY..........NRKL......YLKmyhk.................YYHQITMs....SAKVVIVYG.
ENSMUSP00000127838  AICLAFVNMIPE..........TMQI......YMTradi.................YDKQIIEs....TAKVVIIYG.
ENSMUSP00000127513  NLCVAFSETIPKvy........SNEK......MKI.....................AVDAVKSs....TAKVIVLYA.
ENSMUSP00000129215  GICLAFVNVIPE..........TMKI......YMTrgnm.................YDKQIMTs....SAKVVIIYG.
ENSMUSP00000126953  GICLAFVNMIPE..........NMQI......YMTrati.................YDKQIMEs....TAKVVIIYG.
ENSMUSP00000071670  EICLAFVNMIPE..........NMQI......YMTrati.................YDKQIMTs....SANVVIIYG.
ENSMUSP00000131831  NLCVAFSETIPKvy........SNEK......MKI.....................AVDAVKSs....TAKVIVLYA.
ENSMUSP00000133218  GICLAFVNMIPE..........NMQI......YMTraki.................YDKQIMEs....TAKVAIIYG.
ENSMUSP00000092079  GICLAFVNVIPE..........TMKI......YMTrgnm.................YDKQIMTs....SAKVVIIYG.
ENSMUSP00000126698  TVCLAFVTIITY..........NRML......YLKmyhk.................YYHQITMs....SAKVVIVYG.
ENSMUSP00000128015  GICLAFVNMIPE..........DMQL......YMTraki.................YDKQIMEs....TAKVVIIYG.
ENSMUSP00000129540  TVCLAFVTSITY..........DKML......YLKmthky................YHQIIMS.....SAKVVVVYG.
ENSMUSP00000126596  GICLAFVNVIPE..........TMKI......YMTrgnm.................YDKQIMTs....SAKVVIIYG.
ENSMUSP00000128333  GICLAFVNMIPE..........DMQL......YMTraki.................YDEEIMTs....TAKVVIIYG.
ENSMUSP00000128792  GICLAFVNVIPE..........TMKI......YMTrgnm.................YDKQIMTs....SAKVVIIYG.
ENSMUSP00000129520  GICLAFVNMIPK..........DMQI......YMTrati.................HDKQIMEs....TAKVVIIYG.
ENSMUSP00000052977  GICLAFVNMIPG..........NMQL......YMTraki.................YDKQIMEs....TAKVVIIYG.
ENSMUSP00000078162  GICLAFVNMIPE..........DMQL......YMTrati.................YDKQIMEs....TAKVVMIYG.
ENSMUSP00000132467  EICFAFVKMISV..........DDIS......FEHktem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000129566  GVCIEFYLYVPShq........SLGK......IEE.....................TVRKMQKc....TARVVLVFL.
ENSMUSP00000036551  KVCIAFVNMIIQ..........NIQL......YQKraek.................YYNQILTs....SAKVIIIYG.
ENSMUSP00000126007  IVCLSFEITILTehsm......ARKE......FQR.....................YFNRIVMs....SAKVVIVYG.
ENSMUSP00000083386  GVCIEYHLHVPSyq........SLGK......IEE.....................TVQKMQKc....TAKVVLVFL.
ENSMUSP00000129960  EICFAFVKMISV..........DDIS......FEHktem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000066737  GLHTSAYNFDET..........KDLD......LDD.....................IVRYIQG.....SERVVIMCA.
ENSMUSP00000074613  EICFAFVKMISV..........DDIS......FEHktem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000129578  EICFAFVKMISV..........DDIS......FEHktem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000122645  IVCLSVAIIIQTekim......ALKE......FHT.....................HYNQIIMs....SAKVVIVYG.
ENSMUSP00000104194  EICFAFVKMISV..........DDIS......FEHktem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000132834  GVCIEYHLHVPShq........SLGK......IEE.....................TVQKMQKc....TSKVVLVFL.
ENSMUSP00000093612  GICLAFVNMIPE..........DMQL......YMTraei.................YDKQIMEs....TAKVVIIYG.
ENSMUSP00000126979  GVCIEYHLHVPShq........SFGK......IEE.....................TVQKMQKc....TARVVLVFL.
ENSMUSP00000126973  IVCLSVAIIIQTekfm......ALKE......FRM.....................NYNKIAMs....SATVVIVYG.
ENSMUSP00000127309  DICLAFVTIITY..........NTKL......FLTmtdt.................YYNQIMMs....LAKAVIIFG.
ENSMUSP00000126165  NLCIAFSETIPKvy........SNEK......MQI.....................AIDAVKSs....TAKVIVLYA.
ENSMUSP00000131128  GVCLAFVNVIPQ..........NMHL......FTTraek.................YYNQIITs....SANVVILYG.
ENSMUSP00000131990  EICFAFVKMISV..........DYVY......LEPeiem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000127337  EICFAFVKMISV..........DDVS......FPQntem.................YYNQIVMs....STNVIIIYG.
ENSMUSP00000030191  NLSVQHQV-YAR..........EPGG......PEQ.....................ATHFIRA.....NGRIVYICG.
ENSMUSP00000133007  EICFAFVKMISV..........DDIS......LEEktem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000131780  EICFAFVKMISV..........DDVS......FPQntem.................YYNQIVMs....STNVIIIYG.
ENSMUSP00000132457  EICFAFVKMISV..........DDVS......FPQntem.................YYNQIVMs....STNVIIIYG.
ENSMUSP00000076687  IVCLSVVIIIQT..........DDITa.....YKEyhmn.................YNKIVMS.....SAKVVIVYG.
ENSMUSP00000128102  EICFAFVKMISV..........DYVY......LEPeiem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000132539  EICFAFVKMISV..........DYVY......LEPeiem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000129411  IVCLSFVITILTehsm......AHKE......FQR.....................YFNRIVMs....SAKVVIVYG.
ENSMUSP00000132726  IVCLSVAIIIQTemsm......ALKE......LSM.....................NYKHISIs....SAKVVIVYG.
ENSMUSP00000132327  EICFDFVKMISV..........DYVY......LEPeiem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000030792  GICVAFKDVVPLsaqa......GDPR......MQR.....................MMLRLARa....RTTVVVVFS.
ENSMUSP00000133014  MVCLSFVFAILTehsm......VRKE......FHK.....................NFNLIVRs....SAKVVIVYG.
ENSMUSP00000126917  IVCLSFAIIIKTgkfl......AVTEl.....HMN.....................YKQILMS.....SAKVVIVYG.
ENSMUSP00000128337  EICFAFVKMISV..........DDVS......FPQntem.................YYNQIVMs....STNVIIIYG.
ENSMUSP00000132332  EICFAFVKMISV..........DDVS......FPQntem.................YYNQIVMs....STNVIIIYG.
ENSMUSP00000133265  EICFAFVKMISV..........DDVS......FPQntem.................YYNQIVMs....STNVIIIYG.
ENSMUSP00000126863  EICFAFVKMISV..........DYVY......LEPeiem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000127146  EICFAFVKMISV..........DYVY......LEPeiem.................YYKQIVMs....SSNVIIIYE.
ENSMUSP00000130631  EICFAFVKMISV..........DDVS......FPQntem.................YYNQIVMs....STNVIIIYG.
ENSMUSP00000132337  IVCLSVAIIIQTevym......ALKEl.....HMN.....................YKKILMS.....SAKVVIVYG.
ENSMUSP00000072566  EICFAFVKMISV..........DDVS......FPQntem.................YYNQIVMs....STNVIIIYG.
ENSMUSP00000129466  EICFAFVKMISV..........DDVS......FPQniem.................YYNQIVMs....STNVIIIYG.
ENSMUSP00000075833  EICFAFVKMISV..........DDVS......FPQntem.................YYNQIVMs....STNVIIIYG.
ENSMUSP00000087221  GICLAFVNMIPE..........NMQI......YMTrati.................YDKQIMTs....SAKVVIIYG.
ENSMUSP00000124342  GICVAFAEKVTEy.........SSKN......TVN.....................WKRFMERft...LTPVIITFG.
ENSMUSP00000104190  EICFAFVKMISV..........DEVS......FPQktei.................YYKQIVKs....LTNVIIIYG.
ENSMUSP00000083463  EICFAFVKMISV..........DEVS......FPQktei.................NYKQIVKs....LTNVIIIYG.
ENSMUSP00000126682  GLCVAFAEKVPEf.........PAKDtv....NRE.....................LFMERFT.....LTHVIVAFG.
ENSMUSP00000079827  EICFAFVKMISV..........DDTS......FPHktemd................YNQIVMS.....STNVIIIYG.
ENSMUSP00000074476  EICFAFVKMISV..........DDIL......LEQktem.................YYQQIVMs....SSNVIIIYE.
ENSMUSP00000069647  KICFAFVKMISV..........DDIL......LEQktem.................YYQQIVMs....SSNVIIIYE.
ENSMUSP00000083477  EICFAFVNMIGIs.........DILT......YATtem..................NYNQIMMs....STNVIIIYG.
ENSMUSP00000073604  GICVAFAEKVPEf.........PAKD......TVN.....................RKRFMERfs...LTRVIIAFG.
ENSMUSP00000072296  EICFAFVKMISV..........DDTS......FPHktemd................YNQIVMS.....STNVIIIYG.
ENSMUSP00000129703  IVCLSVVITIKTqklv......ALKEl.....HMN.....................YKQILMS.....SAKVVIVYG.
ENSMUSP00000083478  EICFAFVKMISV..........DDIL......LEQktem.................YYQQIVMs....SSNVIIIYE.
ENSMUSP00000083468  EICFAFVKMISV..........DDTS......FPHktemd................YNQIVMS.....STNVIIIYG.
ENSMUSP00000132043  GLCVAFAEKVPEil........GENTv.....NRK.....................RFMERFS.....LTRVIIAFG.
ENSMUSP00000092462  EICFAFVKMISV..........DEVS......FPQktei.................YYKQIVKs....LTNVIIIYG.
ENSMUSP00000092460  EICFAFVKMISV..........DDTS......FPHktemd................YNQIVMS.....STNVIIIYG.
ENSMUSP00000130160  EICFAFVKMISV..........DDTS......FPHktemd................YNQIVMS.....STNVIIIYG.
ENSMUSP00000098528  GLCIAFAVRSPIf.........PCRN......TVNli...................ILEEELG.....SLDVVLVYG.
ENSMUSP00000030949  GICIAHEGLVPQ..........HDTSgqqlgkVLD.....................VLRQVNQs....KVQVVVLFA.
ENSMUSP00000129352  EICFAFVKMIGIshif......TYA-......--Stemd.................YNQIMMS.....STNVIIIYG.
ENSMUSP00000132206  TVCFAFVSMIPV..........NMHL......YMTrtev.................YYNQIMTs....STNVVIIYG.
ENSMUSP00000032238  GICFAFAEKVTEy.........SSMD......TVN.....................WKHFMERlt...LTPVIITVG.
ENSMUSP00000127506  DICVAFTKSLKT..........NWKVq.....YTSgvg..................LANLNHHp....QVNVNILYG.
ENSMUSP00000074602  GLCVAFAEKVTEfsat......KSVN......LKH.....................FMERVTL.....-TGVIVAFGd
ENSMUSP00000128981  GLCVAFAEKIQGila.......EDKV......NTK.....................LFNEKFT.....LTRVIIAFG.
ENSMUSP00000020062  NVCIAFKEVLPAfl........SDNTievr..INQ.....................TLEKIIAea...QVNVIVVFL.
ENSMUSP00000129145  GLCVAFAEKIQGila.......EDKV......NTK.....................LFNEKFT.....LTRVIIAFG.
ENSMUSP00000030510  DICIAFQEVLPVpepnqavrpeEQ-Dq.....LDN.....................ILDKLRRt....SARVVVIFS.
ENSMUSP00000128600  VVCLSVAIIIQTqkfm......ALKD......YRM.....................NYNKIAMs....SAKVVIVYG.
ENSMUSP00000025338  GIEITFRQSF--..........-FSD......PAV.....................PVKNLKRq....DARIIVGLF.
ENSMUSP00000092459  EICFAFVKMISV..........DDVS......LPHttem.................YYSQIVMs....LTNIIIIYG.
ENSMUSP00000044521  GLPVGVVLTSGR..........DSQS......IQK.....................ALQQIRQad...RIRIIIMCM.
ENSMUSP00000127895  EICFAFVKMISV..........DDTS......FPHktemd................YNQIVMS.....STNVIIIYG.
ENSMUSP00000068253  -FNITASMRYNS..........SSSD......LLQ.....................EGLRNMSy....VARVIILIC.
ENSMUSP00000103378  DIEISDTESF--..........-SND......PCT.....................SVKKLKGn....DVRIILGQF.
ENSMUSP00000131564  GICLAFVKMTPE..........TWTS......YVA.....................KFWENMD.....ETNVTIIYG.
ENSMUSP00000131156  GICLAFVKMTPA..........TWTS......YFA.....................KFWENMD.....ETNVTIIYG.
ENSMUSP00000077758  NLRLKIRQ-LPA..........DTKD......AKP.....................LLKEMKRg....KEFHVIFDC.
ENSMUSP00000095875  GLPIGLVTSLGP..........GEKG......ATE.....................VCKQLHSvh...GLKIVVLCM.
ENSMUSP00000072107  NIKIKIRQ-LPS..........GNKD......AKP.....................LLKEMKKg....KEFYVIFDC.
ENSMUSP00000030676  NIRLKIRQ-LPI..........DSDD......SRP.....................LLKEMKRg....REFRIIFDC.
ENSMUSP00000027020  GWHVSAICVENF..........NDVS......YRQ.....................LLEELDRr....QEKKFVIDC.
ENSMUSP00000032338  SEVLNFKDVL-R..........RSEQ......FQE.....................ILTGHNR.....KSNVIVMCG.
ENSMUSP00000109949  ESKSKKRNYENL..........DQLS......YDNkrgpkaekvlqfdpgtknvtaLLMEARDl....EARVIILSA.
ENSMUSP00000044494  NWQVTAVNILTT..........TEEG......YRM.....................LFQDLEKk....KERLVVVDC.
ENSMUSP00000103375  KWQVTAINVGNInndk......KDET......YRS.....................LFQDLELk....KERRVILDC.
ENSMUSP00000075687  NWQVTARSVGNIk.........DIQE......FRR.....................IIEEMDRr....QEKRYLIDC.
ENSMUSP00000021259  GLPVALVTSMETs.........DRSG......ARE.....................ALGRIRDgp...RVRVVIMVM.
ENSMUSP00000034515  D---TLSVRMLD..........DTRD......PTP.....................LLKEIRDd....KTATIIIHA.
ENSMUSP00000003468  KETLSVR--MLD..........DSRD......PTP.....................LLKEIRDd....KVSTIIIDA.
ENSMUSP00000093536  GMDVALQKVENNinkmit....TLFD......TMRie...................ELNRYRD.....TLRRAILVM.
ENSMUSP00000044009  GLDVSLQKVDKNishvfts...LFT-......--Tmkte.................ELNRYRD.....TLRRAILLL.
ENSMUSP00000129679  ------------..........----......---.....................-------.....---------.
ENSMUSP00000062284  GWELEEVLLLDM..........SLDDg.....DSK.....................IQNQLKKl....QSPIILLYC.
ENSMUSP00000002848  LVGWEHRGALTL..........DPGA......GEAv....................LGAQLRSv....SAQIRLLFC.
ENSMUSP00000091381  HLESIINITANLs.........STKD......LLSflqv.................QLENIRNs....TPTMVMFGC.
ENSMUSP00000032331  GWDMQNVITLDT..........SFED......AKT.....................QVQLKKI.....HSSVILLYC.
ENSMUSP00000097013  ------------..........----......---.....................-------.....---------.
ENSMUSP00000003351  SWRLLDVLTLEL..........GPGG......PRA.....................RTQRLLRqv...DAPVLVAYC.
ENSMUSP00000105373  ------------..........----......---.....................-------.....---------.
ENSMUSP00000093345  ------------..........----......---.....................-------.....---------.


                           220              230       240             250               260       27
                             |                |         |               |                 |         
d1jdpa_               SS.....DTIRS.....I..MLVAHRHGMTSGDYAFFNIE.....LFN.SSS......YGDGSWK..RGDKHDFEAKQ
ENSMUSP00000037255  EG.....MTVRG.....L..LSAMRRLGVVG-EFSLIGSD.....GWA.DRDe.....VIEGYEV..E----------
ENSMUSP00000129181  EG.....MTVRG.....L..LMAMRRLGLAG-EFLLLGSD.....GWA.DRY......DVTDGYQ..RE---------
ENSMUSP00000131856  DI.....TSVQG.....L..MRHIAQLLVT--WKVWVLNS.....SWD.VDT......HSDYF--..--------MVE
ENSMUSP00000126650  DI.....VSLQG.....L..MRHIAQLLVT--WKVWVLNS.....QWD.VDT......HSDYF--..--------MLE
ENSMUSP00000029540  SP.....DAFRN.....L..MLLALDAGLTGEDYVFFHLD.....VFG.QSLqgaqgpVPRKPWE..RDDGQDRRARQ
ENSMUSP00000125817  DT.....VSLQG.....L..MRHIAQLLVT--WKVWVLNS.....QWD.IDY......YSDYF--..--------MIE
ENSMUSP00000113819  NE.....DDIRR.....V..LEAARRANQTG-HFFWMGSD.....SWG.SKS......APVLR--..--------LEE
ENSMUSP00000129576  DI.....ISVQG.....L..MRHIAQLLVT--WKVWVLTS.....SWD.VDT......HSDYF--..--------MVE
ENSMUSP00000126966  DI.....ISVQG.....L..MRHIAQLLVT--WKVWVLSS.....SWD.VDT......HSDYF--..--------MVE
ENSMUSP00000129089  DI.....VSLQG.....L..MRHIAQLLVT--WKVWVLNS.....QWD.IDY......YSDYF--..--------MIE
ENSMUSP00000128493  DI.....ISVQG.....L..MLHITQLLVT--WKVWVLNS.....SWD.VDS......HSDYF--..--------MVE
ENSMUSP00000069080  SG.....PDLEP.....L..IKEIVRRNIT--GRIWLASE.....AWA.SSS......LIAMPEY..---------FH
ENSMUSP00000064404  ND.....EDIKQ.....I..LAAAKRADQVG-HFLWVGSD.....SWG.SKI......NPLHQHE..DI---------
ENSMUSP00000129068  DI.....VSLQG.....L..MRHIAQLLVT--WKVWVLNS.....QWD.IDY......YSDYF--..--------MIE
ENSMUSP00000129308  DI.....VSLQG.....L..MRHIAQLLVT--WKVWVLNS.....QWD.IDY......YSDYF--..--------MIE
ENSMUSP00000087998  NE.....DDIRR.....I..LEAAKKLNQSG-HFLWIGSD.....SWG.SKI......APVYQQE..EI---------
ENSMUSP00000129762  DI.....DSLEG.....L..MRNIRQRLLT--GKVWVM--.....---.---......--NIEPH..FTDYADYFFLD
ENSMUSP00000000631  NE.....DDIRR.....V..LEATRQANLTG-HFLWVGSD.....SWG.SKI......SPILN--..--------LEE
ENSMUSP00000129296  DI.....DSTLVv....I..FKASGQVDP---WRVWVTTS.....QWD.IAS......SVRHF--..--------ILD
ENSMUSP00000129895  DI.....DSLEI.....L..MQIIGQRLLT--WNIWIM--.....---.---......--NNEPH..IIELSDYFMLD
ENSMUSP00000048706  DI.....DSLEG.....L..MRNIGQRLLT--WHVWVM--.....---.---......--NIEPH..IIEYDNYFMLD
ENSMUSP00000029406  SD.....IDLSL.....F..VLEMIHHNIT--DRTWIATE.....AWI.TSA......LIAKPEY..FP---------
ENSMUSP00000126559  DV.....DSLEG.....V..IRNIEQRLLT--QNVWIM--.....---.---......--NIEHH..VIDRADYFMLD
ENSMUSP00000127465  DT.....DSLAS.....L..MRNIGQRLLT--WNVWVM--.....---.---......--NIEHH..VIDTADYFMLD
ENSMUSP00000129347  DV.....DSLTG.....L..MRNIGQRLLT--AKVWVM--.....---.---......--NIEPH..ITDYADYFMFD
ENSMUSP00000131426  SI.....AFILT.....V..IKNRHSKYIT--KKVWVMNS.....KWV.GQK......FEQYT--..--------MLE
ENSMUSP00000128685  DT.....DSLAS.....L..MRNIGQRLLT--WNVWVM--.....---.---......--NIEHH..VIDTADYFMLD
ENSMUSP00000132641  DI.....DSLIG.....L..MRNIGERLLT--GKVWVM--.....---.---......--NIEPY..ITDYADYFMFD
ENSMUSP00000004076  RS.....DDSRE.....L..IAAASRVNA---SFTWVASD.....GWG.AQE......SIVKGSE..HV---------
ENSMUSP00000124192  TD.....IDLSP.....F..VLEVIHHNIT--DRTWIATE.....AWI.TSA......LIAKPEY..FP---------
ENSMUSP00000128975  EM.....NSTLE.....Is.FRRWQDLGA---QRIWITTS.....QWD.VII......NKKDF--..--------SLD
ENSMUSP00000126106  DI.....DSLEG.....V..MRNIEQRLLT--WNIWIM--.....---.---......--NIEHH..VIDRADYFMLD
ENSMUSP00000023959  RS.....EDARE.....L..LAATQRLNA---SFTWVASD.....GWG.ALE......SVVAG--..--------SER
ENSMUSP00000126534  DI.....DSLEI.....L..MRNIGQRLLT--LKVWVL--.....---.---......--NIEPH..VTDYADYFLLD
ENSMUSP00000126756  DV.....DSLEG.....I..MRNIEQRLLT--QNVWIM--.....---.---......--NIEHH..VIDRADYFMLD
ENSMUSP00000078200  DI.....DSLEG.....L..MRNIGQRLLT--WIVWVMNT.....EHH.VLE......ISDYF--..--------MLD
ENSMUSP00000129313  EN.....DSLEG.....I..IRNIEQRLLT--WNVWIM--.....---.---......--NIEHH..VIDRADYFMLD
ENSMUSP00000130373  DI.....DSLTG.....L..MRNIGQRLLT--AKVWIMNT.....EPH.ITD......YADYF--..--------MLD
ENSMUSP00000128350  DI.....DSLEG.....L..VRNIGQRLLT--WNVWVMNV.....EYN.IKL......ITDYF--..--------LLD
ENSMUSP00000094994  DT.....DSTLA.....Vs.FRMWESLGI---QRLWITTS.....QWD.VSP......SMKDFTF..GN---------
ENSMUSP00000090148  DT.....DSTLA.....Vs.FRMWESLGI---QRLWITTS.....QWD.VSP......RMKDFTF..GN---------
ENSMUSP00000131261  DI.....DSLEG.....I..MRNIEQRLLT--WNIWIM--.....---.---......--NIEHH..VIDRADYFILD
ENSMUSP00000131925  SD.....IDLSP.....F..VLEVIHHNIT--HRTWIASE.....AWI.TSA......LIAKPEY..FP---------
ENSMUSP00000130114  PT.....SILLT.....Li.ESTYRKYNM---KKIWVMNT.....KWF.---......-------..CPNIELYNMLE
ENSMUSP00000131583  DV.....DSLEG.....V..MRNIEQRLLT----------.....--R.NVW......NMNIEHH..VIDRADYFMLD
ENSMUSP00000126885  DT.....DSTLA.....Vs.FRMWESLGI---QRLWITTS.....QWD.VSP......SMKDFTF..GN---------
ENSMUSP00000127981  DT.....DSTLA.....Vs.FRMWESLDI---KRIWVTTS.....QWA.ITT......GKKDFTF..NN---------
ENSMUSP00000132299  PT.....SILLT.....Li.ESTYRKYNM---KKIWIMNS.....KWF.CP-......-------..--NLELYNMIE
ENSMUSP00000131447  DT.....DSTLA.....Vs.FRMWESLGI---QRLWITTS.....QWN.VSP......GMKDFTF..GN---------
ENSMUSP00000128106  DT.....DSTLA.....Vs.FRMWESLGI---QRLWITTS.....QWD.VSP......SMKDFTF..GN---------
ENSMUSP00000077109  TD.....IDLGP.....F..VLEVIHHNIT--DRTWIASE.....AWI.TSA......LIAKPEY..FP---------
ENSMUSP00000020547  PT.....SILLT.....L..IENTYRTYNK--KKIWVMST.....KWFcPNL......ELYN---..--------MLE
ENSMUSP00000131450  EM.....NSTLE.....Vs.FRRWAYLCA---RRIWITTS.....QWD.VIT......NKRDFSF..DF---------
ENSMUSP00000125126  EM.....NSTLE.....Vs.FRRWENLGA---RRIWITTS.....QWD.VIT......NKKEFTL..NL---------
ENSMUSP00000126386  DI.....DSLEG.....L..MRNIGQRILT--WIVWVMN-.....---.---......---IEHT..ITYDNDYFMLD
ENSMUSP00000127505  DT.....DSTLA.....Vs.FRMWESLGI---QRLWITTS.....QWD.VSP......SMKDFTF..GN---------
ENSMUSP00000124065  EM.....NSTLE.....Vs.FRRWEDLGA---RRIWITTS.....QWD.IIL......NKKEFTL..NL---------
ENSMUSP00000132478  DK.....ESPLQ.....Fn.FILWKSENI---QRLWVSVS.....QFD.IIT......MIGEF--..--------MLN
ENSMUSP00000127838  EM.....NSTLE.....Vs.FRRWGYLGA---RRIWITTS.....QWD.VIT......NEKDF--..--------SLD
ENSMUSP00000127513  TD.....IDLSP.....F..VLEVIHHNIT--DRTWIATE.....AWI.TSA......LIAKPEY..FP---------
ENSMUSP00000129215  EM.....NSTLE.....Is.FRRWVYLGA---RRIWITTS.....QWD.VIT......NKKDF--..--------SLD
ENSMUSP00000126953  EM.....NSTLE.....Vs.FRRWEDLGV---RRIWITTS.....QWD.VIT......NKNDF--..--------SLD
ENSMUSP00000071670  EM.....NSTLE.....Vs.FRRWEELGA---WRIWITTS.....QWD.VIK......NKKEFTF..NL---------
ENSMUSP00000131831  TD.....IDLCP.....F..VLEVIHHNIT--DRTWIATE.....AWI.TSA......LIAKPEY..FP---------
ENSMUSP00000133218  EM.....NSSLE.....Vs.FRRWEDLGV---RRIWITTS.....QWD.VIT......NKNDF--..--------SLD
ENSMUSP00000092079  EM.....NSTLE.....Is.FRRWAYLGA---RRIWITTS.....QWD.VIT......NKKDF--..--------SLD
ENSMUSP00000126698  DK.....ESPLQ.....Fn.FILWKSENI---QRLWVSVS.....QFD.MIT......VIRDF--..--------MLN
ENSMUSP00000128015  EM.....NSTLE.....Vs.FRRWEDLGA---RRIWITTS.....QWD.VIT......NKNDF--..--------SLD
ENSMUSP00000129540  DK.....ESPLQ.....Ln.FMLWKSINI---QRLWVSVS.....QFD.MIT......MMGDF--..--------MLN
ENSMUSP00000126596  EM.....NSTLE.....Is.FRRWVYLGA---RRIWITTS.....QWD.VIT......NKKDF--..--------SLD
ENSMUSP00000128333  EM.....NSTLQ.....Vs.FRRWEDLGV---RRIWITTS.....QWD.VIT......NKNDF--..--------SLD
ENSMUSP00000128792  EM.....NSTLE.....Is.FRRWVYLGA---QRIWITTS.....QWD.VIT......NKKDF--..--------SLD
ENSMUSP00000129520  EM.....NSTLE.....Vs.FRRWEDLGA---RRIWITTS.....QWD.VIT......NKNDF--..--------SLD
ENSMUSP00000052977  EM.....NSTLE.....Vg.FRRWIHLGV---RKIWITTS.....QWD.VVT......NKKDFSF..NF---------
ENSMUSP00000078162  EM.....NSTLE.....Vs.FRRWEDLSI---RRIWITTS.....QWD.VIT......NKNDF--..--------SLD
ENSMUSP00000132467  ET.....IDFID.....L..IFRMWEPPVL--QRIWITTK.....QWN.FPT......SKRDITH..GT---------
ENSMUSP00000129566  SN.....YNFQL.....I..LYGLLAVPVS--GQVWVSKD.....TLH.MAL......ALTIPG-..--------ISQ
ENSMUSP00000036551  DS.....DILTV.....H..FRLWQHLGI---KRLWITTS.....HWD.ENT......SKGDL--..--------LLS
ENSMUSP00000126007  DY.....TSPID.....Lv.LHLCKSKGI---FRIWVSVS.....QFD.MIT......KLGDF--..--------MLY
ENSMUSP00000083386  SN.....LNFQL.....I..LRGLLGVPVS--GQVWVSKG.....TLH.MAL......ALTIPG-..--------ISQ
ENSMUSP00000129960  ET.....IDFID.....L..IFRMWEPPVL--QRIWITTK.....QWN.FPT......SKRDITH..GT---------
ENSMUSP00000066737  SG.....DTIRR.....I..MLAVHRHGMTSGDYAFFNIE.....LFN.SSS......YGDGSWR..RGDKHDSEAKQ
ENSMUSP00000074613  ET.....INFID.....L..IFRMWEPPVL--QRIWITTK.....QWN.FPT......SKRDITH..GT---------
ENSMUSP00000129578  ET.....IDFVD.....Li.FRMWEPPGL---QRIWITTK.....QWN.FPT......SKRDITH..GI---------
ENSMUSP00000122645  DK.....DSPIH.....Fa.LIVWKSKGI---WRIWVSVS.....QFD.MIT......IIGDFLL..----------Y
ENSMUSP00000104194  ET.....IDFID.....L..IFRMWEPPVL--QRIWITTK.....QWN.FPT......SKRDITH..GT---------
ENSMUSP00000132834  SN.....SNFQL.....I..LHGLLGVPVS--GQVWVSKG.....TLH.MAL......ALTIPG-..--------ISQ
ENSMUSP00000093612  EM.....NSTLE.....Vs.FRRWEDKGV---RRIWIATL.....QWD.VIT......NKKDF--..--------TLD
ENSMUSP00000126979  SN.....SNFQL.....I..LHGLLAVPVS--GQVWVSMD.....TLH.MAL......ALTIPG-..--------ISQ
ENSMUSP00000126973  DK.....DSPIQ.....Ft.LIMWKSEGI---WRIWVSVS.....QFD.MIT......VIGDF--..--------LLY
ENSMUSP00000127309  DK.....DSLLQv....I..FRLWQFLDI---RRIWVTTS.....QWD.IIT......SNGEFLF..NS---------
ENSMUSP00000126165  TD.....FDLSP.....F..VLEVIHHNIA--HRTWIATE.....AWI.TSA......LIAKPEY..FP---------
ENSMUSP00000131128  EL.....NTALE.....Vs.FKHWKYLGT---QKIWFTTS.....QWD.AIT......REKDFSL..TS---------
ENSMUSP00000131990  EK.....DNFFD.....L..IFRMWEPPVL--QRIWITTK.....QWN.CPT......SKRDITH..GT---------
ENSMUSP00000127337  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKKDISH..GT---------
ENSMUSP00000030191  PL.....EMLHE.....I..LLQAQRENLTNGDYVFFYLD.....VFG.ESLragptrATGRPWQdnRTQEQAQALRE
ENSMUSP00000133007  ET.....INFID.....L..IFRMWEPPVL--QRIWITTK.....QWN.FPT......SKRDITH..DT---------
ENSMUSP00000131780  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKKDISH..GT---------
ENSMUSP00000132457  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKKDISH..GT---------
ENSMUSP00000076687  DH.....NSPIK.....Fv.LFLWKSQGI---FRIWVSVS.....QFD.MIT......PLGDF--..--------MLY
ENSMUSP00000128102  EK.....DNFFD.....L..IFRMWEPPVL--QRIWITTK.....QWN.CPT......SKRDITH..GT---------
ENSMUSP00000132539  EK.....DNFFD.....L..IFRMWEPPVL--QRIWITTK.....QWN.CPT......SKRDITH..GT---------
ENSMUSP00000129411  DY.....TSPID.....Lv.LHLCKSKGI---FRIWVSVS.....QFD.MIT......YLGDF--..--------MLY
ENSMUSP00000132726  DK.....FSPIN.....Ya.LTLWISQGI---LRIWVSVS.....QFD.MIT......ILGDF--..--------LLY
ENSMUSP00000132327  EK.....DNFFD.....L..IFRMWEPPVL--QRIWITTK.....QWN.FPT......SKRDITH..GT---------
ENSMUSP00000030792  NR.....HLAGV.....F..FRSVVLANLT--GKVWIASE.....DWA.IST......YITNVP-..--------GIQ
ENSMUSP00000133014  DY.....ASPID.....Lv.LHWFKSKGL---FRIWVSVS.....QFD.IIT......NLGDF--..--------MLY
ENSMUSP00000126917  YR.....DSPII.....Ya.FIVWKSQDL---FRIWVSVS.....QLD.MIT......FLGDF--..--------LLY
ENSMUSP00000128337  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKKDISH..GT---------
ENSMUSP00000132332  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKKDISH..GT---------
ENSMUSP00000133265  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKKDINH..GT---------
ENSMUSP00000126863  EK.....DNFFD.....L..IFRMWEPPVL--QRIWITTK.....QWN.CPT......SKRDITH..GT---------
ENSMUSP00000127146  EK.....DNFFD.....L..IFRMWEPPVL--QRIWITTK.....QWN.CPT......SKRDITH..GT---------
ENSMUSP00000130631  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKKDISH..GT---------
ENSMUSP00000132337  DK.....DSPIK.....Yv.LTAWKSQGI---FRIWVSAS.....QFD.MIT......ILGDF--..--------LLY
ENSMUSP00000072566  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKKDISH..GT---------
ENSMUSP00000129466  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKTDISH..GT---------
ENSMUSP00000075833  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKTDISH..GT---------
ENSMUSP00000087221  DM.....NSTLE.....Is.FRRWEDLGA---QRIWITTS.....QWD.VIT......NKKDFTL..NL---------
ENSMUSP00000124342  DT.....HSLLR.....I..VYFVIFYNLL--GNVWITTSd....WYI.TTL......PFEQNLI..Y---------T
ENSMUSP00000104190  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......SKTDISH..DT---------
ENSMUSP00000083463  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......SKTDISH..DT---------
ENSMUSP00000126682  DT.....YSLLR.....F..VYNIFCNTPF--GNIWITTS.....DWD.ITTls....FQQNL--..--------GYT
ENSMUSP00000079827  ET.....RNFIY.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKTDISH..GT---------
ENSMUSP00000074476  ET.....INFID.....L..IFRMWEPPVL--RRIWITTK.....QWN.FPT......SKRDITH..GT---------
ENSMUSP00000069647  ET.....INFID.....L..IFRMWEPPVL--RRIWITTK.....QWN.FPT......SKRDITH..GT---------
ENSMUSP00000083477  ET.....NNFIE.....L..SFRIWESTVI--QRIWVTTI.....QLN.FPT......SKKDLNH..GT---------
ENSMUSP00000073604  DT.....YSLLS.....F..VDMIIHYGTF--HNVWITTS.....DWD.FTT......FPFHQHK..--------SHI
ENSMUSP00000072296  ET.....RNFIY.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKTDISH..GT---------
ENSMUSP00000129703  YK.....DSPII.....Ya.LISWKSHGI---FRIWVSVS.....QFD.MIT......IRGDF--..--------LLY
ENSMUSP00000083478  ET.....INFID.....L..IFRMWEPPVL--QRIWITTK.....QWN.FPT......SKRDITH..GT---------
ENSMUSP00000083468  ET.....RNFIY.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKTDISH..GT---------
ENSMUSP00000132043  DT.....YSLLA.....L..PVHTTFYTTF--HNVWITTS.....DWD.ITF......YFQQPI-..--------SYK
ENSMUSP00000092462  ET.....YNFID.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......SKTDISH..DT---------
ENSMUSP00000092460  ET.....RNFIY.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKTDISH..GT---------
ENSMUSP00000130160  ET.....RNFIY.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKTDISH..GT---------
ENSMUSP00000098528  DS.....YDFFW.....I..VLYIPFLPFN--GNVLITNS.....DWY.TTF......PYFH---..------NQVYE
ENSMUSP00000030949  SA.....RAVYS.....L..FSYSIHHGLS--PKVWVASE.....SWL.TSD......LVMTLP-..--------NIA
ENSMUSP00000129352  ET.....SNFIE.....L..NFRIWESTVI--QRIWVTTV.....QLN.FPT......SKKDLTH..GP---------
ENSMUSP00000132206  DT.....DSTLA.....Vs.FRMWESLDI---KRIWVTTS.....QWA.ITT......GKKDFTF..NN---------
ENSMUSP00000032238  DT.....HSLLR.....I..VYFVIFYNLS--GNVWITTSd....WYI.TTL......PFEQNLI..YT---------
ENSMUSP00000127506  DI.....DDLLY.....F..CLENKLLS--SRRKVWIMAK.....LHL.VYL......ESVFFKR..KD------LIN
ENSMUSP00000074602  TH.....DFLIS.....V..YLSIYYAPF---GNIWITTS.....DWY.ITL......PIEQNR-..--------VYR
ENSMUSP00000128981  DT.....YSLLA.....L..AVHTTFYTTF--RNVWITTS.....DWD.ITF......YFQQPK-..--------SYE
ENSMUSP00000020062  RK.....FHVFN.....L..FTKAIERKI---SKIWIASD.....NWS.TATkii...T--IP--..--------NVK
ENSMUSP00000129145  DT.....YSLLA.....L..AVHTTFYTTF--RNVWITTS.....DWD.ITF......YFQQPK-..--------SYE
ENSMUSP00000030510  PE.....LSLHN.....F..FREVLRWNFT--GFVWIASE.....SWA.IDP......VLHNLTE..---------LR
ENSMUSP00000128600  DK.....DSPIQ.....Ft.LIMWKSEGI---RRIWVSVS.....QFD.MIT......IIGEF--..--------LLY
ENSMUSP00000025338  YE.....TEARK.....V..FCEVYKERLFGKKYVWFLIG.....WYA.DNW......FKTYDP-..SINCTVEEMTE
ENSMUSP00000092459  ET.....YNFID.....L..IFRMLDPPTL--QRIWITTI.....EWN.FPT......SNTDINH..GT---------
ENSMUSP00000044521  HSaliggETQTH.....F..LELAHDLKMTDGTYVFVPYD.....VLL.YSL......PYKHSPY..QVLRNNPKLRE
ENSMUSP00000127895  ET.....RNFIY.....L..IFRMWEPPIL--QRIWITTK.....QLN.FPT......RKTDISH..GT---------
ENSMUSP00000068253  SS.....EDARR.....I..LQAAVDLGLDTGEFVFILLQ.....QLE.DSF......WKEV---..LTKDKVIRFPK
ENSMUSP00000103378  DQ.....NMAAK.....V..FCCAFEESMFGSKYQWIIPG.....WYE.PAW......WEQVHVEanSSRCLRRSLLA
ENSMUSP00000131564  EI.....DSLEG.....I..MRNIEQRLLT--WNVWIM--.....---.---......--NIEHH..VIDRADYFMLD
ENSMUSP00000131156  DI.....DSLEG.....V..MRNIEQRLLT--WNVWIM--.....---.---......--NIEHH..IIDIADYFMLD
ENSMUSP00000077758  SH.....EMAAG.....I..LKQALAMGMMTEYYHYIFTT.....LDL.FAL......DVEPYRY..SG---------
ENSMUSP00000095875  HS.....ALLGGleqttL..LHCAWEEGLTDGRLVFLPYD.....TLL.FAL......PYGNRSY..LVLDDHGPLQE
ENSMUSP00000072107  SH.....ETAAE.....I..LKQILFMGMMTEYYHYFFTT.....LDL.FAL......DLELYRY..SG---------
ENSMUSP00000030676  SH.....TMAAQ.....I..LKQAMAMGMMTEYYHFIFTT.....LDL.YAL......DLEPYRY..SG---------
ENSMUSP00000027020  EI.....ERLQN.....I..LEQIVSVGKHVKGYHYIIAN.....LGF.KDI......SLERFIH..GG---------
ENSMUSP00000032338  TP.....ESFYD.....VkgDLQVAE------DTVVILVD.....LFS.NHY......FEENTT-..--------APE
ENSMUSP00000109949  SE.....DDAAT.....V..YRAAAMLNMTGSGYVWLVGE.....REI.SGN......A------..--------LRY
ENSMUSP00000044494  ES.....ERLNA.....I..LGQIVKLEKNGIGYHYILAN.....LGF.MDI......DLNKFKE..SG---------
ENSMUSP00000103375  ER.....DKVND.....I..VDQVITIGKHVKGYHYIIAN.....LGF.TDG......DLLKIQF..GG---------
ENSMUSP00000075687  EV.....ERINT.....I..LEQVVILGKHSRGYHYMLAN.....LGF.TDI......VLERVMH..GG---------
ENSMUSP00000021259  HSvllggEEQRY.....L..LEAAEELALTDGSLVFLPFD.....TLH.YAL......SPGPEAL..AAFVNSSQLRR
ENSMUSP00000034515  NA.....SMSHT.....I..LLKAAELGMVSAYYTYIFTN.....LEF.SLQ......RMDSLVD..DR---------
ENSMUSP00000003468  NA.....SISHL.....V..LRKASELGMTSAFYKYILTT.....MDF.PIL......HLDGIVE..DS---------
ENSMUSP00000093536  NP.....ATAKS.....F..ISEVVETNLVAFDCHWIIIN.....EEI.NDV......DVQEL--..--------VRR
ENSMUSP00000044009  SP.....QGAHS.....F..INEAVETNLASKDSHWVFVN.....EEI.SDP......EILDL--..--------VHS
ENSMUSP00000129679  --.....-----.....-..--------------------.....---.---......-------..-----------
ENSMUSP00000062284  TK.....EEATY.....I..FEVANSVGLTGYGYTWIVPS.....LVA.GDT......DTVPSEF..PT---------
ENSMUSP00000002848  AR.....EEAEP.....V..FRAAEEAGLTGPGYVWFMVGpqlagGGG.SGV......PGEPLLL..PG------GAP
ENSMUSP00000091381  DM.....GSIRQ.....I..FEMSTQFGLSPPDLHWVLGD.....SQN.VEE......LRTEGLP..LG-------L-
ENSMUSP00000032331  SK.....DEAVL.....I..LSEARSLGLTGYDFFWIVPS.....LVS.GNT......ELI----..--------PKE
ENSMUSP00000097013  --.....-----.....-..--------------------.....---.---......-------..-----------
ENSMUSP00000003351  SR.....EEAEV.....L..FAEAAQAGLVGPGHVWLVPN.....LAL.GST......DAPPAAF..PV---------
ENSMUSP00000105373  --.....-----.....-..--------------------.....---.---......-------..-----------
ENSMUSP00000093345  --.....-----.....-..--------------------.....---.---......-------..-----------


                      0         280             290                               300               
                      |           |               |                                 |               
d1jdpa_               AYSSLQT..VTLLRT......VKPEFEKF..........SMEVK..............SSVEKQGLN..MEDY.....
ENSMUSP00000037255  -ANGGIT..IKLQSP......EVRSFDDYflklrldtntRNPWF..............PEFWQHRFQ..CRLPghlle
ENSMUSP00000129181  -AVGGIT..IKLQSP......DVKWFDDYylklrpetnlRNPWF..............QEFWQHRFQ..CRLEgfaqe
ENSMUSP00000131856  SFHGSLV..FSHHRE......EMVEFMNF..........VQTVNpykypedtyl....PKFWHLFFK..CSFSefdcq
ENSMUSP00000126650  SLHGSFI..FSHHHE......EMAEFTNF..........IRTVNpykypednyl....PKFWYLFFK..CSFSefdcq
ENSMUSP00000029540  AFQAAKI..ITYKEP......DNPEYLEF..........LKQLK..............LLADKKFNFtmEDGL.....
ENSMUSP00000125817  SFHGSLI..FSHHHE......EMVEFVNF..........VQTVNpytypedayl....PKFWVFFFN..CSFSefdcq
ENSMUSP00000113819  VAEGAVT..ILPKRT......SVRGFDRYfssrtldnnrRNIWF..............AEFWEDNFH..CKLSrhalk
ENSMUSP00000129576  SFHGSLI..FSHHHE......DMVEFMKF..........VQTVNpykypednyl....PKFWHLFFK..CSFSkfdcq
ENSMUSP00000126966  SFHGSLV..FSHHHD......EMVEFMNF..........VQTVNpykypednyl....PKFWHLFFK..CSFSefncq
ENSMUSP00000129089  SFHGSLI..FSHHHE......EMVEFVNF..........VQTVNpytypedayl....PKFWVIFFN..CSFSefdcq
ENSMUSP00000128493  SFHGSLI..FSYHHE......EMVEFMNF..........VQTVNpykypednyl....PKFWHLFFK..CSFSkfdcq
ENSMUSP00000069080  VVGGTIG..FGLKAG......QIPGFREF..........LQKVHprksvhngfa....KEFWEETFN..CHLQdgakg
ENSMUSP00000064404  -AEGAIT..IQPKRA......TVEGFDAYftsrtlennrRNVWF..............AEYWEENFN..CKLTisgsk
ENSMUSP00000129068  SFHGSLI..FSHHHE......EMVEFVNF..........VQTVNpytypeddyl....PKFWVFFFK..CSFSefdcq
ENSMUSP00000129308  SFHGSLI..FSHHHE......EMVEFVNF..........VQTVNpytypeddyl....PKFWVFFFK..CSFSefdcq
ENSMUSP00000087998  -AEGAVT..ILPKRA......SIDGFDRYfrsrtlannrRNVWF..............AEFWEENFG..CKLGshgkr
ENSMUSP00000129762  SFHGSLI..FTYHYS......ERFEFTNF..........IQTVNpykypediyl....PKLWHLFFK..CSFSdngcq
ENSMUSP00000000631  EAVGAIT..ILPKRA......SIDGFDQYfmtrslennrRNIWF..............AEFWEENFN..CKLTssggq
ENSMUSP00000129296  SFHGTLI..FSQHHP......EISAFKDF..........IQTVNpskypddifl....SHIWKMYLN..CPFSrvyck
ENSMUSP00000129895  SFHGSFI..FRHNYR......DNIEFTKF..........IQRVNpykypediyl....PKLWNFFFK..CSFSdinch
ENSMUSP00000048706  SFHGSLI..FKHNYR......ENFEFTKF..........IRTVNpkkypediyl....PKMWYLFFM..CSFSdincq
ENSMUSP00000029406  YFGGTIG..FATPRS......VIPGLKEF..........LYDVHpnkdpndvlt....IEFWQTAFN..CTWPnssvp
ENSMUSP00000126559  TFHGSLI..FKHSYR......ENFEFTKF..........IKTVNpkkypediyl....PKLWHLFFK..CSFAdincn
ENSMUSP00000127465  LFHGSLI..FKHHYR......ENFEFTKF..........IQTVNpnkypediyl....PKLWYFFFK..CSFAginch
ENSMUSP00000129347  SFHGSLI..FTHKYR......ESFDLTTF..........IQTVNpykypediyl....PKLWHLFFK..CSFSdidcl
ENSMUSP00000131426  LSHGALS..FSHHHG......EIFGFTNF..........VHEATpfkypedifl....HVLWNKYFN..CSLLqsdck
ENSMUSP00000128685  LFHGSLI..FKHHYR......ENFEFTKF..........IQTVNpnkypediyl....PKLWYFFFK..CSFAginch
ENSMUSP00000132641  SFHGSLI..FTYHYR......ESFELTKF..........IQTVNpykypediyl....PKLWHLFFK..CSFSdincq
ENSMUSP00000004076  -AYGAIT..LELASH......PVRQFDRYfqslnpynnhRNPWF..............RDFWEQKFQ..CSLQnkrnh
ENSMUSP00000124192  YFGGTIG..FAVPRS......VIPGLKEF..........LYDVHpskdpndvlt....IEFWQTAFN..CTWPnstvp
ENSMUSP00000128975  FFHGTVI..FVHHND......RIAKFRNF..........MQTINtnkypvdish....TILKWNYFN..CSISknsis
ENSMUSP00000126106  SFHGSLI..FKHHYR......ENFEFTKF..........IQRVNpnkypediyl....PKLWYLFFK..CSFSatnch
ENSMUSP00000023959  AAEGAIT..IELASY......PISDFASYfqnldpwnnsRNPWF..............REFWEERFR..CSFRqrdca
ENSMUSP00000126534  SFHGSLI..FTHHYR......KNFEFTNF..........IQTVNpykypediyl....PKLWHLFFK..CSFSdidcq
ENSMUSP00000126756  SFHGSLI..FKHNYK......ENFEFTKF..........IQTVNpnkypediyl....PKLWHLFFK..CSFAdincn
ENSMUSP00000078200  SFHGSLI..FKHHYR......ENSDFTKF..........IQTVNpknypediyl....PKLWYYFFK..CSFSdinch
ENSMUSP00000129313  SFHGSLI..FKHNYR......ENFEFTKF..........IQTVNpnkypediyl....PKLWYLFFK..CSFSdtnch
ENSMUSP00000130373  SFHGSLI..FTHNYR......KSFKISNF..........IQTVNpykypediyl....PKLWHLFFK..CSFSdvdcr
ENSMUSP00000128350  SFHGSLI..FKHNFR......ENFEFTKF..........IQTVNpskypkdiyl....PKLWYLFFK..CSFAdvnch
ENSMUSP00000094994  -KYGTFD..FQQHNS......EISGFKNF..........VQTLNsvkcpdeyl.....VELEWMHFN..CEVSaskck
ENSMUSP00000090148  -KYGTFD..FQQHNS......EISGFKNF..........VQTLNsvkypddyl.....VELEWMHFN..CEVSaskck
ENSMUSP00000131261  SFHGSLI..FKHSYR......ENFEFTKF..........IQTVNpnkypedvyl....PKLWYLFFK..CSFSdtnch
ENSMUSP00000131925  YFGGTIG..FAIPRS......VIPGLKEF..........LYDVHpskdpndvlt....IEFWQTAFN..CTWPnnsvp
ENSMUSP00000130114  LSHGALI..FSPHYE......EIAGFKKF..........MQEATpikypedifl....HILWYWYFK..CSFLhfeck
ENSMUSP00000131583  SFHGSLI..FKHNYK......ENFDFTKF..........IQTVNpnkypediyl....PKLWYLFFK..CSFAdincq
ENSMUSP00000126885  -EYGTFA..FGQHHS......EISGFKHF..........VQTLNsvkcpdeyl.....VKLEWMHFN..CEVSaskck
ENSMUSP00000127981  -LYGTFA..FGHHHG......EISGFKNF..........VQTLNllkysdeyl.....VKLEWMYFN..CEVSapkck
ENSMUSP00000132299  LSHGALI..FSPHYE......EITGFKKF..........MQEATpnkypedifl....HLLWYWHFN..CSFLhseck
ENSMUSP00000131447  -EYGTFA..FGQHHS......EISGFKHF..........VQTLNsvkcpdeyl.....VKLEWMHFN..CEVSaskck
ENSMUSP00000128106  -KYGTFA..FEQHHS......EISGFKHF..........VQTLNsvkcpdeyl.....VKLEWMHFN..CEVSaskck
ENSMUSP00000077109  YFGGTIG..FAIPRS......VIPGLKEF..........LYDVHpsknpndvlt....IEFWQTAFN..CTWPnssvp
ENSMUSP00000020547  LTHGALI..FSPHYK......EIVGFKKF..........MLEATpikypedifl....HLLWYWHFN..CSFLhseck
ENSMUSP00000131450  -FHGTVT..FAHHNG......EIVIFRNF..........LQTVNtskypldisq....TMQEWNYFN..CSISknsns
ENSMUSP00000125126  -FHGTIT..FAHRRF......EIPKFKKF..........MQTMNtakypvdish....TILEWNYFN..CSISknssk
ENSMUSP00000126386  SFHGSLI..FRHNYR......ENFEFTKF..........IQTVNpnkypediyl....PKLWNFFFK..CSFSdtnch
ENSMUSP00000127505  -EYGTFA..FGQHHS......EISGFKHF..........VQTLNsvkcpdeyl.....VKLEWMHFN..CEVSaskck
ENSMUSP00000124065  -FHGPIT..FAHHKV......EIPKLRNF..........MQTMNtakypvdish....TILEWNYFN..CSISknssk
ENSMUSP00000132478  SVHGTLI..FSHQQS......EMSGFKQF..........MQTVHpsnysndisl....AKLWWTYFK..CSLPppdck
ENSMUSP00000127838  FFHGTIT..FAHHNG......RIAKFNNF..........LQTMNtskypidvtq....TMQDWNYFN..CSIFknsvr
ENSMUSP00000127513  YFGGTIG..FAIPRS......VIPGLKEF..........LYDVHpskdpndvlt....IEFWQTAFN..CTWPnssva
ENSMUSP00000129215  LFHGTVT..FAHHKG......WIAKFKNF..........MQTMNtskypinisq....SVLRWNYFN..CSVSknsik
ENSMUSP00000126953  FFHGTVT..FEHHHS......EIAKFKNF..........MKTMNtdkypvnisq....SIVGWNYFN..CSTSmnsfs
ENSMUSP00000071670  -FHGTIT..FAHHKV......EIPKFKKF..........MQTMNtakypvdish....TILEWNYFN..CSISknssk
ENSMUSP00000131831  YFGGTIG..FAVPRS......VIPGLKEF..........LYDVHpskdpndvlt....IEFWQTAFN..CTWPnstvp
ENSMUSP00000133218  FFHGTVT..FEHHHS......EIAKFKNF..........MQTINtdkypvnise....SILGWNYFN..CSTSmnsys
ENSMUSP00000092079  LFHGTVT..FAHHKG......WIAKFKNF..........MQTMNtskypinisq....SVLRWNYFN..CSVSknsik
ENSMUSP00000126698  SLHGTLI..FSHQQS......EISGFKQF..........MQTVHpsnysndisl....AKMWWTYFK..CSLKppdck
ENSMUSP00000128015  FFHGTVT..FEYHHS......EIAKFKNF..........MKTMNtdkypvnise....SILRWNYFN..CSTSmnsys
ENSMUSP00000129540  SIHGTLI..FSHQQS......EMSGFKHF..........IQRVNpsnysndisl....AKLWWTYFK..CSLPppdck
ENSMUSP00000126596  LFHGTVT..FAHHKG......WIAKFKNF..........MQTMNtskypinisq....SILRWNYFN..CSVSknsik
ENSMUSP00000128333  FFHGTVT..FAHHVG......KIAKFRNF..........LQTMNsdkypvnisk....SILGWNYFN..CSVSkkgnk
ENSMUSP00000128792  LFHGTVT..FAHHKG......WIAKFKNF..........MQTMNtskypisise....SILRWNYLN..CSVSknsik
ENSMUSP00000129520  FFHGTVT..FEHHHS......EIAKFKNF..........MKTMNtdkypvnisq....SIGGWNYFN..CSTSmnsys
ENSMUSP00000052977  -FHGTVT..FAHHIG......ELVKFRNF..........LQTMNnekypvnise....TRLGWNSFN..CSISknsnk
ENSMUSP00000078162  FFQGTVT..FAHHVG......EIANFRNF..........LQTMNsekytvnise....SRLGWNYFN..CSISknsnk
ENSMUSP00000132467  -FYGSLT..FLPHHG......GISGFKDF..........VQTWFhlkskdlylvmpewKYFKYES--..---Saskck
ENSMUSP00000129566  VLQGTFG..LLYHSS......RAIGFPEF..........LAHLRpsqtpedmfi....KKFWEFTFD..CMWPyqnit
ENSMUSP00000036551  SFNGIFI..FSHPHS......KIPGFKKF..........IQTVHpsnyskdtsl....ARLWWLYFN..CSLPshckt
ENSMUSP00000126007  SSSGTFI..FSHQKP......ELSGFQQF..........IQTVHpsnyssefsf....AKLWWTYFR..CSLPpsnck
ENSMUSP00000083386  VLQGTFG..LLYHSS......RAIGFPEF..........LAHLRpsqtpedmfi....KKFWEFTFD..CTWPyqnst
ENSMUSP00000129960  -FYGSLT..FLPHHG......GISGFKDF..........VQTWFhlrskdlylvmpewKYFKYES--..---Saskck
ENSMUSP00000066737  AYSSLQT..VTLLRT......VKPEFEKF..........SMEVK..............SSVEKQGLN..EEDY.....
ENSMUSP00000074613  -FYGSLT..FLPHHG......GISGFKDF..........VQTWFhlrskdlylvmpewKYFKYES--..---Saskck
ENSMUSP00000129578  -IYGSLT..FLPHHG......GISGFKDF..........VQTWFhlrskdlylvmpewKYFKYES--..---Saskck
ENSMUSP00000122645  SSIGTFI..FSHQQP......EIPGFEQF..........IQTVHpsnyssehsl....AKLWWTYFR..CSLPpsnck
ENSMUSP00000104194  -FYGSLT..FLPHHG......GISGFKDF..........VQTWFhlrskdlylvmpewKYFKYES--..---Saskck
ENSMUSP00000132834  VLQGTFG..LLYHSS......RAIGFPEF..........LAHLRpsqtpedmfi....KKFWEFTFD..CTWPyqnst
ENSMUSP00000093612  FFQGTVT..FAHHVG......DIANFRNF..........LQTMNnekypinise....SILQWNSFN..CSFSknsnk
ENSMUSP00000126979  VLQGTFG..LLYHSS......RAIGFPEF..........LAHLRpsqtpedmfi....KKFWEFTFD..CTWPyqnst
ENSMUSP00000126973  SSTGSFI..FSHQQS......EISGFEKF..........IQTVHpsnyssefsl....AKLWWTYFT..CSLPpsnck
ENSMUSP00000127309  -FHGTLS..FSHHYS......EIAGFKEF..........IQTAHplnysntisl....AKLWWLNFN..CFLSssnck
ENSMUSP00000126165  YFGGTIG..FAIPRS......VIPGLKEF..........LYDVHpskdpndvlt....IEFWQTAFN..CTWPnssvp
ENSMUSP00000131128  -FYGTLT..ISQYHG......DVSTLNNF..........FQGANlskdthyfss....ERLGWMYFN..CSILksnck
ENSMUSP00000131990  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFnlsnkdlylvmp..E--------..---Wkyfky
ENSMUSP00000127337  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhfrntdlyl.....VMPEWKYFN..YEDSasnck
ENSMUSP00000030191  AFQTVLV..ITYREP......PNPEYQEF..........QNRLL..............IRAREDFGVelAPSL.....
ENSMUSP00000133007  -FYGSLT..FLPHHG......GISGFKNF..........VQTWFhlrskdlylvmpewKYFKYES--..---Saskck
ENSMUSP00000131780  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhfrntdlyl.....VMPEWKYFN..YEDSasnck
ENSMUSP00000132457  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhfrntdlyl.....VMPEWKYFN..YEDSasnck
ENSMUSP00000076687  SASGTLI..FSHQQS......ELSGFEKF..........IKTVKpsnyssefsf....AKLWWTYFR..CSSLppsnc
ENSMUSP00000128102  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFnlrnkdlylvmp..E--------..---Wkyfky
ENSMUSP00000132539  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFnlrnkdlylvmp..E--------..---Wkyfky
ENSMUSP00000129411  SSSGTFI..FSHQKP......ELSGFQQF..........IQTVHpsnyssefsf....AKLWWTYFR..CSLPpfnck
ENSMUSP00000132726  SSTGTFI..FSHQQP......EIPGFEKF..........IQTVYpsnyssefsf....AKLWWTYFR..CSLPpsnck
ENSMUSP00000132327  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFnlrnkdlylvmp..E--------..---Wkyfky
ENSMUSP00000030792  GIGTVLG..VAIQQR......QVPGLKEF..........EESYV..............QAVMGAPRT..CPEGswcgt
ENSMUSP00000133014  SSSGTFI..FSHQKP......EISGFQKF..........IKTVYpsnyssefsf....AKLWWTYFR..CSLPpsnck
ENSMUSP00000126917  ASTGTFI..FSHQKP......EISGFEQF..........IQRIHpsnyssefsl....AKQWWTYFR..CSLPpsnck
ENSMUSP00000128337  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhlrntdlyl.....LMQEWKYFN..YVSSasnck
ENSMUSP00000132332  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhlrntdlyl.....LMQEWKYFN..YVSSasnck
ENSMUSP00000133265  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhlrntdlyl.....LMQEWKYFN..YVSSasnck
ENSMUSP00000126863  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFnlrnkdlylvmp..E--------..---Wkyfky
ENSMUSP00000127146  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFnlrnkdlylvmp..E--------..---Wkyfky
ENSMUSP00000130631  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhlrntdlyl.....LMQEWKYFN..YVSSasnck
ENSMUSP00000132337  SYTGTFI..FSHQQP......EIPGFEKF..........IQTVHpsnyssefsf....AKLWWTYFR..CSLPpsnck
ENSMUSP00000072566  -FYGSLT..FLPHHG......VISGFKNF..........VQTWFhlrntdlyl.....VMQEWKYFN..YEDSastck
ENSMUSP00000129466  -FYGSLT..FLPHHG......VISGFKNF..........VQTWFhlrntdlyl.....VMQEWKYFN..YEDSastck
ENSMUSP00000075833  -FYGSLT..FLPHHG......VISGFKNF..........VQTWFhlrntdlyl.....VMQDWKYFN..YEDSastck
ENSMUSP00000087221  -FHGTVT..FAHYKG......EIPKFRNF..........MQTINtdkypvdish....TILEWNYFN..CSSSknssk
ENSMUSP00000124342  HFGGGLS..FSFHMD......EILGFKDF..........LRSVQprkyphdifi....RHVWSSLFG..CPHYyqhrl
ENSMUSP00000104190  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhlrntdlyl.....VMPEWKYIN..SEDSasnck
ENSMUSP00000083463  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhlrntdlcl.....VMPEWKYIN..SEDSasnck
ENSMUSP00000126682  YFGGGLS..FFVHMD......EILGFKDF..........LRDVQp.............RKYPHDIFI..QDVWsilfe
ENSMUSP00000079827  -FYGSLT..FLPHHG......EISGFKKF..........VQTWFhvrntdlyl.....VMPEWNYFN..YVSSasnck
ENSMUSP00000074476  -FYGSLT..FLPHHG......GISGFKNF..........VQTWFhlrskdlylvmpewKYFKYES--..---Lasnck
ENSMUSP00000069647  -FYGSLT..FLPHRG......GISGFKNF..........VQTWFhlrskdlylvmpewKYFKYES--..---Lasnck
ENSMUSP00000083477  -FYGTFT..FLPHHA......EISGYKKF..........VQTLFhlkstdlnl.....EMQEWKYFN..CEDSacnck
ENSMUSP00000073604  ISVRGLS..FSVRMD......QVPGFKDF..........LRDVQp.............RKYPHDIFI..QDVWsilfe
ENSMUSP00000072296  -FYGSLT..FLPHHG......EISGFKKF..........VQTWFhvrntdlyl.....VMPEWNYFN..YVSSasnck
ENSMUSP00000129703  SSTGTFI..FSHQKP......EISGFEQF..........IQTVHpsnyssefsf....AKLWWTYFR..CSLPpsdck
ENSMUSP00000083478  -FYGSLT..FLPHHG......GISGFKNF..........VQTWFhlrskdlylvmpewKYFKYES--..---Sasnck
ENSMUSP00000083468  -FYGSLT..FLPHHG......EISGFKKF..........VQTWFhvrntdlyl.....VMPEWNYFN..YVSSasnck
ENSMUSP00000132043  YFGGGLS..FSDRMD......QILGFKDF..........LKNIQp.............RKYPQDIFI..QDVWiilfe
ENSMUSP00000092462  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhlrntdlyl.....VMPEWKYIN..SEDSasnck
ENSMUSP00000092460  -FYGSLT..FLPHHG......EISGFKKF..........VQTWFhvrntdlyl.....VMPEWNYFN..YVSSasnck
ENSMUSP00000130160  -FYGSLT..FLPHHG......EISGFKKF..........VQTWFhvrntdlyl.....VMPEWNYFN..YVSSasnck
ENSMUSP00000098528  YFGGVLL..FSDHMD......EILGFKEF..........LRNLQprkypqnifi....QDMWSIVFE..CPHLylhkv
ENSMUSP00000030949  RVGTVLG..FLQRGA......LLPEFSHY..........VETHL..............ALAADPAFC..ASLNaeldl
ENSMUSP00000129352  -FYGTFT..FLPHHG......EISGYKNF..........LQTLFhlkstdafl.....VMPEWKYFN..CEDSacnck
ENSMUSP00000132206  -LYGTFA..FGHHHG......EISGFKNF..........VQTLNllkysdeyl.....VKLEWMYFN..CEVSapkck
ENSMUSP00000032238  HFGGGLS..FSFHMD......EILGFKDF..........LRSVQprkyphdifi....RHVWSSLFG..CPHYyqhrl
ENSMUSP00000127506  FFTGSLL..FSKKR-......NIPGFKNF..........LESLTpsyypgefyf....YKF------..---Widkfd
ENSMUSP00000074602  HFGGGLL..FSFHMD......EILGFKDF..........LRSVQp.............RKYPHDIFI..QDVWsilfe
ENSMUSP00000128981  YFGGGLS..FTDRMD......QILGFKDF..........LRNVQp.............RKYPQDIFI..QDVWmvlfe
ENSMUSP00000020062  KLGKVVG..FAFRRG......NTSSFHSF..........LQTLHmypndnn.......K-------P..L--Hefaml
ENSMUSP00000129145  YFGGGLS..FTDRMD......QILGFKDF..........LRNVQp.............RKYPQDIFI..QDVWmvlfe
ENSMUSP00000030510  HTGTFLG..VTIQRV......SIPGFSQF..........RVR-H..............DKPEYPMPN..ETSLrttcn
ENSMUSP00000128600  SSMGSFI..FSHQQP......EISDFEQF..........IKTVHpsnyssefsl....AKLWWMYFR..CSLPpsnck
ENSMUSP00000025338  AVEGHITteIVMLNPantrsiSNMTSQEF..........VEKLT..............KRLKRHP--..EETG.....
ENSMUSP00000092459  -FYGSLT..FLPHHG......EISGFKNF..........VQTWFhvrntdlyl.....LMQEWKYFN..YEDSasnck
ENSMUSP00000044521  AYDAVLT..ITVESH......EKTFYEAY..........AEA-A..............ARGEIPEKP..DSNQ.....
ENSMUSP00000127895  -FYGSLT..FLPHHG......EISGFKKF..........VQTWFhvrntdlyl.....VMPEWNYFN..YVSSasnck
ENSMUSP00000068253  VYESVFL..IAPSAYg.....GGIGDDGF..........RKQVS..............QELRRPPFQ..SSITsedq.
ENSMUSP00000103378  AMEGYIG..VDFEPL......SSKQIKTI..........SGKTP..............QQYEREYNS..KRSGvg...
ENSMUSP00000131564  SFHGSLI..FKHNYR......ENIEFTKF..........IQTVNpnkypediyl....PKLWYLFFK..CSFSdtnch
ENSMUSP00000131156  PFHGSLI..FKHNYR......ENFEFTKF..........IQTVNpnkypediyl....PKLWHLFFK..CSFSdinch
ENSMUSP00000077758  --VNMTG..FRILNT......ENTQVSSI..........IEKWSm.............ERLQAPPKP..DSGLldgf.
ENSMUSP00000095875  AYDAVLT..VSLESS......--PESHAF..........TAT-E..............MSGGATANL..EPEQ.....
ENSMUSP00000072107  --VNMTG..FRLLNI......DNPHVSSI..........IEKWSm.............ERLQAPPRP..ETGLldgv.
ENSMUSP00000030676  --VNLTG..FRILNV......DNPHVSAI..........VEKWAm.............ERLQAAPRA..ESGLldgv.
ENSMUSP00000027020  --ANVTG..FQLVDF......NTPMVTKL..........MDRWK..............KLDQREYPG..SETP.....
ENSMUSP00000032338  YMDNVLV..LTLPSE......QSTSNTSV..........AERFS..............SGR------..----.....
ENSMUSP00000109949  APDGIIG..LQLING......--------..........-----..............---------..----.....
ENSMUSP00000044494  --ANVTG..FQLVNY......TDTIPARI..........MQQWRtsdardht......RVDWKRP--..----.....
ENSMUSP00000103375  --ANVSG..FQIVDY......DDSLVSKF..........IERWS..............TLEEKEYPG..AHTAt....
ENSMUSP00000075687  --ANITG..FQIVNN......ENPMVQQF..........IQRWV..............RLDEREFPEa.KNAP.....
ENSMUSP00000021259  AHDAVLT..LTRRCP......PGGSVQDS..........LRRAQ..............EHQELPLDL..NLKQ.....
ENSMUSP00000034515  --VNILG..FSIFNQ......SHAFFQEF..........SQSLN..............QSWQENCDH..VPFTg....
ENSMUSP00000003468  --SNILG..FSMFNT......SHPFYPEF..........VRSLN..............MSWRENCEA..STYPg....
ENSMUSP00000093536  SIGRLTI..IRQTFP......---VPQNI..........SQRCF..............R--------..---Gnhris
ENSMUSP00000044009  ALGRMTV..VRQIFP......SA---KDN..........QKCMR..............NNHRISSLL..CDPQegylq
ENSMUSP00000129679  -------..------......--AKFRNF..........FANNEnqqipvnise....SILEWNYFN..CSVSknsnk
ENSMUSP00000062284  ---GLIS..VSYDEW......D-------..........-----..............---------..----.....
ENSMUSP00000002848  LPAGLFA..VRSAGW......R-------..........-----..............---------..----.....
ENSMUSP00000091381  -------..------......--------..........----I..............AH-------..GKTT.....
ENSMUSP00000032331  FPSGLIS..VSYDDW......D-------..........-----..............---------..----.....
ENSMUSP00000097013  -------..------......--------..........-----..............---WTALHK..CDMA.....
ENSMUSP00000003351  ---GLIS..VVTESW......RLSLRQK-..........-----..............---------..----.....
ENSMUSP00000105373  -------..------......--------..........-----..............---WTALHK..CDMA.....
ENSMUSP00000093345  -------..------......--------..........-----..............---WTALHK..CDMA.....


                                                                    310            320       330    
                                                                      |              |         |    
d1jdpa_               ...............................................VN....MFVEG.FHDAILLYVLALHEV....
ENSMUSP00000037255  ............................npnfkkvctgnesleenyvQD....SKMGF.VINAIYAMAHGLQNM....
ENSMUSP00000129181  ............................nskynktcnssltlrthhvQD....SKMGF.VINAIYSMAYGLHNM....
ENSMUSP00000131856  .........................llencqpnasldllprhqfepvMG....EEGYH.IYNAVYAVAYSLHEM....
ENSMUSP00000126650  .........................llencqpnaslellprylfdpvMS....EESYN.IYNAVYAVAYSLHEM....
ENSMUSP00000029540  ...............................................KN....IIPAS.FHDGLLLYVQAVTET....
ENSMUSP00000125817  .........................llencqpnasldllprhifdpaMS....EESYN.IYNAVYALAHSLHEM....
ENSMUSP00000113819  ..........................kgshikkctnrerigqdsayeQE....GKVQF.VIDAVYAMGHALHAM....
ENSMUSP00000129576  .........................llencqpnasldllprhlfdpaMS....EEGYN.IYNAVYAVAYSVHEM....
ENSMUSP00000126966  .........................llencqpnasldllprhhfdpaMN....EEGYN.IYNAVRAVAYSIHEM....
ENSMUSP00000129089  .........................llencqpnasldllprhifdptMS....EESYN.IYNAVHALAHSLHEM....
ENSMUSP00000128493  .........................llencqpnasldllprhlfdpaMS....EEGYN.IYNAVYAVAYSLHEM....
ENSMUSP00000069080  .....plpvdtfvrsheeggnrllnsstafrplctgdeninsvetpyMDyehlRISYN.VYLAVYSIAHALQDI....
ENSMUSP00000064404  ..........................kedtdrkctgqerigkdsnyeQE....GKVQF.VIDAVYAMAHALHHM....
ENSMUSP00000129068  .........................llencqpnasldlllrhifdpaMS....EESYN.LYNAVYALAHSLHEM....
ENSMUSP00000129308  .........................llencqpnasldllprhifdpaMS....EESYN.LYNAVYALAHSLHEM....
ENSMUSP00000087998  ...........................nshikkctgleriardssyeQE....GKVQF.VIDAVYSMAYALHNM....
ENSMUSP00000129762  .........................llnncqfnasldalprhifdesMS....DESTS.IYNAVYAVAHSLHEL....
ENSMUSP00000000631  ..........................sddstrkctgeerigqdstyeQE....GKVQF.VIDAVYAIAHALHSM....
ENSMUSP00000129296  .........................tlktcssngslallpwhrfdmdMS....EESYH.IYNAVYAVAHSLHEM....
ENSMUSP00000129895  .........................vldncktnasldllpsfifdvvMS....EESTN.IYNGVYALAHSLHQM....
ENSMUSP00000048706  .........................vldscqtnasldmlpsqifdvvMS....EESTS.IYNAVYAVAHSLHEM....
ENSMUSP00000029406  ......ynvdhrvnmtgkedrlydmsdqlctgeekledlkntyldtsQL....RITNN.VKQAVYAIAHGLDHL....
ENSMUSP00000126559  .........................vldncqtnasldvfprhifdvaMN....EESSS.IYNGVYAVAHSLHEM....
ENSMUSP00000127465  .........................vlancqtnasldilpshifdvaMN....DESRN.IYNGVYAVAHSLHEM....
ENSMUSP00000129347  .........................llancqsnasldvlpshildmtIS....EESNN.IYNAVYAVAHSLHQM....
ENSMUSP00000131426  .........................iiekclpnsslellpgnifemiMT....EESYN.VYNAVYAVAHSLHEM....
ENSMUSP00000128685  .........................vlancqtnasldilpshifdvaMN....DESRN.IYNGVYAVAHSLHEM....
ENSMUSP00000132641  .........................lladchsnasldmlpshildmtIS....EESNN.IYNAVYAVAHSLHQI....
ENSMUSP00000004076  ...............................rqicdkhlaidssnyeQE....SKIMF.VVNAVYAMAHALHKM....
ENSMUSP00000124192  ......ynvdhrvnmtgkedrlydmsdqlctgeekledlkstyldtsQL....RITNN.VRQAVYLLAHAIDLF....
ENSMUSP00000128975  .........................kmdhftfnntlewlakhkfdmvLS....EEGYN.LYNAVYAVAHTYHEL....
ENSMUSP00000126106  .........................vlencqtnasldvfprhifdvaMN....AESTS.IYNGVYAVAHSLHEM....
ENSMUSP00000023959  .....................................ahslravpfeQE....SKIMF.VVNAVYAMAHALHNM....
ENSMUSP00000126534  .........................llancqanasldvlpchifdiaIS....EESKT.IYNAVYALAHSLHVM....
ENSMUSP00000126756  .........................vlencqtnasldvfprhifdlsMN....AESTS.IYNGVYAVAHSLHEI....
ENSMUSP00000078200  .........................vldncqtnasldvlpshifdvaMT....EESTS.IYNGVYALAHSLHEM....
ENSMUSP00000129313  .........................vlencqtnasldvfprhifdvaMN....AESTI.IYNGVYAVAHSLHEM....
ENSMUSP00000130373  .........................llancqpnasldvlpshildmvIS....EESNN.IYNAVYAVAHSLHQM....
ENSMUSP00000128350  .........................vldncqsnasldilpshifdvaMS....EESTS.IYNGVYAVAHSLHEM....
ENSMUSP00000094994  .........................plkncsssysfdwlmehtfdmaFI....EKSYY.IYNAVYAFAHALHQF....
ENSMUSP00000090148  .........................tlkncssnhslewlmvhtfdmaFI....EKSYY.IYNAVYAFAHALHQF....
ENSMUSP00000131261  .........................vlgncqtnaslevfpshifdvaMN....AESTS.IYNGVYAVAHSLHEM....
ENSMUSP00000131925  ......ynvdhrvnmtgkedrlydmsdqlctgeekledlkntyldtsQL....RITNN.VRQAVYLMAHALDHL....
ENSMUSP00000130114  .........................ifknclqnaslellpgniftmtMT....EESYY.VYNAVYAVAHSLHEE....
ENSMUSP00000131583  .........................vlnncqtnasfdilprhifdvvMN....AESTS.IYNGVYAVAHSLHEM....
ENSMUSP00000126885  .........................tlkncssnhslewlmvhtfdmaFI....EGSYD.IYNAVYAFAHALHQI....
ENSMUSP00000127981  .........................tlkncssnhplewlmvrtfdmaFT....EGSYA.IYNAVYAVAHALHEL....
ENSMUSP00000132299  .........................ifenclqnaslellpgniftmtMT....EESYN.VYNAVLAVAYSLHEK....
ENSMUSP00000131447  .........................tlkncssnhslewlmvhtfdmaFI....EGSYD.IYNAVYAFAHALHQI....
ENSMUSP00000128106  .........................tlkncssnhslkwlmvhtfdmaFI....EESYY.IYNAVYAFAHVLHQF....
ENSMUSP00000077109  ......ynvdhrvnmtgkedrlydmsdqlctgeekledlkntyldtsQL....RITNN.VKQAVYLMAYALDRL....
ENSMUSP00000020547  .........................ifenclqnaslellpgniftmtMT....EESYN.VYNAVYAVAHSLHEE....
ENSMUSP00000131450  .........................kmdhftfnntlewtalqklnmvLS....EEGYN.LYNAVYAVAHTYHEL....
ENSMUSP00000125126  ..........................mdhitfnntlewtalhnydmvMS....DEGYN.LYNAVYAVAHTYHEH....
ENSMUSP00000126386  .........................vldkcqtnasldllprhifdvvMS....EESTN.IYNGVYALAHSLHQM....
ENSMUSP00000127505  .........................tlkncssnhslewlmvhtfdmaFI....EGSYD.IYNAVYAFAHALHQI....
ENSMUSP00000124065  ..........................mdlftsnntlewtalhnydmaMS....DEGYN.LYNAVYVAAHTYHEH....
ENSMUSP00000132478  .........................tlkncptktllkrffvpplgmsMS....ETCYN.LYNSVYAVAHSLHEM....
ENSMUSP00000127838  .........................ktgqfifnntlewttqhkidmvLS....EEGHN.LYNAVYAVAHTYHEL....
ENSMUSP00000127513  ......ynvdhrvnmtgkedrlydmsdqlctgeekledlkntyldtsQL....RITNN.VRQAVYLFAHAMDIL....
ENSMUSP00000129215  ..........................mdhftcknplewtalhnydmaLS....DEGYN.LYNAVYAVAHAYHEH....
ENSMUSP00000126953  .........................kmdhltfnntlewtalhnfdmvLS....EEGYN.LYNAVYAVAHTYHEL....
ENSMUSP00000071670  ..........................mdhmtfnntlewtalhnydmaMS....DEGYN.LYNAVYAAAHTYHEH....
ENSMUSP00000131831  ......ynvdhrvnmtgkedrlydmsdqlctgeeklqdlkstyldtsQL....RITNN.VRQAVYLLAHAIDRF....
ENSMUSP00000133218  .........................kmdhltfnntsewtalhkydmaLS....EEGYN.LYNAVYAVAHTYHEL....
ENSMUSP00000092079  ..........................mdhftcenpleltalhnydmaLS....DEGYN.LYNAVYAVAHTYHEH....
ENSMUSP00000126698  .........................tlkncptktlfkwffvpplgmsMS....ETCYN.LYNSVYAVAHSLHEM....
ENSMUSP00000128015  .........................kmghftfnntlewtalhnfdmaLS....EEGYN.LYNAVYAVAHTYHEL....
ENSMUSP00000129540  .........................tlkncptktlfqwffepplgmsMS....ETCYN.LYNSVYAAAHSIHEM....
ENSMUSP00000126596  ..........................mdhftcknpleltalhnydmaLS....DEGYN.LYNAVYAVAHTYHEH....
ENSMUSP00000128333  ..........................kdhftfnntlewtalhnfdivLS....EEGYN.LYNAVYAVAHTYHEL....
ENSMUSP00000128792  ..........................mdhftcknpleltalhnydmaLS....DEGYN.LYNAVYAVAHTYHEH....
ENSMUSP00000129520  .........................kmdhltfnntsewtalhnfdivLS....EEGYN.LYNAVYAVAHTYHEL....
ENSMUSP00000052977  ..........................kdhftfnntlewtarnnfdmvLS....EEGYN.LYNAVYAVAHTYHEL....
ENSMUSP00000078162  ..........................kdhftfnntlewttlhkydmvLS....EEGYN.LYNAVYAVAHTYHEL....
ENSMUSP00000132467  .........................ilknnssdasfdwlmeqkfdmaFS....ESSHN.IYNAVHAIAHALHEM....
ENSMUSP00000129566  .........................vtegvqfctgneslknkphpfpEV....SKIDA.AYTAVYSIAHALHDM....
ENSMUSP00000036551  ..........................lkncstkillewlsrhqfevsMS....EPSYN.LYNAVYAVAYALHEM....
ENSMUSP00000126007  .........................klkncptkivfkwlfmtplgmaMS....DTCYN.LYNAIYAVAHSLHEM....
ENSMUSP00000083386  .........................vtegvqfctgneslknkphpfpEV....SKIDA.AYTAVYSIAHALHNM....
ENSMUSP00000129960  .........................ilknnssdasfdwlmeqkfdmaFS....ESSHN.IYNAVHAIAHALHEM....
ENSMUSP00000066737  ...............................................VN....MFVEG.FHDAILLYVLALHEV....
ENSMUSP00000074613  .........................ilknnssdasfdwlmeqkfdmaFS....ESSHN.IYNAVHAIAHALHEV....
ENSMUSP00000129578  .........................ilknnssdasfdwlmeqkfdmaFS....ESSHN.IYNAVHAIAHALHEM....
ENSMUSP00000122645  .........................klkncptttvfkwlfmtplgmaMS....NTCYN.LYNGVYAVALSLHEM....
ENSMUSP00000104194  .........................ilknnssdasfdwlmeqkfdmaFS....ESSHN.IYNAVHAIAHALHEM....
ENSMUSP00000132834  .........................vtegvqfctgneslknkphpfpEV....SKIDA.AYTAVYSIAHALHNM....
ENSMUSP00000093612  ..........................kdhftfnntlewtalhiynmvLS....EEGYN.LYNAVYAVAHTYHEL....
ENSMUSP00000126979  ........................vtegvqfctgneslknkphpfpeV-....SRIDA.AYTAVYSIAHALHNM....
ENSMUSP00000126973  .........................klkncpiktvfkwlfmtpigmsMS....DISYN.LYNAMYAVAHSVHEM....
ENSMUSP00000127309  .........................slktcsrkmllkwlsrnhfemsMS....DTSYN.LYNAVYAVAHSLNEL....
ENSMUSP00000126165  ......ynvdhrvnmtgkedrlydmsdhlctgkeklkdlkntyldtsQL....RITNN.VRQAVYLMAYGLDRL....
ENSMUSP00000131128  .........................tpnqctssnllewlprhsfdmaMN....DESYN.IYNAIYAVAHALHEM....
ENSMUSP00000131990  .................egsasnckilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000127337  .........................ilknnssdasfdwlmeqkfdmtFS....ESSHN.IYNAVHAIAHALHEM....
ENSMUSP00000030191  ...............................................MN....LIAGC.FYDGILLYAQVLNET....
ENSMUSP00000133007  .........................ilkskssnasfdwlmeqkfdmaFS....ESSHN.IYNAVYAVAHALHEM....
ENSMUSP00000131780  .........................ilknnssdasfdwlmeqkfdmtFS....ESSHN.IYNAVHAIAHALHEM....
ENSMUSP00000132457  .........................ilknnssdasfdwlmeqkfdmtFS....ESSHN.IYNAVHAIAHALHEM....
ENSMUSP00000076687  ........................kklkncptktvfrwlfmtplgmaMS....DTCYN.LYNAIYAVAHSLHEM....
ENSMUSP00000128102  .................egsasnckilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000132539  .................egsasnckilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000129411  .........................klkncptkivfkwlfmtplgmaMS....DTCYN.LYNAIHAVAHSLHEM....
ENSMUSP00000132726  .........................klkncptktiftwlfrtpfgmaMS....DTCYN.SYNAIYAVAHSLHEM....
ENSMUSP00000132327  .................egsasnckilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000030792  ...........................nqlcrechafttwnmpelgaFS....MSAAYnVYEAVYAVAHGLHQL....
ENSMUSP00000133014  .........................tlkncptktvfkwlfrtplgmaMS....DTCYN.SYNAIHAVAHSLHEM....
ENSMUSP00000126917  .........................klkncstktvfkwlfmtplglaMS....DTCYN.IYNAMYAVAHSLHGM....
ENSMUSP00000128337  .........................ilknnssdasfnwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000132332  .........................ilknnssdasfnwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000133265  .........................ilknnssdasfnwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000126863  .................egsasnckilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000127146  .................egsasnckilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000130631  .........................ilknnssdasfnwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000132337  .........................klkncptksvfawlfrtplgmaMS....DTCYN.SYNAIYAVAHSLHEM....
ENSMUSP00000072566  .........................ilknnssnasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000129466  .........................ikknnssnasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000075833  .........................ilknnssnasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000087221  ..........................mdhftfnntlewtalhkydmaLS....EEGYN.LYNAVYAAAHTYHEH....
ENSMUSP00000124342  ........................wdlsqcepngslstrplhawdmnTS....PMSYK.VHAAVYAIAQALHEE....
ENSMUSP00000104190  .........................ilknsssdasfdwlmeekldmaFS....DNSHN.IYNAVHAIAHALHEM....
ENSMUSP00000083463  .........................ilknsssdasfdwlmeekldmaFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000126682  ...............cpyfeqhgirelsqceqngslstrplhvwdmnTS....PMSYK.VHAAVYAIAQALHEE....
ENSMUSP00000079827  .........................ilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000074476  .........................mlksnssnasfdwlmeqkfdmaFS....ESSHN.IYNAVYAIAHALHEM....
ENSMUSP00000069647  .........................mlksnssnasfdwlmeqkfdmaFS....ESSHN.IYNAVYVVAHALHEM....
ENSMUSP00000083477  .........................ilmnfssnasldwlieqkfditFS....DGSQN.IYNAVHAMAHALHET....
ENSMUSP00000073604  ...............cpylywqkvrepskcepngslstrplhvwdmnTS....PYSSK.VHAAVYAIAQALHEE....
ENSMUSP00000072296  .........................ilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000129703  .........................klkncptktvfkwlfmtplgmaMS....DTCYN.LYNAVYGVAHSLHEM....
ENSMUSP00000083478  .........................mlksnssnasfdwlmeqkfdmaFS....ESSHN.IYNAVYAVAHALHEM....
ENSMUSP00000083468  .........................ilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000132043  ...............cpylidhearqlsqcepngslstrplhvwdmnTS....PYSSK.VHAAVYAIAQALHEE....
ENSMUSP00000092462  .........................ilknsssdasfdwlmeqkldmaFS....DNSHN.IYNVVHAIAHALHEM....
ENSMUSP00000092460  .........................ilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000130160  .........................ilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000098528  ........................relsqcepngslstrplhvwdmnTS....PMSYK.VHAAVYAIAQALHVE....
ENSMUSP00000030949  ...............eehvmgqrcprcddimlqnlssgllqnlsagqLH....HQIFA.TYAAVYSVAQALHNT....
ENSMUSP00000129352  .........................ilmnysanssldwlmgqkfeitFS....DDSQN.IYNAVYAMAHALHET....
ENSMUSP00000132206  .........................tlkncssnhplewlmvrtfdmaFT....EGSYA.IYNAVYAVAHALHEL....
ENSMUSP00000032238  ........................wdlsqcepngslstrplhawdmnTS....PYSYK.VYAAVYAIAQALHEE....
ENSMUSP00000127506  ................cappallcgrnkpcplnitlknkegendimiPS....EASYS.IWNTVYAVAHAIHNM....
ENSMUSP00000074602  ...............cpyfdkdgvrelsqcepngslstrplhawdmnTS....PSSYK.VHAAVYAIAQALHEE....
ENSMUSP00000128981  ...............cpylidhearqlsqcepngslstrplhvwdmnTS....PCSSK.VHAAVYAIAQALHEE....
ENSMUSP00000020062  vsackyikdgdlsqcisnysqatltydttktienhlfkrndflwhytEP....GLIYS.IQLAVFALGHAIRDL....
ENSMUSP00000129145  ...............cpylidhearqlsqcepngslstrplhvwdmnTS....PCSSK.VHAAVYAIAQALHEE....
ENSMUSP00000030510  ...........................qdcdacmnitesfnnvlmlsGE....RVVYS.VYSAVYAVAHTLHRL....
ENSMUSP00000128600  .........................klkncpiitvfkwlfmtpfgmaMS....DTCYN.LYNAMYAVAHSLHEM....
ENSMUSP00000025338  ...............................................GF....QEAPL.AYDAIWALALALNKT....
ENSMUSP00000092459  .........................ilknnssdasfdwlmeqkfdmtFS....ESSHN.IYNAVHAIAHALHEM....
ENSMUSP00000044521  ...............................................VS....PLFGT.IYNSIYFIAQAMNNA....
ENSMUSP00000127895  .........................ilknnssdasfdwlmeqkfdmtFS....ENSHN.IYNAVHAIAHALHEM....
ENSMUSP00000068253  ...............................................VS....PYSAY.LHDALLLYAQTVEEM....
ENSMUSP00000103378  ...............................................PS....KFHGY.AYDGIWVIAKTLQRA....
ENSMUSP00000131564  .........................vlencqtnatldifprhifdmvMN....AESTI.IYNGVYAVAYSLHEM....
ENSMUSP00000131156  .........................vlencqtnasldvfprhifdgsMS....DESRS.IYNGVYTVAHSLHEM....
ENSMUSP00000077758  ...............................................MT....TDAAL.MYDAVHVVSVAVQQFpqmt
ENSMUSP00000095875  ...............................................VS....PLFGT.IYDAVILLAHALNRS....
ENSMUSP00000072107  ...............................................MT....TEAAL.MYDAVYMVAIASHRAsqlt
ENSMUSP00000030676  ...............................................MM....TDAAL.LYDAVHIVSVCYQRApqmt
ENSMUSP00000027020  ...............................................PK....YTSAL.TYDGVLVMAETFRSL....
ENSMUSP00000032338  ...............................................-S....DFSLA.YLEGTLLFGHMLQTF....
ENSMUSP00000109949  ...............................................-K....NESAH.ISDAVGVVAQAVHEL....
ENSMUSP00000044494  ...............................................-K....YTSAL.TYDGVKVMAEAFQSL....
ENSMUSP00000103375  ...............................................IK....YTSAL.TYDAVQVMTEAFRNL....
ENSMUSP00000075687  ...............................................LK....YTSAL.THDAILVIAEAFRYL....
ENSMUSP00000021259  ...............................................VS....PLFGT.IYDAVFLLAGGVKRA....
ENSMUSP00000034515  ...............................................PA....LSSAL.LFDAVYAVVTAVQEL....
ENSMUSP00000003468  ...............................................PA....LSAAL.MFDAVHVVVSAVREL....
ENSMUSP00000093536  ..................................sslcdpkdpfaqnME....ISNLY.IYDTVLLLANAFHKK....
ENSMUSP00000044009  ..............................................mLQ....ISNLY.LYDSVLMLANAFHRK....
ENSMUSP00000129679  ..........................mdhftfnstsewtalhkcdmaLS....EEGYS.LYKAVYVVVHTYHEL....
ENSMUSP00000062284  ...............................................-Y....GLPAR.VRDGIAIITTAASDM....
ENSMUSP00000002848  ...............................................-D....DLARR.VAAGVAVVARGAQAL....
ENSMUSP00000091381  ...............................................QS....VFEYY.VQDAMELVARAVATA....
ENSMUSP00000032331  ...............................................-Y....SLEAR.VRDGLGILTTAASSM....
ENSMUSP00000097013  ...............................................LS....EDCYS.LYKAVYVVVHTYHEL....
ENSMUSP00000003351  ...............................................--....-----.VRDGVAILALGAHSY....
ENSMUSP00000105373  ...............................................LS....EEGYS.LYKAVYVVVHTYHEL....
ENSMUSP00000093345  ...............................................LS....EEGYS.LYKAVYVVVHTYHEL....


                                                     340          350                   360         
                                                       |            |                     |         
d1jdpa_               ...LRA....GYS.................KKDGGKI.IQQTW..NR..TF.EG.I.......AG.QVSIDA.NGDR.
ENSMUSP00000037255  ...HHAl...CPGyvglcdamk........PIDGRKL.LDFLI..KS..SF.VG.V.......SGeEVWFDE.KGDA.
ENSMUSP00000129181  ...QMSl...CPGyaglcdamk........PIDGRKL.LDSLM..KT..NF.TG.V.......SGdMILFDE.NGDS.
ENSMUSP00000131856  ...NLQ....QIQtqpypngeek.......ELSPWQL.HPFLQ..NT..IM.RS.H.......ARrQIAMHG.GGNL.
ENSMUSP00000126650  ...NLQ....QIQiqryangekm.......VAFPWEV.LPFLK..NT..LLkHR.M.......RG.HTDLDG.KRKL.
ENSMUSP00000029540  ...LAQ....GGT.................VTDGENI.TQRMW..NR..SF.QG.V.......TG.YLKIDR.NGDR.
ENSMUSP00000125817  ...TVQ....QIQtqpyangegm.......AFSPWQI.LPFLK..IT..LLkNH.P.......SG.QTVIDE.RKNL.
ENSMUSP00000113819  ...HRDl...CPGrvglcprmd........PVDGTQL.LKYIR..NV..NF.SG.I.......AGnPVTFNE.NGDA.
ENSMUSP00000129576  ...NLQ....QIQtqpyangeem.......VFSPWQL.HPFLK..NT..IM.KShV.......RG.QTLIHG.GRNL.
ENSMUSP00000126966  ...NLQ....KIQtqpyakgeem.......VFFQWQL.HPFLK..NT..IM.RS.H.......IGrHTATHG.GGNL.
ENSMUSP00000129089  ...TVQ....QIQtqpyangdgm.......AFLPWQI.LPFLK..IT..LL.EN.H.......LSsRSVIDE.RKNL.
ENSMUSP00000128493  ...NLQ....QIQtqpyangeem.......AFSPWQL.HPFLK..NT..IM.KShV.......RG.DTVTHG.GRNL.
ENSMUSP00000069080  ...YTC....LPGrglftngscadik....KVEAWQV.LKHLR..HL..NF.TN.N.......MGeQVTFDE.CGDL.
ENSMUSP00000064404  ...NKD....LCAdyrgvcpeme.......QAGGKKL.LKYIR..NV..NF.NG.S.......AGtPVMFNK.NGDA.
ENSMUSP00000129068  ...TVQ....QIQtqpyangdgm.......AFLPWQI.LPFLK..IT..LLkNH.P.......SG.QTVIDE.RKNL.
ENSMUSP00000129308  ...TVQ....QIQtqpyangdgm.......AFLPWQI.LPFLK..IT..LLkNH.P.......SG.QTVIDE.RKNL.
ENSMUSP00000087998  ...HKEl...CPGyiglcprmv........TIDGKEL.LGYIR..AV..NF.NG.S.......AGtPVTFNE.NGDA.
ENSMUSP00000129762  ...TLQ....QVQmepyengeet.......LFFPWQL.NSFLK..DI..E-.--.V.......GG.QMRLDW.RQEV.
ENSMUSP00000000631  ...HQAl...CPGhtglcpame........PTDGRTL.LHYIR..AV..RF.NG.S.......AGtPVMFNE.NGDA.
ENSMUSP00000129296  ...LQE....HADvqpvksrkrl.......VFSPCRL.HPFLK..NI..QF.NN.P.......SGdKVDLSH.TGKL.
ENSMUSP00000129895  ...RLQ....LLQmqafengeem.......VFFPWQL.NTFLK..DI..EV.K-.-.......-D.KRNLDW.KQTI.
ENSMUSP00000048706  ...RLQ....QLQtqpceneegm.......EFFPWQL.NTFLK..DI..EV.R-.-.......--.VNSLDW.RQRI.
ENSMUSP00000029406  ...SRC....QEGqgpfgsnqqcayip...TFDFWQL.MYYMK..EI..KF.KS.H.......EDkWVILDD.NGDLk
ENSMUSP00000126559  ...RLQ....ELQmqpyengkgi.......VFFPWQL.NRFLK..DT..EV.K-.-.......-D.KRCLDW.KQTI.
ENSMUSP00000127465  ...TLQ....QIQmqqfkngegm.......VSFPWQL.NTFLK..DI..EV.R-.-.......-D.KKSLGW.RQTI.
ENSMUSP00000129347  ...SLQ....QVQkqphengeam.......AFFPWQL.NIFLK..DI..NE.R-.-.......-G.NISLDW.RHKL.
ENSMUSP00000131426  ...TLS....QMQvqpqaykdrt.......MLFPWQL.HPFLR..NI..EV.KN.S.......VGdHVVLDW.KRKT.
ENSMUSP00000128685  ...TLQ....QIQmqrckngegm.......VSFPWQL.NTFLK..DI..EV.R-.-.......-D.KKSLGW.RQTI.
ENSMUSP00000132641  ...TLQ....QEQiqahendkmm.......AFFPWQL.NIFLK..DI..D-.--.-.......-E.RNNMNS.GGRQk
ENSMUSP00000004076  ...QRTl...CPNttklcdamk........ILDGKKLyKDYLL..KI..NF.TA.PfnpnkgaDS.IVKFDT.YGDG.
ENSMUSP00000124192  ...SQA....DIReeyrenavlenkp....NFESVKL.WLYLT..KI..KF.IT.H.......DGrKIELGR.NGDVl
ENSMUSP00000128975  ...ILQ....HVEspemaeprgl.......FFDCQKV.ASLLK..TM..VF.TN.P.......LGeLVNMKH.RENQ.
ENSMUSP00000126106  ...RLQ....QLQmqpyengkgm.......VFFPWQL.NTFLK..HI..EV.R-.-.......-D.KKSLDW.RQKI.
ENSMUSP00000023959  ...HRAl...CPNttrlcdamr........PVNGRRLyKDFVL..NV..KF.DA.Pfrpad..TDdEVRFDR.FGDG.
ENSMUSP00000126534  ...SIQ....QIQiqphengdvl.......VFSPWQV.ITILN..TFl.KE.ID.E.......RD.NMSLDW.RQKL.
ENSMUSP00000126756  ...RLQ....QLQmqpyengegm.......VFFPWQL.NRFLK..DT..EV.K-.-.......-D.KRCLDW.RQTI.
ENSMUSP00000078200  ...RLQ....QLQvqpfengegm.......VFFPWQL.NTFLK..DI..EM.R-.-.......-K.NRSLYW.RQTI.
ENSMUSP00000129313  ...RLQ....QLQmqtyenhhgi.......VLFPWQV.ITFLL..YF..IV.ST.L.......VKdKRSLDW.RQIR.
ENSMUSP00000130373  ...HLQ....EVQikphengeai.......AFFPWQL.NIFLK..DI..NE.R-.-.......-D.NMSFGG.RQKL.
ENSMUSP00000128350  ...RLQ....QLQrqpfengegm.......EFIPWQL.NTFLK..NI..EV.R-.-.......-E.NRSIDW.KLAI.
ENSMUSP00000094994  ...TFQ....KFDnlpkdngkkh.......NYSCKKV.DSSLR..KT..QF.TN.P.......VGdIVNMNQ.KGEL.
ENSMUSP00000090148  ...TFQ....KFDnlpkdngkeh.......NYSCKKV.DPSLR..KM..QF.TN.P.......VGdIVNMNQ.RDKL.
ENSMUSP00000131261  ...RLQ....QLQmqpyenphgm.......VFFPWQL.NSFLK..DI..EV.K-.-.......-D.KRSLDW.RQTI.
ENSMUSP00000131925  ...SNC....DLLeeqrnntacship....DFEPKEL.LPYFK..KL..KI.TT.H.......DGaEIELNG.NGDVd
ENSMUSP00000130114  ...TLS....QIQyqpqsnidrt.......LLFPWQL.HPFLK..KI..QV.KN.S.......VGdDVVLDW.KRKA.
ENSMUSP00000131583  ...TRQ....QLQrqpyengegm.......LFFPWEL.NTFLK..DI..EL.K-.-.......-D.KWSLDW.RQTI.
ENSMUSP00000126885  ...AFQ....KLDnlpkdngkeh.......NYSCKKL.YSFLR..KT..QF.TN.P.......VGdRVNMNR.RNKL.
ENSMUSP00000127981  ...TFQ....KFDnlptdnvkeq.......NYACNKL.GSFLR..KI..HF.TN.P.......VEdRVNMNQ.RNKL.
ENSMUSP00000132299  ...TLS....QIQfqpqanidrt.......LLFPWQL.HPFLK..KI..QV.KN.S.......VGdHVVLDW.KRKA.
ENSMUSP00000131447  ...TFQ....KFDnlpkdngkeh.......NYSCKKL.YSFLR..KT..QF.IN.P.......VGdRVNMNQ.RDKL.
ENSMUSP00000128106  ...TFQ....KFDnlpkdngkeh.......NYSCKKL.YSYLR..KN..HF.IN.P.......VGdRVSMNQ.RDKL.
ENSMUSP00000077109  ...STC....DLLeeqrndtacship....DFEPKEL.MTYFK..KL..KI.IT.H.......DGaEIELDL.NGDVg
ENSMUSP00000020547  ...TLS....QIQfqpqanidrt.......LLFPWQL.HPFLK..KI..QV.KN.S.......VGdHVVLDW.KRKA.
ENSMUSP00000131450  ...ILQ....QVEfqkmaepkgi.......FTDCQQV.ASLLK..TR..VF.TN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000125126  ...IFQ....QVEsqkkakpkrf.......FTVCQQV.SSLMK..TR..VF.TN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000126386  ...RLQ....LLQmqpfengegm.......VFFPWQL.NAFLK..DI..EM.R-.-.......-D.KRSLEW.RQTK.
ENSMUSP00000127505  ...AFQ....KFDlpkdngkeh........NYSCKKL.YSFLR..KT..QF.TN.P.......VGdRVNMNQ.RDKL.
ENSMUSP00000124065  ...ILQ....QVEsqkkvehnry.......FTVCQQV.SSLMK..TR..VF.TN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000132478  ...LLQ....QVDtcsendgkvl.......EFNSWKM.FSFLK..TI..QF.VN.P.......VGdLINMNQ.NRER.
ENSMUSP00000127838  ...ILQ....QVEsqkmpklkgv.......FSDCHQV.ASLLK..TR..VF.TN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000127513  ...RQD....DIReeyreksvlesks....ILDYIKV.WPYMK..EI..KF.VT.H.......DGrKIELGS.NGDVl
ENSMUSP00000129215  ...ILH....QVEsqkmaedkgk.......YTECQQL.APLLK..TR..VF.TN.P.......VGeLVNMNQ.REYQ.
ENSMUSP00000126953  ...ILL....QVEsqqtevpkgi.......FTDCQQV.ASMLK..SR..IF.TN.P.......IGeLVNMKH.RENQ.
ENSMUSP00000071670  ...ILQ....QVEsqkkakpkry.......FTACQQV.SSLMK..TR..VF.SN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000131831  ...SQA....DIReeyresavlenkp....DFESGKL.WLYLT..KI..KF.IT.H.......DGkKIELGS.NGDVl
ENSMUSP00000133218  ...ILL....QVEsqqmavpkgt.......FTDCQQV.SSMLK..SR..IF.TN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000092079  ...ILQ....QVEsqkmaedkge.......YTECQQL.APLLK..TR..VF.TN.P.......VGeMVNMNH.REYQ.
ENSMUSP00000126698  ...LLQ....QVDtcsendgtvm.......EFNSWKM.FYFLK..TI..QF.VN.P.......AGdLINMNQ.NRER.
ENSMUSP00000128015  ...ILL....QVEsqqteepkgt.......FTDCQQV.SSTLK..SR..IF.TN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000129540  ...LLQ....HVDtssendenvl.......EFNSWKM.FSFVK..NI..QF.VN.P.......AGdLVNMNQ.NRKL.
ENSMUSP00000126596  ...ILH....QVEsqkmvedkgk.......YTECQQL.ALLLK..TR..VF.TN.P.......VGeMVNMNH.REYQ.
ENSMUSP00000128333  ...ILQ....QVEsqqtavpkgi.......FTDCQQV.SSMLK..SR..IF.TN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000128792  ...ILQ....QVEsqkmvedkgk.......YTECQQL.APLLK..TR..VF.TN.P.......VGeLVDMNH.REYQ.
ENSMUSP00000129520  ...ILL....QVEsqqtevrkgi.......FNDCQQV.SSMLK..SR..IF.TN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000052977  ...ILQ....QVEsqqmavpkgi.......FTDCQQV.ASLLK..TR..VF.TN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000078162  ...VLQ....QVEsqqmtvpkgt.......FTDCQQV.SSMLK..SR..IF.TN.P.......VGeLVNMKH.RENQ.
ENSMUSP00000132467  ...NLQ....QVDnqaidngkga.......SSHCLKV.NSFLR..KI..HF.TN.P.......LGdKVIMKQ.RVIM.
ENSMUSP00000129566  ...ISY....EHQdgkgtnsq.........DFQPWQL.LHVLR..KV..HF.KT.P.......DGsEIMFDA.NGDL.
ENSMUSP00000036551  ...LIQ....HTEhwqkdigkel.......EFYSWKV.APFLE..NN..KF.II.P.......SEyQY---R.RGKL.
ENSMUSP00000126007  ...LLQ....QIDtwsnnagkel.......EFDTWKM.FSILK..TL..QF.VN.P.......AGdLVNMNQ.NLKQ.
ENSMUSP00000083386  ...LAC....EHQerkgtnsh.........NFHSWQL.LHALK..KV..HF.KT.L.......DGiKIMFDA.NGDL.
ENSMUSP00000129960  ...NLQ....QVDnqaidngkga.......SSHCLKV.NSFLR..KI..HF.TN.P.......LGnKVIMKQ.RVIM.
ENSMUSP00000066737  ...LRA....GYS.................KKDGGKI.IQQTW..NR..TF.EG.I.......AG.QVSIDA.NGDR.
ENSMUSP00000074613  ...NLQ....QVDnqaidngkga.......SSHCLKV.NSFLR..KI..HF.TN.P.......LGdKVIMKQ.RVIM.
ENSMUSP00000129578  ...NLQ....QVDnqaidngkga.......SSHCLKV.NSFLR..KI..HF.TN.P.......LGdKVIMKQ.RVIM.
ENSMUSP00000122645  ...ILQ....QVDtwsmnagkel.......EFDSWKL.FYFLK..TL..QF.VN.P.......AGeLVIMNQ.NLKQ.
ENSMUSP00000104194  ...NLQ....QVDnqaidngkga.......SSHCLKV.NSFLR..KI..HF.TN.P.......LGnKVIMKQ.RVIM.
ENSMUSP00000132834  ...LAC....EHQerkgtnsh.........NFHSWQL.LHALK..KV..HF.KT.L.......DGiKIMFDA.NGDL.
ENSMUSP00000093612  ...ILQ....QVEsqqtevpkgt.......FTDCQQV.SSMLK..SR..IF.TN.P.......FGeLVNMKH.QESQ.
ENSMUSP00000126979  ...LAC....EHQerkgtnsh.........NFHSWQL.LHNLR..NV..YF.KT.S.......DGnKIMFDA.NGDL.
ENSMUSP00000126973  ...LLQ....QVDiwstnagtel.......EFDSWKM.FSILK..TL..KF.VN.P.......AGdLVNMNQ.NLKQ.
ENSMUSP00000127309  ...LLQ....QANtlsnnvgkgl.......EFDSLQV.LSSLK..NI..HF.VN.P.......AGdLVNLNQ.KENM.
ENSMUSP00000126165  ...IRV....LIKeyreyllhpkil.....AFMSYKL.FEYIR..KV..KF.TT.H.......DGrKIELNV.HGDIe
ENSMUSP00000131128  ...VLQ....KIDfqqlenvtql.......MQECVQI.HAFLE..NM..QF.LN.P.......IGdVVIINQ.QAKT.
ENSMUSP00000131990  ...NLQ....QVDnqaidngkga.......SSHCLKV.HSFLR..KT..HF.TN.P.......LGdKVIMKQ.RVIT.
ENSMUSP00000127337  ...NLQ....KADnqaidngkra.......SSHCLKV.NSFLR..RA..YF.TN.P.......LGdKVFMNQ.RVIM.
ENSMUSP00000030191  ...IQE....GGT.................REDGLRI.VEKMQ..GR..RY.HG.V.......TG.LVVMDK.NNDR.
ENSMUSP00000133007  ...NLQ....QVDnqaidngkga.......SSHCLKV.NSFLR..KI..HF.TN.P.......LGdKVIMKQ.RVIM.
ENSMUSP00000131780  ...NLQ....KADnqaidngkra.......SSHCLKV.NSFLR..RA..YF.TN.P.......LGdKVFMNQ.RVIM.
ENSMUSP00000132457  ...NLQ....KADnqaidngkra.......SSHCLKV.NSFLR..RA..YF.TN.P.......LGdKVFMNQ.RVIM.
ENSMUSP00000076687  ...LLQ....QVDtwsenagkel.......EFDSWKM.FSILK..TM..QF.VN.P.......AGdLVNMNQ.NLKQ.
ENSMUSP00000128102  ...NLQ....QADnqaidngkga.......SSHCLKV.HSFLR..KT..HF.TN.P.......LGdKVIMKQ.RVIT.
ENSMUSP00000132539  ...NLQ....QADnqaidngkga.......SSHCLKV.HSFLR..KT..HF.TN.P.......LGdKVIMKQ.RVIT.
ENSMUSP00000129411  ...LLQ....QVDtwsnnagkel.......EFDTWKM.FSILK..TL..QF.VN.P.......AGdLVNMNQ.NLKQ.
ENSMUSP00000132726  ...LMQ....EVDtwsnnagkel.......EFDSWKM.FSILK..TL..KF.VN.P.......AGdLVNMNQ.NLKQ.
ENSMUSP00000132327  ...NLQ....QADnqaidngkga.......SSHCLKV.HSFLR..KT..HF.TN.P.......LGdKVIMKQ.RVIT.
ENSMUSP00000030792  ...LGC....TSGtcarg............PVYPWQL.LQQIY..KV..NF.LL.H.......KK.TVAFDD.KGDP.
ENSMUSP00000133014  ...LLQ....QVDtwsnndgkdl.......EFDTWKM.FSILK..TL..QF.VN.P.......AGdLVNMNQ.NLKQ.
ENSMUSP00000126917  ...LLQ....QVDtwsknagkel.......EFDSWKM.FSILK..TL..KF.VN.P.......AGdLVNMNQ.NLKQ.
ENSMUSP00000128337  ...NLQ....HADnqaidngkga.......SSHCLKV.NSFLR..RA..YF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000132332  ...NLQ....HADnqaidngkga.......SSHCLKV.NSFLR..RA..YF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000133265  ...NLQ....HADnqaidngkrv.......SSHCLKV.NSFLR..RA..YF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000126863  ...NLQ....QADnqaidngkga.......SSHCLKV.HSFLR..KT..HF.TN.P.......LGdKVIMKQ.RVIT.
ENSMUSP00000127146  ...NLQ....QADnqaidngkga.......SSHCLKV.HSFLR..KT..HF.TN.P.......LGdKVIMKQ.RVIT.
ENSMUSP00000130631  ...NLQ....HADnqaidngkra.......SSHCLKV.NSFLR..RA..YF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000132337  ...LLQ....EVDtwsknagkel.......EFDSWKM.FSILK..TL..KF.VN.P.......SGdLVNMNQ.NLKQ.
ENSMUSP00000072566  ...NLQ....QADnqaidngkga.......SSHCLKV.NSFLR..RI..YF.TN.P.......PGdKVFMKQ.RVIM.
ENSMUSP00000129466  ...NLQ....QADnqaidngkga.......SSHCLKV.NSFLR..RI..YF.TN.P.......PGdKVFMKQ.RVIM.
ENSMUSP00000075833  ...NLQ....QADnqaidngkga.......SSHCLKV.NSFLR..RI..YF.TN.P.......PGdKVFMKQ.RVIM.
ENSMUSP00000087221  ...FLQ....QAE.................-------.-----..--..--.--.-.......--.------.----.
ENSMUSP00000124342  ...LSL....RVEgdsfdkvilq.......APHPWKL.HPFLQ..KG..QV.GR.S.......TN.------.----.
ENSMUSP00000104190  ...NLQ....QADnqaidngkga.......SSHCLKV.NSFLR..RT..YF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000083463  ...NLQ....QADnqaidngkga.......SSHCLKV.NSFLR..RT..YF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000126682  ...LSL....RVEggslhk...........APLPWKL.HPFLQ..KG..QL.RR.N.......TN.EASM-N.KEVW.
ENSMUSP00000079827  ...NLQ....QADnqaigngkga.......SSHCLKV.NSFLR..RT..CF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000074476  ...NLQ....QVDnqavdngkga.......SSHCLKV.NSFLR..KI..HF.TN.P.......VGdKLIMKE.RVII.
ENSMUSP00000069647  ...NLQ....QVDnqavdngkga.......SSHCLKV.NSFLR..KI..HF.TN.P.......VGdKVIMKQ.RVIM.
ENSMUSP00000083477  ...NLQ....QVDnqaidngkls.......RYPCFKV.NSFLR..KT..HF.TN.P.......LGdKVIMKH.RVIL.
ENSMUSP00000073604  ...LSL....RMAgdsldksvlr.......APLPWKL.HPFLQ..KG..RF.GR.S.......TN.EENVGN.KEVS.
ENSMUSP00000072296  ...NLQ....QADnqaigngkga.......SSHCLKV.NSFLR..RT..YF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000129703  ...LLQ....QVDawsknagkel.......EFDPWKM.FSVLK..TI..QF.IN.P.......AGdLVNMNQ.NLRQ.
ENSMUSP00000083478  ...NLQ....QVDnqavdngkga.......SSHCLKV.NSFLR..KI..HF.TN.T.......LGdKVIMKQ.RVIM.
ENSMUSP00000083468  ...NLQ....QADnqaigngkga.......SSHCLKV.NSFLR..RT..CF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000132043  ...LSL....RVEggsldrsalr.......APLPWKL.HPFLQ..KG..QL.GR.S.......SN.KENIVN.KEIL.
ENSMUSP00000092462  ...NLQ....QADnqaidngkga.......SSHCLKV.NSFLR..RT..YF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000092460  ...NLQ....QADnqaigngkga.......SSHCLKV.NSFLR..RT..CF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000130160  ...NLQ....QADnqaigngkga.......SSHCLKV.NSFLR..RT..CF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000098528  ...LSV....RVEgdsfdkgvlr.......APLPWKL.HPFLQ..NG..QF.VR.L.......SN.EENIVN.KEGS.
ENSMUSP00000030949  ...LQC....NVShchvse...........HVLPWQL.LENMY..NM..SF.HA.R.......DL.TLQFDA.EGNV.
ENSMUSP00000129352  ...NLQ....QVDnqaidngkva.......SSHCLKV.NSFLR..KT..HF.TN.P.......LGdKVIMKQ.RVIL.
ENSMUSP00000132206  ...TFQ....KFD.................-------.-----..--..--.--.-.......--.------.----.
ENSMUSP00000032238  ...LSL....RVEgdssnkcllq.......APLPWKL.HPFLQ..KG..QL.G-.-.......--.------.----.
ENSMUSP00000127506  ...FLR....KTEigshedknhd.......RFLPWQL.HPFLR..KI..QF.TN.T.......AGdPISFDE.HKNH.
ENSMUSP00000074602  ...LSL....RVEgdsldksvlr.......PPLPWKL.HPFLQ..NS..QL.GR.S.......SN.EKNVVN.KEVS.
ENSMUSP00000128981  ...LSL....RVEggsldksvlr.......APLPWKL.HPFLQ..KG..QL.GR.S.......SN.KENIVN.KEIL.
ENSMUSP00000020062  ...CQArdckKPN.................AFQPWEL.LAVLK..NV..TF.TD.G.......RN.SFHFDA.HGDL.
ENSMUSP00000129145  ...LSL....RVEggsldksvlr.......APLPWKL.HPFLQ..KG..QL.GR.S.......SN.KENIVN.KEIL.
ENSMUSP00000030510  ...LHC....N-Qvrctkq...........IVYPWQL.LREIW..HV..NF.TL.L.......GN.QLFFDE.QGDM.
ENSMUSP00000128600  ...LLQ....QVDtwsnnagkel.......EFDSWKM.FSILK..TL..QF.VN.P.......AGdLVNMNQ.NLKQ.
ENSMUSP00000025338  ...SGG....GGRsgvrledfnynn.....QTITDQI.YRAMN..SS..SF.EG.V.......SG.HVVFDA.SGSR.
ENSMUSP00000092459  ...NLQ....QADnqatdngkra.......SSHCLKV.NSFLR..RT..YF.TN.P.......LGdKVFMKQ.RVIM.
ENSMUSP00000044521  ...MKK....N-G.................RASAASL.VQHSR..NM..QF.YG.F.......NQ.LIKTDS.NGNG.
ENSMUSP00000127895  ...NLQ....QAD.................-------.-----..--..--.--.-.......--.------.----.
ENSMUSP00000068253  ...RKA....EKD.................FRDGRQL.ISTLRagQV..TL.QG.I.......TG.PVLLDS.QGKR.
ENSMUSP00000103378  ...MET....LHAssrhqriqdfnytd...HTLGRII.LNAMN..ET..NF.FG.V.......TG.QVVF-R.NGER.
ENSMUSP00000131564  ...RLQ....LLQmqpyenhhgm.......VFFPWQL.NTFLK..NI..VV.K-.-.......-D.KRSLDW.RQTI.
ENSMUSP00000131156  ...RIQ....QLQmqpyengegm.......VFFPWQL.NTFLK..DI..EL.K-.-.......-D.KRSLDW.RQTI.
ENSMUSP00000077758  vssLQC....NRHkp...............WRFGTRF.MSLIK..EA..HW.EG.L.......TG.RITFNKtNGLRt
ENSMUSP00000095875  ...ETH....G-A.................GLSGAHL.GDHVR..AL..DV.AG.F.......SQ.RIRTDG.KGRR.
ENSMUSP00000072107  vssLQC....HRHkp...............WRLGPRF.MNLIK..EAsaRW.DG.L.......TG.RITFNKtDGLRk
ENSMUSP00000030676  vnsLQC....HRHka...............WRFGGRF.MNFIK..EA..QW.EG.L.......TG.RIVFNKtSGLRt
ENSMUSP00000027020  ...RRQ....KIDisrrgnagdclanpaapWGQGIDM.ERTLK..QV..RI.QG.L.......TG.NVQFDH.YGRRv
ENSMUSP00000032338  ...LEN....G-E.................NVTGPKF.ARAFR..NL..TF.QG.F.......AG.PVTLDD.SGDI.
ENSMUSP00000109949  ...LEK....E-Nitdpprgcvgntni...WKTGPLF.KRVLM..SS..KYaDG.V.......TG.RVEFNE.DGDRk
ENSMUSP00000044494  ...RRQ....RIDisrrgnagdclanpavpWGQGIDI.QRALQ..QV..RF.EG.L.......TG.NVQFNE.KGRRt
ENSMUSP00000103375  ...RKQ....RIEisrrgnagdclanpavpWGQGVEI.ERALK..QV..QV.EG.L.......SG.NIKFDQ.NGKRi
ENSMUSP00000075687  ...RRQ....RVDvsrrgsagdclanpavpWSQGIDI.ERALK..MV..QV.QG.M.......TG.NIQFDT.YGRRt
ENSMUSP00000021259  ...RTAv...GGG.................WVSGASV.ARQVR..EA..QV.SG.F.......CG.VLGR--.---Te
ENSMUSP00000034515  ...NRSq...EIGvkplscgsaqi......WQHGTSL.MNYLR..MV..EL.EG.L.......TG.HIEFNS.KGQRs
ENSMUSP00000003468  ...NRSq...EIGvkplactsani......WPHGTSL.MNYLR..MV..EY.DG.L.......TG.RVEFNS.KGQRt
ENSMUSP00000093536  ...LED....RKWhsmaslscirknskp..WQGGRSM.LETIK..KG..GV.NG.L.......TG.DLEFGE.NGGNp
ENSMUSP00000044009  ...LED....RKWhsmaslncirkstkp..WNGGRSM.LDTIK..KG..HI.TG.L.......TG.VMEFRE.DSSNp
ENSMUSP00000129679  ...MLQ....QVEsqkiaepkgl.......FTDCQQT.VSLLK..AQ..VF.TN.P.......DGeLVNMNH.KEYH.
ENSMUSP00000062284  ...LSE....H-Sfipepksscynthekr.IYQSNML.NRYLI..NV..TF.E-.-.......-GrNLSFSE.DGYQm
ENSMUSP00000002848  ...LRD....YGFlpelghdcraqnr....THRGESL.HRYFM..NI..TW.D-.-.......-NrDYSFNE.DGFLv
ENSMUSP00000091381  ...TMI....QPElallpstmncmdvkttnLTSGQYL.SRFLA..NT..TF.RG.L.......SG.SIKVKG.STIVs
ENSMUSP00000032331  ...LEK....F-Syipeakascygqtekp.ETPLHTL.HQFMV..NV..TW.D-.-.......-GkDLSFTE.EGYQv
ENSMUSP00000097013  ...MLQ....QVEsqkiaepkrl.......FTDCQQM.VSLLK..AQ..VF.TN.P.......DGeLVNMNH.REYQ.
ENSMUSP00000003351  ...RRQ....YGTlpapagdcrshpgpv..SPAREAF.YRHLL..NV..TW.E-.-.......-GrDFSFSP.GGYLv
ENSMUSP00000105373  ...MLQ....QVEsqkiaepkgl.......FTDCQQM.VSLLK..AQ..VF.TN.P.......DGeLVNMNH.REYQ.
ENSMUSP00000093345  ...MLQ....QVEsqkiaepkgl.......FTDCQQT.VSLLK..AQ..VF.TN.P.......GGeLVNMNH.KEYQ.


                       370                380                             390         400           
                         |                  |                               |           |           
d1jdpa_               .YGDFSVIAMT..Dvea....GT.....QEVIGDY-.................----..---------fgkegrfemr
ENSMUSP00000037255  .PGRYDIMNLQ..Y.......TEanrydYVHVGTWH.................----..---------egvlniddy.
ENSMUSP00000129181  .PGRYEIMNFK..Em......GKdyfd.YINVGSWD.................----..---------ngelkmdd..
ENSMUSP00000131856  .DSQYDILNFW..Nfpsgf..GL.....KVKVGTYSlnapq............G---..---------lqlslceqmi
ENSMUSP00000126650  .DSEYDILNFW..Nfpk....GLal...KVKVGNFSpna..............P---..---------hgqqlmlaek
ENSMUSP00000029540  .DTDFSLWDMD..Pet.....GA.....FRVVLNFNgtsqelmavsehrly..WPLG..YPPPDIPKCgf........
ENSMUSP00000125817  .YSEYDIFNFW..Nfptgl..GL.....KMKVGTFSpns..............P---..---------qghrlslsee
ENSMUSP00000113819  .PGRYDIYQYQ..Rr......NGsae..YKVIGSWTdhlhlriermq......WPG-..---------..........
ENSMUSP00000129576  .DSMYDILNFW..Nfpsgl..GL.....KVKIGTYSvsapqglq.........F---..---------slceqmiqwp
ENSMUSP00000126966  .DAQYDILNFW..Nfpsgl..GL.....KVKVGTYSlsaqqgp..........Q---..---------fslceqmiqw
ENSMUSP00000129089  .YSEYDIFNFW..Nfptgl..GL.....KMKVGTFSpn...............S---..---------pqgqqlslse
ENSMUSP00000128493  .DAQYDILNFW..Nfpsgl..GL.....KVKVGTYSlsaqhslhf........S---..---------iceqmiqwp.
ENSMUSP00000069080  .VGNYSIINWHlsPe......DGsiv..FKEVGYYNvyakkgerl........F---..---------inegkilwsg
ENSMUSP00000064404  .PGRYDIFQYQ..Ttnttn..PG.....YRLIGQWT.................----..---------delqlniedm
ENSMUSP00000129068  .YSEYDIFNFW..Nfptgl..GL.....KMKVGTFSpn...............S---..---------pqgqqlslse
ENSMUSP00000129308  .YSEYDIFNFW..Nfptgl..GL.....KMKVGTFSpn...............S---..---------pqgqqlslse
ENSMUSP00000087998  .PGRYDIFQYQi.N.......NKste..YKIIGHWT.................----..---------nqlhlkvedm
ENSMUSP00000129762  .NVKYDILNIW..Nlpkgl..GR.....KVKIGSFSpnapq............G---..---------qqlslteqii
ENSMUSP00000000631  .PGRYDIFQYQ..AtngsassGG.....YQAVGQW-.................----..---------aealrldmea
ENSMUSP00000129296  .ETKYDIFNFW..Nfpqgl..GL.....KVKVGTFSsf...............L---..---------prnkqfslsd
ENSMUSP00000129895  .DTEYDILNLW..Nlpkgl..GL.....KVKIGSFSanapqgq..........Q---..---------lslseqiiqw
ENSMUSP00000048706  .DAEYDILNLW..Nlpkgl..GL.....KVKIGNFYanapqg...........Q---..---------qlslseqmiq
ENSMUSP00000029406  .NGHYDVLNWHldD.......EGeis..FVTVGRFN.................FRS-..---------tnfelviptn
ENSMUSP00000126559  .DTEYDILNLW..Nlpkgl..GL.....KVKIGSFSanapqgq..........Q---..---------lslseqmiqw
ENSMUSP00000127465  .DEEYDILNLW..Nlpkgl..GL.....KVKIGSFSvnapqg...........Q---..---------qlslseqmiq
ENSMUSP00000129347  .NGEYDILNLW..Nlpkgl..GQ.....KVKIGSFSanapegq..........Q---..---------lslsehmiqw
ENSMUSP00000131426  .DTKYDIFNVW..Nfptgl..SL.....LVKVGTFA.................----..---------psapkeeqfs
ENSMUSP00000128685  .DEEYDILNLW..Nlpkgl..GL.....KVKIGSFSvnapqg...........Q---..---------qlslseqmiq
ENSMUSP00000132641  lNAEYDILNLW..Nlpkgl..GR.....KVKIGSFSanapegq..........Q---..---------lslsehmiqw
ENSMUSP00000004076  .MGRYNVFNFQ..Hig.....GKys...YLKVGHW-.................----..---------aetlyldvds
ENSMUSP00000124192  .NGSYDILNWHm.D.......NTgeit.FVKVGEYK.................----..---------fts.......
ENSMUSP00000128975  .CAEYDIYKIW..Nfpqgl..GL.....KVKLGSYFpc...............F---..---------phsqhihmse
ENSMUSP00000126106  .DTEYDILNIW..Nlpkgl..GL.....KVKIGSFSanapqgq..........Q---..---------lslseqmiqw
ENSMUSP00000023959  .IGRYNIFTYL..Rag.....NGryr..YQKVGYW-.................----..---------aegltldtsi
ENSMUSP00000126534  .NAEYDILNLW..Nlpkgl..GL.....KVKIGSFSantaqhq..........Q---..---------lslseemiqw
ENSMUSP00000126756  .DTEYDILNFW..Nlpkgl..GL.....KVKIGSFSanapqgq..........E---..---------lslseqmiqw
ENSMUSP00000078200  .DVEYDILNLW..Nlpkgl..GL.....KVKVGSFSanapqgq..........Q---..---------lslseqmiqw
ENSMUSP00000129313  .DTEYDILNIW..Nlpkgl..GL.....KVKIGSFSanapqgq..........Q---..---------lslseqmiqw
ENSMUSP00000130373  .NAEYDILNLW..Nlpkgl..GQ.....KVKIGSFSan...............A---..---------pegqqlslse
ENSMUSP00000128350  .DAEYEILNLW..Nlpkgl..GL.....KVKVGSYSasapqgq..........Q---..---------lslseqiiqw
ENSMUSP00000094994  .QEEYDIFYIW..Nfpqgl..GL.....RIKIGMFSpy...............FPNG..---------qqvhlsevmi
ENSMUSP00000090148  .QEEYDIFYIW..Nfpqgl..GL.....RVKIGMFSpy...............LPNG..---------qqvhlsevii
ENSMUSP00000131261  .DTEYDILNIW..Nmpkgl..GL.....KVKIGSFSanapqgq..........Q---..---------lslseqmiqw
ENSMUSP00000131925  .SGYYDILNWH..M.......GDageitFVKVGEY-.................----..---------if........
ENSMUSP00000130114  .DPEYDITNIW..Nfptgl..SL.....LVKVGTFV.................----..---------psapkgkqls
ENSMUSP00000131583  .DTEYDILNLW..Nlpkgl..GL.....KMKIGSFSanapqgk..........Q---..---------lslsehmiqw
ENSMUSP00000126885  .QEEYDIFYIW..Nfpqgl..GL.....RVKIGMFSpy...............FPNG..---------qqvhlsedmi
ENSMUSP00000127981  .QENYDIFYVW..Nfpqgl..GL.....KVKIGIFSpy...............I---..---------ingqqlhlse
ENSMUSP00000132299  .DPEYDITNIW..Nfptgl..SQ.....LVKVGTFV.................----..---------psapkgeqls
ENSMUSP00000131447  .QEEYDIFYIW..Nfphgl..GF.....KVKIGIFSpy...............FPNG..Q--------qvhlsedmie
ENSMUSP00000128106  .QEEYDIVYIW..Nfpqgl..GL.....RVKIGMFSpy...............FPNG..---------qqvhlsedml
ENSMUSP00000077109  .KGYYDILNWH..M.......GNtgeitFVKVGEY-.................----..---------ky........
ENSMUSP00000020547  .DPEYDITNIW..Nfptgl..SL.....LVKVGTFV.................----..---------psapkgeqls
ENSMUSP00000131450  .CADYDIFNIW..Nfpqgl..GL.....RVKIGSYYpc...............FP--..---------qnqqlhised
ENSMUSP00000125126  .CTEYDIFLIW..Nfpqgl..GL.....KVKIGSYL.................----..---------pcfpqrqelh
ENSMUSP00000126386  .DSGYDILNLW..Nlpkgl..GL.....KVKIGSFSanapqgq..........Q---..---------lslseqmiqw
ENSMUSP00000127505  .QEEYDIFYIW..Nfpqgl..EL.....RVKIGMFSpy...............FPNG..---------qqvhlsedmi
ENSMUSP00000124065  .CTEYDIFIIW..Nfpqgl..GL.....KLKIGSYI.................----..---------pcfpksqqlh
ENSMUSP00000132478  .DTEYDIFYIM..Dflkhe..GL.....KMKIGRFSgh...............FPNG..Q--------qlfisdemie
ENSMUSP00000127838  .CADYDIFNIW..Nfpqgl..GL.....KVKIGSYF.................----..---------pcfpqsqqlc
ENSMUSP00000127513  .NGSYDIINWHm.D.......NTgeit.FVKVGEY-.................----..---------kf........
ENSMUSP00000129215  .CAEYDIFIIW..Nfpqgl..GL.....KVKIGNYF.................----..---------pcfprsqqlh
ENSMUSP00000126953  .CADYDIFIIW..Nfpqgl..GL.....KVKIGSY-.................----..---------lhcfsqsqql
ENSMUSP00000071670  .CTEYDIFIIW..Nfpqgl..GL.....KVKIGSYI.................----..---------pcfpksqqlh
ENSMUSP00000131831  .NGSYDILNWHm.D.......NTgeit.FVKVGEYK.................----..---------fts.......
ENSMUSP00000133218  .CADYDIFIIW..Nfsqgl..GL.....KVKIGSY-.................----..---------lhcyprsqql
ENSMUSP00000092079  .CAEYDIFIIW..Nfpqgl..GL.....KVKIGSYF.................----..---------pcfpqsqqlh
ENSMUSP00000126698  .DTEYDIFYIM..Dflkhe..GL.....KMKIGRFSgh...............FPNG..Q--------qlfmsdemie
ENSMUSP00000128015  .CADYDIFIIW..Nfpqgl..GL.....KVKIGSYL.................----..---------pcfpqsqqlh
ENSMUSP00000129540  .DTEYDIFYIT..Dflkhe..GL.....KMKIGRFSgh...............FPNG..Q--------qlfisdemie
ENSMUSP00000126596  .CAEYDIFIIW..Nfpqgl..GL.....KVKIGSYFpcfp.............W---..---------sqqlhisedl
ENSMUSP00000128333  .CADYDIFIIW..Nfpqgl..GL.....KVKIGNYL.................----..---------pcypwsqqlh
ENSMUSP00000128792  .CAEYDIFIIW..Nfpqgl..GL.....KVKIGSYF.................----..---------pcfpqsqqlh
ENSMUSP00000129520  .CAEYDIFIIW..Nfpqgl..GL.....KVKIGSY-.................----..---------lpcfqqsqql
ENSMUSP00000052977  .CADYDIFIIW..Nfpkgl..GL.....KVKIGSY-.................----..---------lpcfhqsqql
ENSMUSP00000078162  .CTEYDIFIIW..Nfpqgl..GL.....KVKIGSY-.................----..---------lpcfqqsqql
ENSMUSP00000132467  .QEEYDIFHFG..Nlsqhl..GI.....KVKLGKFS.................----..---------pyfs......
ENSMUSP00000129566  .VTKFDIFQGQ..Ktpd....G-.....--------.................----..---------vfhlvcvgli
ENSMUSP00000036551  .DTEYDILYAM..Dllpal..GL.....NVKIGKFS.................----..---------qhflhfqqly
ENSMUSP00000126007  .DTDYDIFYIM..Dfqkdy..GF.....KMKIGRFSgh...............L---..---------pshqqlymsk
ENSMUSP00000083386  .VTKFDIFQGQ..K.......--.....--------.................----..---------tpagvfhlvh
ENSMUSP00000129960  .QEEYDIFHFG..Nlsqhl..GI.....KVKLGKFS.................----..---------pyfs......
ENSMUSP00000066737  .YGDFSVVAMT..Dtea....GT.....QEVIGDY-.................----..---------f.........
ENSMUSP00000074613  .QEEYDIFHFG..Nlsqhl..GI.....KVKLGKFS.................----..---------pyfs......
ENSMUSP00000129578  .QEEYDIFHFG..Nlsqhl..GI.....KVKLGKFS.................----..---------pyfs......
ENSMUSP00000122645  .DTEYDIFFIM..Dfkkyy..GL.....KIKIGRFSgh...............LPSG..---------qqllmstemi
ENSMUSP00000104194  .QEEYDIFHFG..Nlsqhl..GI.....KVKLGKFS.................----..---------pyfs......
ENSMUSP00000132834  .VTKFDIFQGQ..K.......--.....--------.................----..---------tpagvfhlvh
ENSMUSP00000093612  .CADYDIFIIW..Nfpkgl..GL.....KVKIGYY-.................----..---------lpcyqrsqql
ENSMUSP00000126979  .VTQFDIFQGK..K.......--.....--------.................----..---------tpagvfhlvh
ENSMUSP00000126973  .DTEYDIFYIP..Nfqkyy..GL.....KMKIGRFSgy...............LPSG..---------qqlymskemm
ENSMUSP00000127309  .NINYDIFYTG..Nflqsf..GI.....KVKIGKFF.................----..---------kyfthpqell
ENSMUSP00000126165  .NGYYDILNWQm.D.......NTgdia.IVKVGEY-.................----..---------kf........
ENSMUSP00000131128  .DAEYEIYMIW..Nfpqgl..GV.....KVKIGRFY.................----..---------syflhdqkly
ENSMUSP00000131990  .QEDYDIFHFG..Nlsqhl..GI.....KLKLGKFS.................----..---------pyfs......
ENSMUSP00000127337  .QDEYDIFHFW..Nlsqhl..GI.....KMKLGKFS.................----..---------p.........
ENSMUSP00000030191  .ETDFVLWAMG..Dlds....GD.....FQPAAHYSgaekqiwwtgrpip...WVKG..APPLDNPPCaf........
ENSMUSP00000133007  .QEEYDIFHFE..Nlsqhl..GI.....KVKLGKFS.................----..---------qyvs......
ENSMUSP00000131780  .QDEYDIIHFW..Nlsqhl..GI.....KMKLGKFS.................----..---------p.........
ENSMUSP00000132457  .QDEYDIIHFW..Nlsqhl..GI.....KMKLGKFS.................----..---------p.........
ENSMUSP00000076687  .EREYDIFYIM..Dfqkdy..GL.....KMKIGKFSgh...............LP--..---------shqqlymske
ENSMUSP00000128102  .QEDYDVFHFG..Nlsqhl..GI.....KLKLGKF-.................----..---------sp........
ENSMUSP00000132539  .QEDYDVFHFG..Nlsqhl..GI.....KLKLGKF-.................----..---------sp........
ENSMUSP00000129411  .DTEYEIFYIM..Dfqkdy..GL.....KMKIGRFSgh...............L---..---------psrqqlymsk
ENSMUSP00000132726  .ATQYNIFYVM..Dfqkdy..GL.....KMKIGRFSeh...............LPSG..---------qqlymskemi
ENSMUSP00000132327  .QEDYDVFHFG..Nlsqhl..GI.....KLKLGKF-.................----..---------sp........
ENSMUSP00000030792  .LGYYDIIAWD..W.......NGpewt.F-------.................----..---------evigsaslsp
ENSMUSP00000133014  .DTEYDIFYIM..Dfqkhy..GF.....KMKIGRFS.................----..---------ghlpsrqqly
ENSMUSP00000126917  .DVEFDVFYIM..Dfqkdy..GL.....KMKIGRFSeh...............LPSG..---------qqiymskemi
ENSMUSP00000128337  .QDEYDIIHFG..Nlsqhl..EI.....KMKL----.................----..---------gkfsp.....
ENSMUSP00000132332  .QDEYDIIHFG..Nlsqhl..EI.....KMKL----.................----..---------gkfsp.....
ENSMUSP00000133265  .QDEYDIIHFG..Nlsqhl..EI.....KMKL----.................----..---------gkfsp.....
ENSMUSP00000126863  .QEDYDVFHFG..N.......--.....--------.................----..---------lsqhlgiklk
ENSMUSP00000127146  .QEDYDVFHFG..N.......--.....--------.................----..---------lsqhlgiklk
ENSMUSP00000130631  .QDEYDIIHFG..Nlsqhl..EI.....KMKL----.................----..---------gkfsp.....
ENSMUSP00000132337  .DTEYDIFYIM..Dfqkdy..GL.....KMKIGRFS.................----..---------ghllsgqqly
ENSMUSP00000072566  .HDEYDIVHFV..Nlsqhl..GI.....KMKLGKFS.................----..---------pylp......
ENSMUSP00000129466  .QDEYDIVHFV..Nlsqhl..GI.....KMKLGKF-.................----..---------sp........
ENSMUSP00000075833  .QDEYDIVHFV..Nlsqhl..GI.....KMKLGKFS.................----..---------pylp......
ENSMUSP00000087221  .----------..-.......--.....--------.................----..---------sqkradpkrd
ENSMUSP00000124342  .----------..-.......--.....--------.................----..---------eeysvnkevs
ENSMUSP00000104190  .QDEYDIVHFA..Nlsehl..GI.....KMKLGKF-.................----..---------sp........
ENSMUSP00000083463  .QDEYDIVHFA..Nlsqhl..GI.....KMKLGKF-.................----..---------sp........
ENSMUSP00000126682  .TTELDIFNYQ..Slq.....SGtka..QVKVGEF-.................----..---------vfgshsvqhl
ENSMUSP00000079827  .QDEYDIIHFG..Nlsqhl..GI.....KMKLGKFS.................----..---------pylphgr...
ENSMUSP00000074476  .QEDYDIFHFE..Nlsqhl..GI.....KVKLGKFS.................----..---------pyfs......
ENSMUSP00000069647  .QEDYDIFHFE..Nlsqhl..GI.....KVKLGKFS.................----..---------pyfs......
ENSMUSP00000083477  .QEDYDIFHFW..Nlsqhl..GI.....KVKLGKFS.................----..---------pyfp......
ENSMUSP00000073604  .ATKFDILNYH..Slpsst..KS.....QVKVGEFV.................----..---------feshtvqlfs
ENSMUSP00000072296  .QDEYDIIHFG..Nlsqhl..GI.....KMKLGKF-.................----..---------sp........
ENSMUSP00000129703  .DVEYDVFYIM..Dfqkvy..GL.....KMKIGRFS.................----..---------gqlssgqqly
ENSMUSP00000083478  .QEDYDIFHFE..Nlsqhl..GI.....KVKLGKFS.................----..---------pyfs......
ENSMUSP00000083468  .QDEYDIIHFG..Nlsqhl..GI.....KMKLGKF-.................----..---------sp........
ENSMUSP00000132043  .ATEFDIFNYQ..Slq.....SGtka..QVKVGEF-.................----..---------vfeshrvqhf
ENSMUSP00000092462  .QDEYDIVHFA..Nlsqhl..GI.....KMKLGKF-.................----..---------sp........
ENSMUSP00000092460  .QDEYDIIHFG..Nlsqhl..GI.....KMKLGKF-.................----..---------sp........
ENSMUSP00000130160  .QDEYDIIHFG..Nlsqhl..GI.....KMKLGKF-.................----..---------sp........
ENSMUSP00000098528  .ATKLDIFNYQ..Slqsgt..EG.....HVKVGEF-.................----..---------vfephrvqhl
ENSMUSP00000030949  .DMEYDLKMWV..Wqspt...PV.....LHTVGTFNgtlqlqqskmy......WPG-..---------..........
ENSMUSP00000129352  .QEDYDIFHFW..Nlskhl..GI.....KVKLGKFS.................----..---------pyfp......
ENSMUSP00000132206  .----------..-.......--.....--------.................----..---------nlptdnvkeq
ENSMUSP00000032238  .----------..-.......--.....--------.................----..---------rstneentvn
ENSMUSP00000127506  .MEIYEIQNFM..Kytkqh..SY.....LVKVGEFVskspqdqsl........F---..---------ineslikwpn
ENSMUSP00000074602  .ATKLDIFNYQ..Slq.....SGtka..QVKVGEF-.................----..---------vfeshsvqhl
ENSMUSP00000128981  .ATEFDIFNYQ..Slq.....SGtka..QVKVGEFV.................----..---------feshrvqhfs
ENSMUSP00000020062  .NTGYDVVLWK..Et......NG.....LMTV----.................----..---------tkmaeyd...
ENSMUSP00000129145  .ATEFDIFNYQ..Slq.....SGtka..QVKVGEFV.................----..---------feshsvqhfs
ENSMUSP00000030510  .PMLLDIIQWQ..W.......GLsqnp.FQSIASYS.................----..---------ptetrltyis
ENSMUSP00000128600  .DTVYDIFYIL..Nfqkyf..GL.....KIKIGIFSgy...............LPSG..---------qqlymskemm
ENSMUSP00000025338  .MAWTLIEQLQ..G.......GS.....YKKIGYYDstkddlswsktdk....WIGG..SPPAD----..........
ENSMUSP00000092459  .QDEYDIVHFG..N.......--.....--------.................----..---------lsqhlgikmk
ENSMUSP00000044521  .ISEYVILDTN..G.......KE.....WELRGTYTvdmetellrfrgtpih.FPGG..RP-------tsadakcwf.
ENSMUSP00000127895  .----------..-.......--.....--------.................----..---------nqaigngkga
ENSMUSP00000068253  .HVDYSVYALQ..E.......SGnrsl.FLPFLHYDsfqkvirpwrndsnts.WPHG..SLPEYKPGCgf........
ENSMUSP00000103378  .MGTIKFTQFQ..D.......SR.....EVKVGEYNavadtleiindtir...FQGS..EPPKD----..........
ENSMUSP00000131564  .DAEYDILNIW..Nlpkgl..GL.....KVKIGSFSanaplgqql........S---..---------lseqmiqwp.
ENSMUSP00000131156  .DTEYDILNIW..Nlpkgl..GL.....KVKIGSFSanapqdqql........C---..---------lseqmiqwp.
ENSMUSP00000077758  .DFDLDVISLK..E.......EG.....LEKIGTWD.................P---..---------ssg.......
ENSMUSP00000095875  .LAQYVILDTD..G.......EG.....SQLVPTHIldtstwqvqplgkpih.FPGG..SPPAHDASCwf........
ENSMUSP00000072107  .DFDLDIISLK..E.......EG.....TEKIGIWN.................SNS-..---------g.........
ENSMUSP00000030676  .DFDLDIISLK..E.......DG.....LEKVGVWS.................PA--..---------dg........
ENSMUSP00000027020  .NYTMDVFELK..S.......TG.....PRKVGYWN.................----..---------dmdk......
ENSMUSP00000032338  .DNIMSLLYVSl.Dt......RK.....YKVLMKYDthknktipvaenpnfi.WKNH..KLPNDVP--..........
ENSMUSP00000109949  .FANYSIMNLQ..N.......RK.....LVQVGIYNgthvipndrkii.....WPGGetEKPR-----g.........
ENSMUSP00000044494  .NYTLHVIEMK..H.......DG.....IRKIGYWN.................----..---------eddkf.....
ENSMUSP00000103375  .NYTINIMELK..T.......NG.....PRKIGYWS.................----..---------..........
ENSMUSP00000075687  .NYTIDVYEMK..V.......SG.....SRKAGYWN.................EY--..---------erfvpf....
ENSMUSP00000021259  .EPSFVLLDTD..A.......SG.....EQLFATHLldpvlgslrsagtpmhfPRGG..PAPGPDPSCwf........
ENSMUSP00000034515  .NYALKILQFT..R.......NG.....FQQIGQWH.................----..---------v.........
ENSMUSP00000003468  .NYTLRILEKS..R.......QG.....HREIGVWY.................----..---------..........
ENSMUSP00000093536  .NVHFEILGTN..Ygeelg..RG.....VRKLGCWN.................PVT-..---------gln.......
ENSMUSP00000044009  .YVQFEILGTT..Ysetf...GKd....MRKLATWD.................----..---------sekglngs..
ENSMUSP00000129679  .CVEYDICIIW..Nfrqgl..GL.....KVKIGS--.................----..---------hfpcfpqtqq
ENSMUSP00000062284  .HPKLVIILLN..Ke......RK.....WERVGKWK.................----..---------dkslqmkyyv
ENSMUSP00000002848  .NPSLVVISLTr.D.......RT.....WEVVGSWE.................----..---------qqtlrlkyp.
ENSMUSP00000091381  sENNFFIWNLQy.Dpm.....GKpm...WTRLGSWQ.................----..---------ggrivmdsgi
ENSMUSP00000032331  .HPRLVVIVLN..Kd......RE.....WEKVGKWEnqtlslrhav.......W---..---------p.........
ENSMUSP00000097013  .CVEYDICIIW..Nfrqgl..GL.....KVKIGSYF.................----..---------pcfpqtqqll
ENSMUSP00000003351  .QPTMVVIALN..Rh......RL.....WEMVGRWD.................----..---------..........
ENSMUSP00000105373  .CVEYDICIIW..Nfrqgl..GL.....KVKIGS--.................----..---------hfpcfpqtqq
ENSMUSP00000093345  .CVEYDICIIW..Nfrqgl..GL.....KVKIGS--.................----..---------hfpcfpqtqq


                                                                      
                                                                      
d1jdpa_               p...............................................
ENSMUSP00000037255  ................................................
ENSMUSP00000129181  ................................................
ENSMUSP00000131856  qwp.............................................
ENSMUSP00000126650  riqwp...........................................
ENSMUSP00000029540  ................................................
ENSMUSP00000125817  miqwp...........................................
ENSMUSP00000113819  ................................................
ENSMUSP00000129576  ................................................
ENSMUSP00000126966  p...............................................
ENSMUSP00000129089  emiqwp..........................................
ENSMUSP00000128493  ................................................
ENSMUSP00000069080  ................................................
ENSMUSP00000064404  qw..............................................
ENSMUSP00000129068  emiqwp..........................................
ENSMUSP00000129308  emiqwp..........................................
ENSMUSP00000087998  qw..............................................
ENSMUSP00000129762  qwp.............................................
ENSMUSP00000000631  lqws............................................
ENSMUSP00000129296  gmiew...........................................
ENSMUSP00000129895  p...............................................
ENSMUSP00000048706  wp..............................................
ENSMUSP00000029406  stifw...........................................
ENSMUSP00000126559  p...............................................
ENSMUSP00000127465  wp..............................................
ENSMUSP00000129347  ag..............................................
ENSMUSP00000131426  isehiidwp.......................................
ENSMUSP00000128685  wp..............................................
ENSMUSP00000132641  ag..............................................
ENSMUSP00000004076  ihw.............................................
ENSMUSP00000124192  ................................................
ENSMUSP00000128975  dfew............................................
ENSMUSP00000126106  p...............................................
ENSMUSP00000023959  ipw.............................................
ENSMUSP00000126534  p...............................................
ENSMUSP00000126756  p...............................................
ENSMUSP00000078200  p...............................................
ENSMUSP00000129313  p...............................................
ENSMUSP00000130373  qmiqw...........................................
ENSMUSP00000128350  p...............................................
ENSMUSP00000094994  rw..............................................
ENSMUSP00000090148  kw..............................................
ENSMUSP00000131261  p...............................................
ENSMUSP00000131925  ................................................
ENSMUSP00000130114  mseyminwp.......................................
ENSMUSP00000131583  p...............................................
ENSMUSP00000126885  ew..............................................
ENSMUSP00000127981  dmlew...........................................
ENSMUSP00000132299  iseyminwp.......................................
ENSMUSP00000131447  w...............................................
ENSMUSP00000128106  kw..............................................
ENSMUSP00000077109  ................................................
ENSMUSP00000020547  mseymiswp.......................................
ENSMUSP00000131450  lew.............................................
ENSMUSP00000125126  isddlew.........................................
ENSMUSP00000126386  p...............................................
ENSMUSP00000127505  ew..............................................
ENSMUSP00000124065  isddlew.........................................
ENSMUSP00000132478  w...............................................
ENSMUSP00000127838  isenmew.........................................
ENSMUSP00000127513  ................................................
ENSMUSP00000129215  isedlew.........................................
ENSMUSP00000126953  hisedlew........................................
ENSMUSP00000071670  icddlew.........................................
ENSMUSP00000131831  ................................................
ENSMUSP00000133218  hisedlew........................................
ENSMUSP00000092079  isedlew.........................................
ENSMUSP00000126698  w...............................................
ENSMUSP00000128015  isedldw.........................................
ENSMUSP00000129540  w...............................................
ENSMUSP00000126596  ew..............................................
ENSMUSP00000128333  isenlew.........................................
ENSMUSP00000128792  isedlew.........................................
ENSMUSP00000129520  hisedldw........................................
ENSMUSP00000052977  hisedlew........................................
ENSMUSP00000078162  hisedlew........................................
ENSMUSP00000132467  ................................................
ENSMUSP00000129566  dpqas...........................................
ENSMUSP00000036551  iaedmidw........................................
ENSMUSP00000126007  emmew...........................................
ENSMUSP00000083386  vgmidpqvssg.....................................
ENSMUSP00000129960  ................................................
ENSMUSP00000066737  ................................................
ENSMUSP00000074613  ................................................
ENSMUSP00000129578  ................................................
ENSMUSP00000122645  kw..............................................
ENSMUSP00000104194  ................................................
ENSMUSP00000132834  vgmidpqvssg.....................................
ENSMUSP00000093612  hiydlew.........................................
ENSMUSP00000126979  vglidpqas.......................................
ENSMUSP00000126973  ew..............................................
ENSMUSP00000127309  myeelvdw........................................
ENSMUSP00000126165  ................................................
ENSMUSP00000131128  lyedmiqw........................................
ENSMUSP00000131990  ................................................
ENSMUSP00000127337  ................................................
ENSMUSP00000030191  ................................................
ENSMUSP00000133007  ................................................
ENSMUSP00000131780  ................................................
ENSMUSP00000132457  ................................................
ENSMUSP00000076687  miew............................................
ENSMUSP00000128102  ................................................
ENSMUSP00000132539  ................................................
ENSMUSP00000129411  emmew...........................................
ENSMUSP00000132726  ew..............................................
ENSMUSP00000132327  ................................................
ENSMUSP00000030792  vhldinktkiqwhg..................................
ENSMUSP00000133014  mskemmew........................................
ENSMUSP00000126917  ew..............................................
ENSMUSP00000128337  ................................................
ENSMUSP00000132332  ................................................
ENSMUSP00000133265  ................................................
ENSMUSP00000126863  lekfspyfsh......................................
ENSMUSP00000127146  lekfspyfsh......................................
ENSMUSP00000130631  ................................................
ENSMUSP00000132337  makemmew........................................
ENSMUSP00000072566  ................................................
ENSMUSP00000129466  ................................................
ENSMUSP00000075833  ................................................
ENSMUSP00000087221  ftecqqv.........................................
ENSMUSP00000124342  aikldifnyqslqsgteahvkvgefvfeshsvqhlslndkiitw....
ENSMUSP00000104190  ................................................
ENSMUSP00000083463  ................................................
ENSMUSP00000126682  slndklitw.......................................
ENSMUSP00000079827  ................................................
ENSMUSP00000074476  ................................................
ENSMUSP00000069647  ................................................
ENSMUSP00000083477  ................................................
ENSMUSP00000073604  ldeklitw........................................
ENSMUSP00000072296  ................................................
ENSMUSP00000129703  mskeiiew........................................
ENSMUSP00000083478  ................................................
ENSMUSP00000083468  ................................................
ENSMUSP00000132043  sineklitw.......................................
ENSMUSP00000092462  ................................................
ENSMUSP00000092460  ................................................
ENSMUSP00000130160  ................................................
ENSMUSP00000098528  slneelirw.......................................
ENSMUSP00000030949  ................................................
ENSMUSP00000129352  ................................................
ENSMUSP00000132206  nyacnk..........................................
ENSMUSP00000032238  kevsaikldifnyqslqsgteahvkvgefvfdshsvqhlslndkiitw
ENSMUSP00000127506  ................................................
ENSMUSP00000074602  slndklitw.......................................
ENSMUSP00000128981  ineklitw........................................
ENSMUSP00000020062  ................................................
ENSMUSP00000129145  lneklitw........................................
ENSMUSP00000030510  nvsw............................................
ENSMUSP00000128600  ew..............................................
ENSMUSP00000025338  ................................................
ENSMUSP00000092459  lgkisp..........................................
ENSMUSP00000044521  ................................................
ENSMUSP00000127895  sshclk..........................................
ENSMUSP00000068253  ................................................
ENSMUSP00000103378  ................................................
ENSMUSP00000131564  ................................................
ENSMUSP00000131156  ................................................
ENSMUSP00000077758  ................................................
ENSMUSP00000095875  ................................................
ENSMUSP00000072107  ................................................
ENSMUSP00000030676  ................................................
ENSMUSP00000027020  ................................................
ENSMUSP00000032338  ................................................
ENSMUSP00000109949  ................................................
ENSMUSP00000044494  ................................................
ENSMUSP00000103375  ................................................
ENSMUSP00000075687  ................................................
ENSMUSP00000021259  ................................................
ENSMUSP00000034515  ................................................
ENSMUSP00000003468  ................................................
ENSMUSP00000093536  ................................................
ENSMUSP00000044009  ................................................
ENSMUSP00000129679  llisedlew.......................................
ENSMUSP00000062284  wp..............................................
ENSMUSP00000002848  ................................................
ENSMUSP00000091381  wp..............................................
ENSMUSP00000032331  ................................................
ENSMUSP00000097013  isedlew.........................................
ENSMUSP00000003351  ................................................
ENSMUSP00000105373  llisedlew.......................................
ENSMUSP00000093345  llisedlew.......................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0039493 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Trichoderma citrinoviride v1.0
NoYes   Aspergillus zonatus v1.0
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Phytophthora capsici
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acholeplasma laidlawii PG-8A
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Mesoplasma florum L1
NoYes   Mycoplasma leachii 99/014/6
NoYes   Mycoplasma mycoides subsp. capri LC str. 95010
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma bovis HB0801
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma agalactiae PG2
NoYes   Mycoplasma synoviae 53
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma hyorhinis GDL-1
NoYes   Mycoplasma hyopneumoniae 168
NoYes   Conexibacter woesei DSM 14684
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Acidothermus cellulolyticus 11B
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium leprae Br4923
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Tropheryma whipplei TW08/27
NoYes   Sanguibacter keddieii DSM 10542
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Leifsonia xyli subsp. xyli str. CTCB07
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Isoptericola variabilis 225
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Cellulomonas flavigena DSM 20109
NoYes   Cellulomonas fimi ATCC 484
NoYes   [Cellvibrio] gilvus ATCC 13127
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Micrococcus luteus NCTC 2665
NoYes   Gardnerella vaginalis 409-05
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium bifidum S17
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Arcanobacterium haemolyticum DSM 20595
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Dehalogenimonas lykanthroporepellens BL-DC-9
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Marinithermus hydrothermalis DSM 14884
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Veillonella parvula DSM 2008
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus bromii
NoYes   Ruminococcus albus 7
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   Sulfobacillus acidophilus DSM 10332
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   butyrate-producing bacterium SM4/1
NoYes   Candidatus Desulforudis audaxviator MP104C
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Desulfotomaculum kuznetsovii DSM 6115
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Syntrophomonas wolfei subsp. wolfei str. Goettingen
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor obsidiansis OB47
NoYes   Caldicellulosiruptor kronotskyensis 2002
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor kristjanssonii 177R1B
NoYes   Caldicellulosiruptor saccharolyticus DSM 8903
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Carboxydothermus hydrogenoformans Z-2901
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Ammonifex degensii KC4
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Weissella koreensis KACC 15510
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus kefiranofaciens ZW3
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus sanfranciscensis TMW 1.1304
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus uberis 0140J
NoYes   Streptococcus parauberis KCTC 11537
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pyogenes str. Manfredo
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus thermophilus LMD-9
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus terrae HPL-003
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Paenibacillus polymyxa M1
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Solibacillus silvestris StLB046
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   butyrate-producing bacterium SSC/2
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Macrococcus caseolyticus JCSC5402
NoYes   Staphylococcus pseudintermedius HKU10-03
NoYes   Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305
NoYes   Staphylococcus lugdunensis HKU09-01
NoYes   Staphylococcus haemolyticus JCSC1435
NoYes   Staphylococcus epidermidis RP62A
NoYes   Staphylococcus carnosus subsp. carnosus TM300
NoYes   Staphylococcus aureus subsp. aureus JH1
NoYes   Staphylococcus aureus
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Candidatus Cardinium hertigii
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Blattabacterium sp. (Blattella germanica) str. Bge
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Chlamydophila pecorum E58
NoYes   Chlamydophila pneumoniae TW-183
NoYes   Chlamydophila caviae GPIC
NoYes   Chlamydophila felis Fe/C-56
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Chlamydia trachomatis B/Jali20/OT
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Aminobacterium colombiense DSM 12261
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Brachyspira murdochii DSM 12563
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira pilosicoli 95/1000
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Flexistipes sinusarabici DSM 4947
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Thermocrinis albus DSM 14484
NoYes   Hydrogenobacter thermophilus TK-6
NoYes   Dictyoglomus turgidum DSM 6724
NoYes   Dictyoglomus thermophilum H-6-12
NoYes   Caldisericum exile AZM16c01
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter felis ATCC 49179
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   syncytium symbiont of Diaphorina citri
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Taylorella asinigenitalis MCE3
NoYes   Taylorella equigenitalis MCE9
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Zymomonas mobilis subsp. mobilis NCIMB 11163
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Ketogulonicigenium vulgare Y25
NoYes   Ketogulonigenium vulgarum WSH-001
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   alpha proteobacterium HIMB59
NoYes   Candidatus Pelagibacter sp. IMCC9063
NoYes   Candidatus Midichloria mitochondrii IricVA
NoYes   Rickettsia bellii OSU 85-389
NoYes   Rickettsia canadensis str. McKiel
NoYes   Rickettsia typhi str. Wilmington
NoYes   Rickettsia prowazekii str. BuV67-CWPP
NoYes   Rickettsia philipii str. 364D
NoYes   Rickettsia heilongjiangensis 054
NoYes   Rickettsia peacockii str. Rustic
NoYes   Rickettsia felis URRWXCal2
NoYes   Rickettsia slovaca 13-B
NoYes   Rickettsia parkeri str. Portsmouth
NoYes   Rickettsia massiliae MTU5
NoYes   Rickettsia japonica YH
NoYes   Rickettsia africae ESF-5
NoYes   Rickettsia rhipicephali str. 3-7-female6-CWPP
NoYes   Rickettsia montanensis str. OSU 85-930
NoYes   Candidatus Rickettsia amblyommii str. GAT-30V
NoYes   Rickettsia australis str. Cutlack
NoYes   Rickettsia akari str. Hartford
NoYes   Rickettsia rickettsii str. 'Sheila Smith'
NoYes   Rickettsia conorii str. Malish 7
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Agrobacterium sp. H13-3
NoYes   Agrobacterium vitis S4
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Bartonella tribocorum CIP 105476
NoYes   Bartonella clarridgeiae 73
NoYes   Bartonella henselae str. Houston-1
NoYes   Bartonella grahamii as4aup
NoYes   Bartonella quintana str. Toulouse
NoYes   Bartonella bacilliformis KC583
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Aggregatibacter aphrophilus NJ8700
NoYes   Aggregatibacter actinomycetemcomitans D7S-1
NoYes   Haemophilus somnus 129PT
NoYes   Gallibacterium anatis UMN179
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parasuis SH0165
NoYes   Haemophilus ducreyi 35000HP
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Haemophilus influenzae PittEE
NoYes   Actinobacillus succinogenes 130Z
NoYes   Actinobacillus pleuropneumoniae serovar 5b str. L20
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Rhodanobacter denitrificans
NoYes   Frateuria aurantia DSM 6220
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Halothiobacillus neapolitanus c2
NoYes   Spiribacter sp. UAH-SP71
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Coxiella burnetii Dugway 5J108-111
NoYes   Legionella longbeachae NSW150
NoYes   Legionella pneumophila str. Corby
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia symbiotica str. 'Cinara cedri'
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Escherichia blattae DSM 4481
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Psychrobacter sp. G
NoYes   Psychrobacter sp. PRwf-1
NoYes   Psychrobacter arcticus 273-4
NoYes   Psychrobacter cryohalolentis K5
NoYes   Moraxella catarrhalis RH4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter sp. ADP1
NoYes   Methylophaga sp. JAM1
NoYes   Cycloclasticus sp. P1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Thioalkalimicrobium cyclicum ALM1
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Cenarchaeum symbiosum A
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Candidatus Korarchaeum cryptofilum OPF8
NoYes   Acidilobus saccharovorans 345-15
NoYes   Pyrolobus fumarii 1A
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Thermogladius cellulolyticus 1633
NoYes   Ignisphaera aggregans DSM 17230
NoYes   Aeropyrum pernix K1
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Thermosphaera aggregans DSM 11486
NoYes   Staphylothermus hellenicus DSM 12710
NoYes   Staphylothermus marinus F1
NoYes   Desulfurococcus fermentans DSM 16532
NoYes   Desulfurococcus kamchatkensis 1221n
NoYes   Desulfurococcus mucosus DSM 2162
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   Thermofilum sp. 1910b
NoYes   Thermofilum pendens Hrk 5
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Pyrobaculum sp. 1860
NoYes   Pyrobaculum calidifontis JCM 11548
NoYes   Pyrobaculum arsenaticum DSM 13514
NoYes   Pyrobaculum oguniense TE7
NoYes   Thermoproteus neutrophilus V24Sta
NoYes   Pyrobaculum aerophilum str. IM2
NoYes   Pyrobaculum islandicum DSM 4184
NoYes   Thermoproteus uzoniensis 768-20
NoYes   Thermoproteus tenax Kra 1
NoYes   halophilic archaeon DL31
NoYes   Methanocella conradii HZ254
NoYes   Methanosaeta harundinacea 6Ac
NoYes   Methanosaeta concilii GP6
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Methanosphaerula palustris E1-9c
NoYes   Methanoregula boonei 6A8
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanocorpusculum labreanum Z
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanopyrus kandleri AV19
NoYes   Ferroglobus placidus DSM 10642
NoYes   Archaeoglobus profundus DSM 5631
NoYes   Archaeoglobus veneficus SNP6
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Thermococcus sp. 4557
NoYes   Thermococcus onnurineus NA1
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus gammatolerans EJ3
NoYes   Thermococcus sibiricus MM 739
NoYes   Thermococcus barophilus MP
NoYes   Pyrococcus sp. ST04
NoYes   Pyrococcus yayanosii CH1
NoYes   Pyrococcus horikoshii OT3
NoYes   Pyrococcus abyssi GE5
NoYes   Pyrococcus furiosus COM1
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Halopiger xanaduensis SH-6
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Natrinema sp. J7-2
NoYes   Natrialba magadii ATCC 43099
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Haloquadratum walsbyi DSM 16790
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Haloferax volcanii DS2
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Natronomonas pharaonis DSM 2160
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Halalkalicoccus jeotgali B3
NoYes   Halobacterium salinarum R1
NoYes   Halobacterium sp. NRC-1
NoYes   Methanotorris igneus Kol 5
NoYes   Methanocaldococcus sp. FS406-22
NoYes   Methanocaldococcus vulcanius M7
NoYes   methanocaldococcus infernus ME
NoYes   Methanocaldococcus jannaschii DSM 2661
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Cyanobium gracile PCC 6307
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Synechococcus sp. JA-3-3Ab
NoYes   Synechococcus sp. CC9902
NoYes   Synechococcus sp. RCC307
NoYes   Synechococcus sp. CC9605
NoYes   Synechococcus sp. WH 8102
NoYes   Synechococcus sp. WH 7803
NoYes   Synechococcus sp. PCC 7002
NoYes   Synechococcus elongatus PCC 6301
NoYes   Prochlorococcus marinus str. NATL1A
NoYes   Prochlorococcus marinus str. MIT 9301
NoYes   Prochlorococcus marinus str. AS9601
NoYes   Prochlorococcus marinus subsp. pastoris str. CCMP1986
NoYes   Prochlorococcus marinus str. MIT 9215
NoYes   Prochlorococcus marinus str. MIT 9313
NoYes   Prochlorococcus marinus str. MIT 9312
NoYes   Prochlorococcus marinus str. MIT 9303
NoYes   Prochlorococcus marinus str. NATL2A
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Mesoplasma florum W37
NoYes   Spiroplasma syrphidicola EA-1
NoYes   Spiroplasma diminutum CUAS-1
NoYes   Spiroplasma chrysopicola DF-1
NoYes   Mycoplasma leachii PG50
NoYes   Mycoplasma mycoides subsp. mycoides SC str. Gladysdale
NoYes   Mycoplasma cynos C142
NoYes   Mycoplasma bovis Hubei-1
NoYes   Mycoplasma bovis PG45
NoYes   Mycoplasma fermentans JER
NoYes   Mycoplasma fermentans PG18
NoYes   Mycoplasma agalactiae
NoYes   Mycoplasma hyorhinis SK76
NoYes   Mycoplasma hyorhinis MCLD
NoYes