SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Periplasmic binding protein-like II alignments in Pseudomonas fluorescens Pf0-1

These alignments are sequences aligned to the 0049987 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1us5a_                         a...................................................................
gi|77457042|ref|YP_346547.1|  lvfcsegspagfdpgqyttgtdfdasaetmfnrltqferggtavipglatkwdisddgltytfhlreg
gi|77457043|ref|YP_346548.1|  tlvycseaspagfdpsqytsgtdfdasaetvfnrltqfkrggtevepglatkwdvspdglqytfhlrq
gi|77457040|ref|YP_346545.1|  lvvcteaspegfdmvqyttavtadavaetifnrladfkpgttevipalaeswdisedgltytfhlrkg
gi|77461759|ref|YP_351266.1|  lsvcteaspegfdvvqynsltttnasadvlmnrlvdfdtasgkvvpsladswevstdglsyvfklhpq
gi|77458408|ref|YP_347913.1|  dapkggifrqagfggfdslnpfiskgvpaddigliydtlakqgldepfteygliaskiekapdnswvr
gi|77458409|ref|YP_347914.1|  apkggtlrvmafgtfdtlnpytfkgtspvttpnflqyginelneplmvgtgqyapsgdepassyglia
gi|77459295|ref|YP_348802.1|  apkggtmrrsaieighfdhvlpyidkgigvsqidgllysplaqrsldepytvyglvaqkmersddgls
gi|77459963|ref|YP_349470.1|  dapkggslsrasmeigqynyitpyadqgisvvqvndwvysplafrsldepytvyglvaqtmerdpdgl
gi|77459342|ref|YP_348849.1|  spkggtlrrsslesgpfdhlipyidkgtgvadidgwlyaplayrskdepysvyglvahrmeldadrrw
gi|77461625|ref|YP_351132.1|  gtvhiynwsdyigettladfqketgikpvydvfdsnetlegkllagrtgydvvvpsnhflgkqikaga
gi|77458344|ref|YP_347849.1|  dkvlrvynwsdyiapdtvkkfedetgirvtydvfdsnetlearllagksgydivvpsnsflakqikag
gi|77459054|ref|YP_348560.1|  pqvsvynwtdyigettladfqsssgikviydvfdsnetlegkllagrtgydvvvpsnhflarqvkaga
gi|77461852|ref|YP_351359.1|  ertlrvynwfdyitpkaledfkaqnsqtklvydifdtnealeaklltgnsgydvvvpsnvflakqiea
gi|77461626|ref|YP_351133.1|  dkvlhvynwsdyiapdtvanfeketgikvvydvfdsnetleakllagksgydivvpsnnflakqikag
gi|77459482|ref|YP_348989.1|  relrvynwadyilpsvpkdfaaksnikvtwdtfdtnesleaklltgnsgydlvvpsnqfldtqikagv
gi|77458902|ref|YP_348408.1|  dtvkvynwsdyiapdtaknfekasgigvtydvydsnetldgklmtgksgydvvfpsnhfmarqiegga
gi|77458800|ref|YP_348306.1|  ektlnlyswadyvapdtlqrfeketgihvrydtfdtsevletklltggsgydvvvpsssvlarglaag
gi|77459754|ref|YP_349261.1|  vhvynwydyiglntlhdfkrdsgiepvydtfdsaevlegklmtsrsgydvvvasnfslptlikagala
gi|77456422|ref|YP_345927.1|  ellnvsydp...........................................................
gi|77458599|ref|YP_348104.1|  dktlrlynwadyfaedtlskftae............................................
gi|77461708|ref|YP_351215.1|  reiriatrksalalwqaeyvkarleaahpgllvtlvpmvsrgdklldsplskiggkglfvkeletall
gi|77457818|ref|YP_347323.1|  aaptllnvs...........................................................
gi|77456295|ref|YP_345800.1|  tltvaatpvphaeilefv..................................................
gi|77458382|ref|YP_347887.1|  pvvnlyiwgeylapdtlknfeaktgirvvadhfdsletvetklltgrsgydlvltagqhlsraiesga
gi|77456253|ref|YP_345758.1|  afaescd.............................................................
gi|77461459|ref|YP_350966.1|  aepaqcstvnfsdvgwtditattattsvvlnalgyktkttmisvpvtyksladgknmdvflgnwmptm
gi|77456451|ref|YP_345956.1|  klvvaatpvphaeil.....................................................
gi|77459541|ref|YP_349048.1|  aaqtpihfadlnwesgslitdvlriivekgyglptdtlpgttitletalanndiqvigeewagrspvw
gi|77460565|ref|YP_350072.1|  aaektapihfgditwesgsfitevlrlivekgy...................................
gi|77461651|ref|YP_351158.1|  evvvyssridelikpvfdaytaktgvkikfitdkeaplmqrikaegenatadllltvdagnlwqaeqm
gi|77458865|ref|YP_348371.1|  tltiatvnnsdmirmqklsktfetehpdiklnwvvleenvlrqrlttdiatqggqfdvltigmyeaal
gi|77457833|ref|YP_347338.1|  ae..................................................................
gi|77459367|ref|YP_348874.1|  kqlffynwtdyypvdllakfeketgikvtmdgydsnetllaklqaggaaydvivpsqsimqtlikqdl
gi|77456472|ref|YP_345977.1|  glalsagllgqavageqlqqikdkgvinvglegtyppfsfv...........................
gi|77461451|ref|YP_350958.1|  adspscqn............................................................
gi|77456590|ref|YP_346095.1|  wcesgkpvkfaglnwesgmlltdv............................................
gi|77459062|ref|YP_348568.1|  lvvynaqhetltkawvagfteetgipvtvrngddtemgnqivqegaaspadvfltenspamvlvdnak
gi|77456597|ref|YP_346102.1|  sddasc..............................................................
gi|77456759|ref|YP_346264.1|  ltlyngqhkevgdaiakafeaktgihvnvrkgssnqlasqiieegdrspadviyteespplnnlgeqg
gi|77461836|ref|YP_351343.1|  ttgvsgnlssvgsdt.....................................................
gi|77459394|ref|YP_348901.1|  vtgggatlpaalykgsansilpanfsylgtgsgtgktafltnnsalfnttgsvhfagsdsilsaseis
gi|77458291|ref|YP_347796.1|  mkklvmfgalalsmlsltavaedakpi.........................................
gi|77460513|ref|YP_350020.1|  mkklvllgalalsvlslptfadekplkigieaayppfas.............................
gi|77456539|ref|YP_346044.1|  kkvflaaavtlafsagamaetlkmgieaayppfnnk................................
gi|77457194|ref|YP_346699.1|  mkkfplitglalsllacssafaaek...........................................
gi|77461588|ref|YP_351095.1|  aakteltvytaleaeqlksykeafekanpdveikwvrdstgiitakllaekdrpqadavwglaassla
gi|77459463|ref|YP_348970.1|  svnfvswggstqdaqkqawadpfskasgitvvqdgptdygklkamvesgnvqwdvvdveadfalraaa
gi|77456603|ref|YP_346108.1|  mkkylsmllvgvtalvavnaaqagaiddavkrgslkvgmdptympfemtn..................
gi|77460756|ref|YP_350263.1|  aaiaaalistpvfaaeltgtlkkikesgvitlghrdasipfsyiadas....................
gi|77458562|ref|YP_348067.1|  lrvaadpvphaqiltyiq..................................................
gi|77456465|ref|YP_345970.1|  lki.................................................................
gi|77457097|ref|YP_346602.1|  mltialskgrilddtlpllaeagivptenpdksrkliipttqedvrllivratdvptyvehgaadlgv
gi|77457032|ref|YP_346537.1|  irlgarvfteqtllaeitaqylrskgydaqitgglgsnlarsahetgqldmlweytgvslvaynhvte
gi|77459005|ref|YP_348511.1|  kdkivigeqnwtgaiaiqhilgeviksrldgdvsylagdvpvlfs.......................
gi|77461345|ref|YP_350852.1|  pdltvvsfggankaaqvkafyapweaagngkivageyngemakvkamvdtksvswdlvevespelsrg
gi|77457437|ref|YP_346942.1|  mkkalltlsalalcmaagsalakeykelrfgvdpsyapfesk..........................
gi|77459166|ref|YP_348672.1|  evqvavaanftapiqaiaadfekdtghklvaaygatgqfytqikngapfevflsaddttpeklekegd
gi|77460297|ref|YP_349804.1|  kvaylgpegtftqaaamk..................................................
gi|77459872|ref|YP_349379.1|  lriqgsntigaalgpalvegllqdqgllkvhsetpdtaneqrivgltaqgqrvvveiaahg.......
gi|77456456|ref|YP_345961.1|  takalfalplislallagcnkteepakpkvasestapagyldkikardklivgvftdkppf.......
gi|77461510|ref|YP_351017.1|  mqkitllgctlalvfgaqaqasevpltgtlgkvasansitlg..........................
gi|77459027|ref|YP_348533.1|  mktpthltlglalavscsaafagptldrvtqkgeltgvlmesyppfsflndqnql.............
gi|77459852|ref|YP_349359.1|  ikvvsetlttheyeskvlakafseitgiklthdllqegdvvekmqtvmqsdkniydgwvndsdligth
gi|77457275|ref|YP_346780.1|  egqldivawpgyiergesdka...............................................
gi|77461635|ref|YP_351142.1|  ....................................................................
gi|77459314|ref|YP_348821.1|  fvlaassavmgiaqaadskldsvlargklivgtgstnapwhfqgad......................
gi|77461680|ref|YP_351187.1|  llaalfaglmlsqapahadglddvvkrgtlkvavpqdfpp............................
gi|77459080|ref|YP_348586.1|  mknfvipavltslmscgvavaaelpasikekgeivvaimpnyppmdfkdpatnklt............
gi|77460591|ref|YP_350098.1|  kgsvevvhwwtsggekaavdvlkaq...........................................
gi|77460690|ref|YP_350197.1|  gktlrlltwsddtglaalrniaatfeaktgakviadrtgstsemvaklkaggdrpqydiitlagvgae
gi|77457351|ref|YP_346856.1|  tsepkgmlrmtcavaygerfivplvtrfmghypqlridieltnrqldlvhegldlairlgrlqdsrlv
gi|77457411|ref|YP_346916.1|  gslsvgatltign.......................................................
gi|77460131|ref|YP_349638.1|  vagplrigssvsfgrlhiasrlaeflqrfpqvqvdlqlsdqnldlvsegldvslrigelndsgmiarr
gi|77457661|ref|YP_347166.1|  elrgvlrvnapmsfglrrlgkliplfheqhpnielqlvlsdqqvdpvrggfdvtiriaslpdstmiar
gi|77458197|ref|YP_347702.1|  aeprgairvsaplsfalahlgcllppflqryrevtvevdlsdrpvdllgegydlalrigvledstlia
gi|77460696|ref|YP_350203.1|  prgllrisvstsfg......................................................
gi|77461371|ref|YP_350878.1|  lrlgvdaswppfefrd....................................................
gi|77459516|ref|YP_349023.1|  yle.................................................................
gi|77460858|ref|YP_350365.1|  deprgilrvtapltfgverlapalsefslqcpqvkldviltnrrpdllesgldvafrlghfdqsnlia
gi|77458661|ref|YP_348167.1|  gelsgrvrl...........................................................
gi|77459874|ref|YP_349381.1|  fnpsqavktyrismtdlteavilpplfqrlrrlaptviiesflskrret...................
gi|77461861|ref|YP_351368.1|  lqgqlklavessakyfvph.................................................
gi|77458589|ref|YP_348094.1|  lrgslrlaapmafsiryltpilssfavrypelrldiefddrhvnlh......................
gi|77460541|ref|YP_350048.1|  ltgriridmpnilarrlimpklpefmarhpnleleisstdrrvdllaegfdcvvrigaqpdqsvvarh
gi|77458304|ref|YP_347809.1|  rgrvtlaampsfagnllppil...............................................
gi|77461122|ref|YP_350629.1|  qepsgtlrisipttyahhrilpllpafrarfpqvkvdmhisnrnidfvgegydmairvraipdsglia
gi|77460036|ref|YP_349543.1|  ifcgllamagaaqaqepashldtiqqqgqlrvcttgdykpytf.........................
gi|77457913|ref|YP_347418.1|  aegavnsvgmpddwanwkgtwedlaknyglkhidtdmssaqeiakfaaekdnatadigdvgaafgpia
gi|77458663|ref|YP_348169.1|  prgkirvdigg.........................................................
gi|77456484|ref|YP_345989.1|  ltva................................................................
gi|77459913|ref|YP_349420.1|  hgnlrvslpqvhdlvmpvmnefmalypqieldldltdrmvdvveegfdavirtgkprdsrlm......
gi|77457200|ref|YP_346705.1|  tldavkkkgfvqcgvsdglpgfsvpds.........................................
gi|77461639|ref|YP_351146.1|  ltvgyq..............................................................
gi|77459501|ref|YP_349008.1|  kpsgnlritagrqacelvllpiaseflkiypdirlevvesdalldivasgfdagvrfgnrleadmvsm
gi|77459989|ref|YP_349496.1|  eptglvrinapvvfgqrhltpwlgrlcerypklqldiqqtdhyidplqegadllfrigplhdssmqar
gi|77459734|ref|YP_349241.1|  rqghvtvac...........................................................
gi|77459646|ref|YP_349153.1|  geleigmissvmvg......................................................
gi|77461911|ref|YP_351418.1|  qprgqltvtapvlfgelfvtpvmaryltqypdvsinallldrvvsmveegvdvavrigelpdsnqhai
gi|77458595|ref|YP_348100.1|  qpkgrlrvdvpsplanlilvpalpefcarypeiqidmgvsdrivdiidenvdcvvrggelrdqslmar
gi|77456947|ref|YP_346452.1|  psgrlrinaaspfmlhaivpyidefrrlypdiqlelnsndliidlleqstdvairigtladstlhars
gi|77460224|ref|YP_349731.1|  ekkg................................................................
gi|77458091|ref|YP_347596.1|  qwldqhpvvrvgavddfapltf..............................................
gi|77460407|ref|YP_349914.1|  theaeglvrvsvpkavgrfvihphmpeflrrypkvdvellledrqvdliddhvdlairitdrppaglv
gi|77458938|ref|YP_348444.1|  deiagtirlsipsdi.....................................................
gi|77458668|ref|YP_348174.1|  vltistlvsvaskwllprlpsfreahpdidvrisastewvd...........................
gi|77459515|ref|YP_349022.1|  gdqn................................................................
gi|77459029|ref|YP_348535.1|  prgtlrvhcvpglarhlvtgavlayrnefpdvtvdlmlsqrmpnlledqldvsiliartlpdsayvsq
gi|77458115|ref|YP_347620.1|  tgevtgrltlatshhiglhrlppllreytrryp...................................
gi|77458299|ref|YP_347804.1|  gepagvlkislpptfgidhmlpllpeflaryplirpewhfenrqvdliaegydvaidggfeltpgvva
gi|77459590|ref|YP_349097.1|  rgslrlamt...........................................................
gi|77459139|ref|YP_348645.1|  teglsgvlqlaapsdfgrnvllpwlddfkrehphiqlqlllndrhadlfretvdvalrfgvpsdstlv
gi|77461503|ref|YP_351010.1|  e...................................................................
gi|77457545|ref|YP_347050.1|  fdptsarrtfrlamsdygaalilpglirtlra....................................
gi|77456896|ref|YP_346401.1|  dqvsgilqlsapsdfgrnlllpwlddfqhehpkltvrlllgdriadlfrqpvdialrygepedsslva
gi|77457125|ref|YP_346630.1|  rgelrlglpll.........................................................
gi|77459733|ref|YP_349240.1|  ee..................................................................
gi|77456439|ref|YP_345944.1|  eiriavpdlsagtqhsg...................................................
gi|77457466|ref|YP_346971.1|  dmagpvrmtvpvslgetffdgllldfsqkypevqielelnnsyrdlsrdsfdlairtevanderlvak
gi|77458675|ref|YP_348181.1|  daqgrlrisvpvefgrqiiapqlgelldrhpgle..................................
gi|77457981|ref|YP_347486.1|  qpagtlkvsmgtvfgrlyivpllgeflkrfpainpdwhfdnrqvdligq...................
gi|77459375|ref|YP_348882.1|  glrgslkitaplaygrafldqvcdgflqqypqislqvdlcdefvnllesgydlalreghddlpgliar
gi|77458585|ref|YP_348090.1|  qpagslhicssfgfgrnhvapaisqlsracpkldirldvfdrvvdlvgegfdleilvgddlpgqhlar
gi|77461591|ref|YP_351098.1|  qvqgalriaatap.......................................................
gi|77458830|ref|YP_348336.1|  seprgrlrvssptglahemlpvvisnflgkypqvqlev..............................
gi|77458659|ref|YP_348165.1|  lg..................................................................
gi|77456943|ref|YP_346448.1|  gvkgqvrllcnttalseyl.................................................
gi|77459507|ref|YP_349014.1|  gsvnisfvgsa.........................................................
gi|77457171|ref|YP_346676.1|  qlkgtlritttvefalaqvvpalevfrqqqpqlnihlstssthadliserfdlairlgrmldsnlrav
gi|77456255|ref|YP_345760.1|  tqqqhevlqvatdfafaaywlmprlhrfheaypqvdvslvtsernhnmlrpdidvavlfgdgrfkqge
gi|77459383|ref|YP_348890.1|  y...................................................................
gi|77459504|ref|YP_349011.1|  slrlatlptfgskwllprlkdfytahpgmtvhlhsrietidfdtseidaaicvgggdwpgltahrlht
gi|77457677|ref|YP_347182.1|  qpagdfvlgtlystaai...................................................
gi|77458588|ref|YP_348093.1|  epggvlrvtcpttlleecvggiitrfmamhprvemhleasdrqvdvvaegvdlalrvrppplqdselv
gi|77457164|ref|YP_346669.1|  pagqlkvhtmtgigqhfvidaiaryrkthpdvtfdltmanrvpdlldegydvsivlarelpdsgfvsq
gi|77456645|ref|YP_346150.1|  gelkigftssapfnstipqaifsfrqrfpavhlnlremsstmvadalvdesievgimrplglpdslsv
gi|77461779|ref|YP_351286.1|  qltaplkvgaiytvgpylfphlipqlhrvapqmplyieenfthvl.......................
gi|77457277|ref|YP_346782.1|  tdqvagqlivgvtslvag..................................................
gi|77461152|ref|YP_350659.1|  g...................................................................
gi|77456556|ref|YP_346061.1|  lvlltenfppynmakngknfaqdeningiatdivremfkragitysltlrfpwervyklalenpgyga
gi|77460196|ref|YP_349703.1|  svvvneafapltffd.....................................................
gi|77459903|ref|YP_349410.1|  lavdapvhvlpqiarf....................................................
gi|77457685|ref|YP_347190.1|  elrgtlnlgvidstvsdkalpfaeaigaysqehpavhlhlsvmspyelqlgvqdnrldlaigafstrm
gi|77461155|ref|YP_350662.1|  agqidigcfetvaplylpqliag.............................................
gi|77457148|ref|YP_346653.1|  isgilrvrsipsflskwltprlprlqqrypdiqlrlvaedssvplhegdfdlaidlndgsypgllsta
gi|77457225|ref|YP_346730.1|  lrvvtrnspatyfqdrsget................................................
gi|77456777|ref|YP_346282.1|  getevlrvstpstfgarwlvprlkgwrlrhpsihldlcneqeaddllqgrsdlafyfgqgsrpgtecl
gi|77459007|ref|YP_348513.1|  pvgtlklnvpvpvarfllpdllarflrlypgvnvevvmdntfvdvnaggydagvryeeslardmi...
gi|77458947|ref|YP_348453.1|  lrlhsspsfgllwlmprleqfreshpdiqlnlscsyeslhfsrdkidvdirhgmpnwpsfevrtlrne
gi|77459604|ref|YP_349111.1|  dpgqlrrtf...........................................................
gi|77457540|ref|YP_347045.1|  gvrgyvrmlanlsaiiqflpedlrdftah.......................................
gi|77458467|ref|YP_347972.1|  vnvgaiasvqrsflpdalarfhqqcpec........................................
gi|77460123|ref|YP_349630.1|  dvvgkiriltvsgvqarhydefladfh.........................................
gi|77457570|ref|YP_347075.1|  cwtiyagwmpwe........................................................
gi|77456344|ref|YP_345849.1|  vielavvptfgtqwllprlkdfqlkhpevtv.....................................
gi|77457610|ref|YP_347115.1|  fdpavstmtfriglsddvefgllppllralrqeapsvvfvvqhvdywri...................
gi|77458181|ref|YP_347686.1|  ltgsvrvsttdslaidflipamaqlheqhpdvrvqldastqilslakreadiavrntrpdnpdliarr
gi|77459944|ref|YP_349451.1|  qyremltvgavgtfavgwllprladfqakhplidlrlstnnnrvdvaaegldyairfgagawhgieat
gi|77461472|ref|YP_350979.1|  lrlvfdvwppftddtlvngglatdivstalaragyasgyeqvpwa.......................
gi|77460767|ref|YP_350274.1|  aggtagrlhmaiechscfqwlmptidqfrdawpeveldl.............................
gi|77458891|ref|YP_348397.1|  fdpatstsvf..........................................................
gi|77460119|ref|YP_349626.1|  evigkvrlliisrifsdrfddfladfhrlyprvdlevdvmrssdivsalqektatlglslnrrpqprl
gi|77459497|ref|YP_349004.1|  eepqgafplgsle.......................................................
gi|77456366|ref|YP_345871.1|  ivylllnvv...........................................................
gi|77459144|ref|YP_348650.1|  rg..................................................................
gi|77456369|ref|YP_345874.1|  tlrrrfsirandffvgvyggklfdtldqlaphc...................................
gi|77457630|ref|YP_347135.1|  vgrvrigvmdtvihtwlsplvaqmtdly........................................
gi|77457486|ref|YP_346991.1|  tlrigllasfatlwla....................................................
gi|77460216|ref|YP_349723.1|  peglirvdapaafgrrhlapviadflvlypgldvqlhlidsfvdmdgsnlgkvdlvlragqmadtrlv
gi|77461386|ref|YP_350893.1|  rtla................................................................
gi|77458645|ref|YP_348151.1|  pvgrlkihtmsaignhyvidaiaryrdihptvmfdltltnrvpdlleegfdmsivlardlpdsgfvaq
gi|77459746|ref|YP_349253.1|  egglcigyienamhagvlpnalrvlrv.........................................
gi|77458091|ref|YP_347596.1|  qwlrahpvlrigaswpdyppfeltrkrheleg....................................
gi|77461610|ref|YP_351117.1|  flpglicllpllsplahaeliddvndrgelrialeantppfnfk........................
gi|77456717|ref|YP_346222.1|  gqeaqlrvaqdeampyqalvesfgalaeqfpslevqltsaaqgevsrklverradlgllfyhdeipea
gi|77456922|ref|YP_346427.1|  lsghvrmgctegfgsffitpqlshfvdaypaisvdilplphfislskreadivialerpehgpyvcck
gi|77458189|ref|YP_347694.1|  fdpatscdvfriglsddaefglfppll.........................................
gi|77461512|ref|YP_351019.1|  slrrapghslrigatpalalsllpp...........................................
gi|77458795|ref|YP_348301.1|  rsvtvglsdd..........................................................
gi|77459527|ref|YP_349034.1|  lqlltdnhpplhfmqgnqlagfgvdvvqalatqtgdrihlqqvpllralrmasdtpdtgvftvlrtde
gi|77460812|ref|YP_350319.1|  qgqrg...............................................................
gi|77458380|ref|YP_347885.1|  vlrlavtaelaqkwlmnrltdfyaryphitlhlyeqpidatapgedidlaitygtgpvdssayfvrpl
gi|77457256|ref|YP_346761.1|  vvvasvqyplylfqdehgqwsglnndvlk.......................................
gi|77458417|ref|YP_347922.1|  applriigtpplaqqllpqslaalrrclpdvpctllseptrdivrhlllrdsdlglslhdpqhpdidc
gi|77461348|ref|YP_350855.1|  aqhnelrvglvlqapyaqydrrlqrlsgan......................................
gi|77459904|ref|YP_349411.1|  tgrlevaadgphmvmpmlaslr..............................................
gi|77460196|ref|YP_349703.1|  vawahtrnelilgtsapdyppfdmtas.........................................
gi|77459579|ref|YP_349086.1|  gkir................................................................
gi|77456509|ref|YP_346014.1|  ligtlrlgvvplss......................................................
gi|77460531|ref|YP_350038.1|  vsgtvrltctdsvlqglllpalaqfmpnypalsielstsndfanlsrrdadialrltrtppehlvgre
gi|77458432|ref|YP_347937.1|  kisiaqqf............................................................
gi|77458685|ref|YP_348191.1|  fapatse.............................................................
gi|77456796|ref|YP_346301.1|  vdtlrpqrsgssltlsttaafaalwlvprlgrfyakhpninvrldthcevidlhqdasvdlvlrysld
gi|77456443|ref|YP_345948.1|  agelrfgcgpapaaglipraigsfigrypkarvhyqvddwqslskrllseefeffvadtrhfeadpdy
gi|77456440|ref|YP_345945.1|  gelhfgcgpapavklvpdavaqfinahpkvrtcfqvdnweklsralsreeieffiadirhfesdpnfq
gi|77461514|ref|YP_351021.1|  erfklgslysltvktvpqlimglkirrselnidlilgsnidllyklknmevdailvsldetvndpdce
gi|77457657|ref|YP_347162.1|  gweaevrlvvdaaypsarivraltafmpqsrgcrvrlreevls.........................
gi|77460336|ref|YP_349843.1|  lvvtgspdappylwqdpqnpkqlmg...........................................
gi|77458953|ref|YP_348459.1|  ygpimpvlkafeaafpfvdliirhpvhgdvselvssgeavlgvafsqpgypkelafqqlgklimlhvc
gi|77460693|ref|YP_350200.1|  pscvmrwllprllqwqrerpdvpvkltaslqhgvdfhreqfdaaviygsaphdspatlhlfdeqltpv
gi|77457612|ref|YP_347117.1|  fdpmaqpvtfnicapeyfeqlilprmlkrfdfddlpvmvnmhkfe.......................
gi|77458012|ref|YP_347517.1|  sainlgfmalsdc.......................................................
gi|77461737|ref|YP_351244.1|  ilrmkapstltmrwllarlsrfrhlqpgnevqltsawmdvdsvdfnnepfdcavllsdghfpldweas
gi|77459929|ref|YP_349436.1|  pneqqilfrvgvadvvpksivyrliaptmelseplritcredklerlladlaiqrldlvisdspmpsh
gi|77458950|ref|YP_348456.1|  dqpegllrissadwfachvlspvlselvhryplivpeviaghrlfdlarrdadiafrivpftepdivh
gi|77458596|ref|YP_348101.1|  qlvlnttpafarhwllprlgdfrrqhpqvdlwifstdevpdmatqtidlavrddissqaecsfkvlha
gi|77460559|ref|YP_350066.1|  lesklsigvaadidrrrllaaikdlserhpll....................................
gi|77460164|ref|YP_349671.1|  aqvvrvgaahfppytirpen................................................
gi|77460025|ref|YP_349532.1|  lrigmpedfdarrmali...................................................
gi|77458799|ref|YP_348305.1|  gevrlglse...........................................................
gi|77459649|ref|YP_349156.1|  aqrltldvdselaqswlnprlpqlldglpdyevtilsmprsdrstlervnlllrygygdwddcemtqi
gi|77456330|ref|YP_345835.1|  pfvlgcsgsllarwfiprlgrlnadlpdlrlhlsagegdldprrpgldalllfaeppwpadmqvyela
gi|77456912|ref|YP_346417.1|  hlrgeliigltdn.......................................................
gi|77458376|ref|YP_347881.1|  qlvgslrlglvplsnfnpvnyiq.............................................
gi|77460214|ref|YP_349721.1|  vgtvrigtpddyvmrflpgilsrfaqfypliqievhcestkqllqrtdldlsivtrepgneigqllrk
gi|77460544|ref|YP_350051.1|  qgvepkltvaisdtyqsdrfeaalvgfeqrypd...................................
gi|77461845|ref|YP_351352.1|  ggqgeviqvaaahslalg..................................................
gi|77458031|ref|YP_347536.1|  lrfviadswampmvqiergrptqgilydmmlslatqvgipaqfhvlprarvqnamehgevdvrcyaaq
gi|77460241|ref|YP_349748.1|  rvlrvlvnqsrnssgevqgqaigieyhrlrafeqyl................................
gi|77459350|ref|YP_348857.1|  gyhnvlhiggevslcnplmlswaaelrekipghalrmdirdgenllrqlelgvldaalvyqpeywpgl
gi|77461233|ref|YP_350740.1|  wedytaadghglgwd.....................................................
gi|77458508|ref|YP_348013.1|  gslafgvgpfpaamlmhqvvprlrldhpavtlrvevnnwqilearlraegieffvadirnftaesdll
gi|77460704|ref|YP_350211.1|  ldeeglperlrialnadslatwwaeavgdfcaeqhllldlivedqtvglkrmragevagclcaserpv
gi|77459076|ref|YP_348582.1|  splvaalrkinehspkvrfqlqstqldevergvvegrlvagivpvyqkreefdyyplyeersqaycav
gi|77459000|ref|YP_348506.1|  ktlqfaathslsftffprwlrsaengapi.......................................
gi|77458730|ref|YP_348236.1|  plirlavaesilhdilgrdliallrrnasvrleiialdselalravsadivlwlahgdtphpgptfat
gi|77460545|ref|YP_350052.1|  frgrenrapltlgiegdiaashieafvrmahqalpnllltleegchgdgrlaveemccedelflplwe
gi|77457580|ref|YP_347085.1|  gfdltcklaqsalv......................................................
gi|77456527|ref|YP_346032.1|  qrtlkvalnttlapdfnrrligrlievfpd......................................
gi|77457259|ref|YP_346764.1|  lptwaqakptliwllrdlppltifegpkkgqgvidqlmpmliagmpqyehtlmrvnrargtqmlhehp
gi|77460567|ref|YP_350074.1|  nhcsl...............................................................


                                                                                                    
                                                                                                    
d1us5a_                         ....................................................................
gi|77457042|ref|YP_346547.1|  vkfhttpyfkptrefnaddvlftfnrminkddpfrkayptefpyftdmgmdtnitkidkvddhtvkft
gi|77457043|ref|YP_346548.1|  nvkfhttdyftptrtfnaddvlftfqrlldpenafrkaypaesp........................
gi|77457040|ref|YP_346545.1|  vkfhtteyfkptrdmnaddvvwsfqrqldpnhpwhklssvgfpyfesmgfkellksvekvddntvkft
gi|77461759|ref|YP_351266.1|  vkfhttdyfkptreltaedvkfsfdrmldpanpwhkvaqsgfphaqsmqlpslikkidaldpltvrft
gi|77458408|ref|YP_347913.1|  fylrpeakfhdghpvraddvvfsfqtltkegspmyrgyyadveeviaedplkvlfkfkhtnnrelpli
gi|77458409|ref|YP_347914.1|  qsveysedrswvvfnlrpqahfhdgtpitaydvafsyrlllkeghplyrtalqevlrvdilnpqrirf
gi|77459295|ref|YP_348802.1|  lrffinpkarfadgkpitaedvrytydllmtqgslryrtqfadvkgveveapltvrfdfksnenrtlp
gi|77459963|ref|YP_349470.1|  wvrfnlnpearfadgtpitaedvrytfellmtkgslsyrqqyadvqdvliegprqirftfknnlnrtl
gi|77459342|ref|YP_348849.1|  lrfylnpkarfedgtpitaedvrytfelfttqgslkyrqqfrdvaevqvesptqvrfvfknnesrtlp
gi|77461625|ref|YP_351132.1|  fqkldkaqlpnysnldpvllkrleqndpgnlyavpylwgtngigynvdkvkavlgvdkidswsvlfep
gi|77458344|ref|YP_347849.1|  vyqtldksklpnwknlnpvllknasasdpdnahafpymwgsigigfnpdkvkevlgknaptnswdllf
gi|77459054|ref|YP_348560.1|  flkldrsqlpnwknldpkllallekndpgnehsvpylwgtngigynvdkvkqvlgidhidswavlfep
gi|77461852|ref|YP_351359.1|  gvfqpldrsqlpnwnhldpklmklieandpgnqfavpymygtiligfnpakvkaalgdnapvdswdli
gi|77461626|ref|YP_351133.1|  vyqeldkskltnwknldedllkavgdasdpgnkhafpymwgsigigynpakvkaalgidkidswdivf
gi|77459482|ref|YP_348989.1|  fqkldksklpnwshqdpallklldandpgnqygvpymvgtvligfnpakvkaalgenapvdswdlvfk
gi|77458902|ref|YP_348408.1|  lkkldksqlpnwknlnpvllkalqtndpgnehgfpylwgstgigynvakvkavlgdnapvdswdlifk
gi|77458800|ref|YP_348306.1|  alkeipheglkgyanldpdlleklaavdpgnrygvpytwgtlglgmnveavkqrlpdvplnsldllfr
gi|77459754|ref|YP_349261.1|  plprdqlpgwknldndllsklanndpgnqyavpylwgtngigynvdkvravlgekapvdswdlvfkee
gi|77456422|ref|YP_345927.1|  ....................................................................
gi|77458599|ref|YP_348104.1|  ....................................................................
gi|77461708|ref|YP_351215.1|  eneadiavhsmkdvpmdfpeglglfciceredprdafvsntyssldalpagsivgtsslrrqaqlltr
gi|77457818|ref|YP_347323.1|  ....................................................................
gi|77456295|ref|YP_345800.1|  ....................................................................
gi|77458382|ref|YP_347887.1|  iqtlnkqqlphfagvgdefrqhmavfdpgnryagiyawgttgvgyqeeavkqrlpdaprdswamlfdp
gi|77456253|ref|YP_345758.1|  ....................................................................
gi|77461459|ref|YP_350966.1|  endikayrdagtvetvrtnlkgakytlavpqaly..................................
gi|77456451|ref|YP_345956.1|  ....................................................................
gi|77459541|ref|YP_349048.1|  vkaeaegkvaslgdtvkgategwwvpeyvikgdpakgikplap.........................
gi|77460565|ref|YP_350072.1|  ....................................................................
gi|77461651|ref|YP_351158.1|  gilqpftsktidaniplqyrssshawtglslrartiaystervkpgelttyealadknwegrlclrta
gi|77458865|ref|YP_348371.1|  wgakgwlepmkdlpasyalddvfpsvreglsvkgslyalpfyaessityyrtdlfkdagltmperptw
gi|77457833|ref|YP_347338.1|  ....................................................................
gi|77459367|ref|YP_348874.1|  lleidaptlsnfqyvkgpfrdpsfdpgrkfsapylwgttgfsydsarvpggklddswkeffeprkelq
gi|77456472|ref|YP_345977.1|  ....................................................................
gi|77461451|ref|YP_350958.1|  ....................................................................
gi|77456590|ref|YP_346095.1|  ....................................................................
gi|77459062|ref|YP_348568.1|  lfapvapatleqvdaayrpahgqwvgiaarstvfvynpaklpekdlpkslmdlatpawkgrwaaspag
gi|77456597|ref|YP_346102.1|  ....................................................................
gi|77456759|ref|YP_346264.1|  llakaddatlavlpkeyvagngtwigvtarvrvvafnpklidekdlpksvldfadpqwqgkvgfvpts
gi|77461836|ref|YP_351343.1|  ....................................................................
gi|77459394|ref|YP_348901.1|  tyntnfgasygpliqlpsvatsvaipykksgqtalnltsaqlcdafsgakttwgallgtsdttpirvv
gi|77458291|ref|YP_347796.1|  ....................................................................
gi|77460513|ref|YP_350020.1|  ....................................................................
gi|77456539|ref|YP_346044.1|  ....................................................................
gi|77457194|ref|YP_346699.1|  ....................................................................
gi|77461588|ref|YP_351095.1|  ildqqgmlqsyapkdlgkiganyrdaanppawvgmdvwaaticfntveaekqglskpvswqdltkpey
gi|77459463|ref|YP_348970.1|  egllepldfkqiqrdkidprfvsdhgvgsfffsfvlgynegklgankpqdwsalfdtktfpgkralyk
gi|77456603|ref|YP_346108.1|  ....................................................................
gi|77460756|ref|YP_350263.1|  ....................................................................
gi|77458562|ref|YP_348067.1|  ....................................................................
gi|77456465|ref|YP_345970.1|  ....................................................................
gi|77457097|ref|YP_346602.1|  agkdvlmeytgqglyepldlqia.............................................
gi|77457032|ref|YP_346537.1|  kldsaqsyarvkeldakkglvwltpskfsntyalalpkkvaeeypqihtisqlndvlkaeaktnhlva
gi|77459005|ref|YP_348511.1|  ....................................................................
gi|77461345|ref|YP_350852.1|  cdedmfeqldpalfgksedyvkgaiqpcgvgffvwstvlaynadklktaptswadfwdtkkfpgkrgl
gi|77457437|ref|YP_346942.1|  ....................................................................
gi|77459166|ref|YP_348672.1|  tvkgsrftyaigtlalwsakegyvdakgdvlkknqyqhlsianpkaap....................
gi|77460297|ref|YP_349804.1|  ....................................................................
gi|77459872|ref|YP_349379.1|  ....................................................................
gi|77456456|ref|YP_345961.1|  ....................................................................
gi|77461510|ref|YP_351017.1|  ....................................................................
gi|77459027|ref|YP_348533.1|  ....................................................................
gi|77459852|ref|YP_349359.1|  frygktesitdlmanegknftsptldikdfigisfttapdgkiyqlpdqqfanlywfradwferadlk
gi|77457275|ref|YP_346780.1|  ....................................................................
gi|77461635|ref|YP_351142.1|  ....................................................................
gi|77459314|ref|YP_348821.1|  ....................................................................
gi|77461680|ref|YP_351187.1|  ....................................................................
gi|77459080|ref|YP_348586.1|  ....................................................................
gi|77460591|ref|YP_350098.1|  ....................................................................
gi|77460690|ref|YP_350197.1|  glaaagllekpdlnripnlidvpekyrtganghgigyllwcnslvystrtqkeapdsyaalwdadlap
gi|77457351|ref|YP_346856.1|  atrlaprrmylcaspsylerygrphslselgrhncligssdiwqleqngrefsqrvqgnwrcnsgq..
gi|77457411|ref|YP_346916.1|  ....................................................................
gi|77460131|ref|YP_349638.1|  igtthrltvatpdylrrhghpqspqdlaqhnclqfnllstqnlwtyekdgqhhdvriqgnaqsnnsea
gi|77457661|ref|YP_347166.1|  qlapaprimvaspayleragtpqtpqdlrshqclnygylqsgvslqlcngk.................
gi|77458197|ref|YP_347702.1|  rriasiervycaspaylaergapvrpedllghdclpyghgrsvqwrfnagqgkpllvnvtgrmrvnng
gi|77460696|ref|YP_350203.1|  ....................................................................
gi|77461371|ref|YP_350878.1|  ....................................................................
gi|77459516|ref|YP_349023.1|  ....................................................................
gi|77460858|ref|YP_350365.1|  rplidytltvcaspeyvarrgmpltpeelrqhdclsfaypagddwqsvekqwrlsgpdgeimvdvkgp
gi|77458661|ref|YP_348167.1|  ....................................................................
gi|77459874|ref|YP_349381.1|  ....................................................................
gi|77461861|ref|YP_351368.1|  ....................................................................
gi|77458589|ref|YP_348094.1|  ....................................................................
gi|77460541|ref|YP_350048.1|  lgdfsmincaspaylerygvpqtledlaqhrlvhyvgvlgsrs.........................
gi|77458304|ref|YP_347809.1|  ....................................................................
gi|77461122|ref|YP_350629.1|  rhledaalvmvaspdyl...................................................
gi|77460036|ref|YP_349543.1|  ....................................................................
gi|77457913|ref|YP_347418.1|  vkqgvvqpykpstwdqvpdwakdkdgnwalaytgtiafivnkkllhgsevp.................
gi|77458663|ref|YP_348169.1|  ....................................................................
gi|77456484|ref|YP_345989.1|  ....................................................................
gi|77459913|ref|YP_349420.1|  ....................................................................
gi|77457200|ref|YP_346705.1|  ....................................................................
gi|77461639|ref|YP_351146.1|  ....................................................................
gi|77459501|ref|YP_349008.1|  pigpnl..............................................................
gi|77459989|ref|YP_349496.1|  ilaphrfqvaaspaylkrygtpqhpddlarhqcl..................................
gi|77459734|ref|YP_349241.1|  ....................................................................
gi|77459646|ref|YP_349153.1|  ....................................................................
gi|77461911|ref|YP_351418.1|  rvgevrrvicgspeyfavhgrpahpqalagapvvatsaigqqrswpfmehgeligvkpeprl......
gi|77458595|ref|YP_348100.1|  kvadlqlgvyaapsylaragtpahpreledshhrvvg...............................
gi|77456947|ref|YP_346452.1|  lgcspllivaspayl.....................................................
gi|77460224|ref|YP_349731.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77460407|ref|YP_349914.1|  grqlltidhllcatpqylaehgtpthphdllnhsciylgetpsdarwkfk..................
gi|77458938|ref|YP_348444.1|  ....................................................................
gi|77458668|ref|YP_348174.1|  ....................................................................
gi|77459515|ref|YP_349022.1|  ....................................................................
gi|77459029|ref|YP_348535.1|  kigvshcvlaaspdylerhgtpttpdelsahqclllgtvdyvrdewqlkskag...............
gi|77458115|ref|YP_347620.1|  ....................................................................
gi|77458299|ref|YP_347804.1|  rplssaevlavaspaylagrtlprhpadladhqgivmrglrtgrlrqwqmhnetgeqasallnpsivl
gi|77459590|ref|YP_349097.1|  ....................................................................
gi|77459139|ref|YP_348645.1|  alpilpehrrvacaspayierhgtpqnpaelsehgallylrn..........................
gi|77461503|ref|YP_351010.1|  ....................................................................
gi|77457545|ref|YP_347050.1|  ....................................................................
gi|77456896|ref|YP_346401.1|  lpiaphnrrvlcaspaylarhgeplhleqlaqhncllymlggrvh.......................
gi|77457125|ref|YP_346630.1|  ....................................................................
gi|77459733|ref|YP_349240.1|  ....................................................................
gi|77456439|ref|YP_345944.1|  ....................................................................
gi|77457466|ref|YP_346971.1|  pllawqemtcaspeylerfgepltpqalaehrcllnshysgreewlyhqqhellrvrvsgpfasnhyn
gi|77458675|ref|YP_348181.1|  ....................................................................
gi|77457981|ref|YP_347486.1|  ....................................................................
gi|77459375|ref|YP_348882.1|  vvgsnrlalcgspeylarkglpvtpqtldqhewllyrhpllsrefwwaerdgqrlslaqpt.......
gi|77458585|ref|YP_348090.1|  klvsnrrvlcatpeylerrgtpqsledlkdhdclvlker.............................
gi|77461591|ref|YP_351098.1|  ....................................................................
gi|77458830|ref|YP_348336.1|  ....................................................................
gi|77458659|ref|YP_348165.1|  ....................................................................
gi|77456943|ref|YP_346448.1|  ....................................................................
gi|77459507|ref|YP_349014.1|  ....................................................................
gi|77457171|ref|YP_346676.1|  qlstfevfavaapglierfapvdtlavlesmptlghgrvpemtvsdpagtehiyqpkpgttaiv....
gi|77456255|ref|YP_345760.1|  shwlfseevfpvcspqllkdcslplpaqalmefpllhlrgenssnwfdwsglfralnistppapg...
gi|77459383|ref|YP_348890.1|  ....................................................................
gi|77459504|ref|YP_349011.1|  eelvviasaqlsdae.....................................................
gi|77457677|ref|YP_347182.1|  ....................................................................
gi|77458588|ref|YP_348093.1|  srvlsqrpqclvaspallsrlgepsepedlsrfpsahhgspq..........................
gi|77457164|ref|YP_346669.1|  rlgitysivcaspayvkangcaqkpsdllnhaclrlvspviplekwa.....................
gi|77456645|ref|YP_346150.1|  velmreplvavlsskhplaqgseeglflsalalepfvffprsygsglysqlislardagfsphfaqea
gi|77461779|ref|YP_351286.1|  ....................................................................
gi|77457277|ref|YP_346782.1|  ....................................................................
gi|77461152|ref|YP_350659.1|  ....................................................................
gi|77456556|ref|YP_346061.1|  fvmarlpdrek.........................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459903|ref|YP_349410.1|  ....................................................................
gi|77457685|ref|YP_347190.1|  sglvymplyreqhwlycssrhplfnerripeqvitqqrmvgrgywsqaelarhgfkhsaatvesmeaq
gi|77461155|ref|YP_350662.1|  ....................................................................
gi|77457148|ref|YP_346653.1|  lldeqifpvcapgllrgrpplhgpadlvhfpllhditawrgsyeyaewefylnaigfegad.......
gi|77457225|ref|YP_346730.1|  ....................................................................
gi|77456777|ref|YP_346282.1|  klfgeelvpvcapgslpdtpltdptqltdlvllqnasrpqawhdwfdsqgyqtehsyhgprfetfymc
gi|77459007|ref|YP_348513.1|  ....................................................................
gi|77458947|ref|YP_348453.1|  kiavlaspkllek.......................................................
gi|77459604|ref|YP_349111.1|  ....................................................................
gi|77457540|ref|YP_347045.1|  ....................................................................
gi|77458467|ref|YP_347972.1|  ....................................................................
gi|77460123|ref|YP_349630.1|  ....................................................................
gi|77457570|ref|YP_347075.1|  ....................................................................
gi|77456344|ref|YP_345849.1|  ....................................................................
gi|77457610|ref|YP_347115.1|  ....................................................................
gi|77458181|ref|YP_347686.1|  iarwpvglfasqayvdshgvpapgssfeghdlvvyepylqgnkdltlvsep.................
gi|77459944|ref|YP_349451.1|  rlleaplsvlcvpeiarqlhtpgdllqqrllrsyrt................................
gi|77461472|ref|YP_350979.1|  ....................................................................
gi|77460767|ref|YP_350274.1|  ....................................................................
gi|77458891|ref|YP_348397.1|  ....................................................................
gi|77460119|ref|YP_349626.1|  eqrlflrqryaffcgkhhalfgrqdi..........................................
gi|77459497|ref|YP_349004.1|  ....................................................................
gi|77456366|ref|YP_345871.1|  ....................................................................
gi|77459144|ref|YP_348650.1|  ....................................................................
gi|77456369|ref|YP_345874.1|  ....................................................................
gi|77457630|ref|YP_347135.1|  ....................................................................
gi|77457486|ref|YP_346991.1|  ....................................................................
gi|77460216|ref|YP_349723.1|  atplasmvriacaspdylkr................................................
gi|77461386|ref|YP_350893.1|  ....................................................................
gi|77458645|ref|YP_348151.1|  rlgitysilcaspayvakrglpqtpgelceheclrivntvmpvenwtfegpegme.............
gi|77459746|ref|YP_349253.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77461610|ref|YP_351117.1|  ....................................................................
gi|77456717|ref|YP_346222.1|  lerrvlgsvemvtvcgvnhplasqa...........................................
gi|77456922|ref|YP_346427.1|  lcdyrlqlyatqeyldkhppirrpadlgkhqfisyvdd..............................
gi|77458189|ref|YP_347694.1|  ....................................................................
gi|77461512|ref|YP_351019.1|  ....................................................................
gi|77458795|ref|YP_348301.1|  ....................................................................
gi|77459527|ref|YP_349034.1|  rddryqwvgplievetalyardnlqppvhslreadhlgritvprkwlvysylqgqdlnnlygvetpe.
gi|77460812|ref|YP_350319.1|  ....................................................................
gi|77458380|ref|YP_347885.1|  palqffpvcspglfnqgilktpkdlarhcllhddqdgktwtawltshagdlrper.............
gi|77457256|ref|YP_346761.1|  ....................................................................
gi|77458417|ref|YP_347922.1|  qplaqgklqllaphgwlqpkqkyislqdlagqamvglegqdplspalenklqalrpaptiqtrvqthq
gi|77461348|ref|YP_350855.1|  ....................................................................
gi|77459904|ref|YP_349411.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459579|ref|YP_349086.1|  ....................................................................
gi|77456509|ref|YP_346014.1|  ....................................................................
gi|77460531|ref|YP_350038.1|  lakisyrvcasq........................................................
gi|77458432|ref|YP_347937.1|  ....................................................................
gi|77458685|ref|YP_348191.1|  ....................................................................
gi|77456796|ref|YP_346301.1|  dypnlyglclfdesfgvygspeqvalaarrtpal..................................
gi|77456443|ref|YP_345948.1|  lthrlrprkwhfccraghplgafervtaeqlmsyplavsirppnlrkvivdlsgrpdfvpnvecensa
gi|77456440|ref|YP_345945.1|  tqpltpkrgvffcrpghpllakeslstndmfdyplattlippgirkllanl.................
gi|77461514|ref|YP_351021.1|  q...................................................................
gi|77457657|ref|YP_347162.1|  ....................................................................
gi|77460336|ref|YP_349843.1|  ....................................................................
gi|77458953|ref|YP_348459.1|  hprhplaqldnvtfedlhvhrrlafsahasklpsseylrst...........................
gi|77460693|ref|YP_350200.1|  csptllnggpalhtpadlqqhlllhpt.........................................
gi|77457612|ref|YP_347117.1|  ....................................................................
gi|77458012|ref|YP_347517.1|  ....................................................................
gi|77461737|ref|YP_351244.1|  llfpeelipvgapnllndqpwdvarlasaellhptpdrrdwrswlehmglsdqvslkggqvfdtl...
gi|77459929|ref|YP_349436.1|  ldikgysqklgecgisffataelaaqygqdfprslhgapllipgae......................
gi|77458950|ref|YP_348456.1|  rklttlsyglyaashaptpqpdgeglglilmniaq.................................
gi|77458596|ref|YP_348101.1|  drlypachpsllsvpsaqrttlhgeremdwshwavesgidvgqqdqglnfsdpgllldaacgglgial
gi|77460559|ref|YP_350066.1|  ....................................................................
gi|77460164|ref|YP_349671.1|  ....................................................................
gi|77460025|ref|YP_349532.1|  ....................................................................
gi|77458799|ref|YP_348305.1|  ....................................................................
gi|77459649|ref|YP_349156.1|  cgdrvlavaspallerhglqvplspaqilelpllgy................................
gi|77456330|ref|YP_345835.1|  serigpvmsplfsgyqrlqsappialldepllhttsrpqawpswaqqsgldakalklgq.........
gi|77456912|ref|YP_346417.1|  ....................................................................
gi|77458376|ref|YP_347881.1|  ....................................................................
gi|77460214|ref|YP_349721.1|  erfvwaeaqnfsaheqtplplamfnsdcfcrlwacnaldamgreyriaynstslsalm..........
gi|77460544|ref|YP_350051.1|  ....................................................................
gi|77461845|ref|YP_351352.1|  ....................................................................
gi|77458031|ref|YP_347536.1|  swlpnqsgdyiwsipllfqrdllisrqdqppsadpahlprqsigtvlgysyptlqpifdadrlwreda
gi|77460241|ref|YP_349748.1|  ....................................................................
gi|77459350|ref|YP_348857.1|  qveqvleeklilvttpgrpapyvyidwgpdfrrqhdaalpekakaalsfnlgplalqyilenggsgyf
gi|77461233|ref|YP_350740.1|  ....................................................................
gi|77458508|ref|YP_348013.1|  irslgqvsagf.........................................................
gi|77460704|ref|YP_350211.1|  agarsvllgamryralaspafikrhfpdgvraeqlprtpalvfgpddflqhrylas............
gi|77459076|ref|YP_348582.1|  ghplfempaeqmggnvlqdyecinhryaihrdklnfarydsfsasatqveavalliktgrfvgflp..
gi|77459000|ref|YP_348506.1|  ....................................................................
gi|77458730|ref|YP_348236.1|  sep.................................................................
gi|77460545|ref|YP_350052.1|  esyvmalpldhpmanaqagwapiedwitcpqhps..................................
gi|77457580|ref|YP_347085.1|  ....................................................................
gi|77456527|ref|YP_346032.1|  ....................................................................
gi|77457259|ref|YP_346764.1|  facdpsliwnkeraqwiafsipafravsnglvvrqrdrevlepflve.....................
gi|77460567|ref|YP_350074.1|  ....................................................................


                                                                                                    
                                                                                                    
d1us5a_                         ....................................................................
gi|77457042|ref|YP_346547.1|  lkevdaafiqnmamsfasvqsaeyaaqllkegkaadinqkpigtgpfvfksyqkdsnirytgnphywd
gi|77457043|ref|YP_346548.1|  ....................................................................
gi|77457040|ref|YP_346545.1|  ltrreapfladiamafssiypaeyadqllkanktgdlnnkpvgtgpfifqryakdaqvrfkanpdyfr
gi|77461759|ref|YP_351266.1|  ldhpdstflatlsmgfasiysaeyadkllkagatdklnsqpvgtgpfvftrfqkdasirykanpdyvr
gi|77458408|ref|YP_347913.1|  lgqlpvlpkhwwaerdfnkgnleiplgsgpykvtqvkagrsvryervkdywgkdlpvnrgfynfdvmt
gi|77458409|ref|YP_347914.1|  vlkrsgnpllilrlgelpvlpqhywkgrdfkattfepplgsgpyritsvtpgrqlifervkdywgkdl
gi|77459295|ref|YP_348802.1|  ldiatlpvfpehwwktrdfaggggyepplgsgpyrvgkvdsgrsitfernpdwwgkdlpvsrglynfd
gi|77459963|ref|YP_349470.1|  aldlaslrpvpehwwktrdfangggfepplgsgpyrvskvdagrsisfqrdphwwgkdlpvsrgmynf
gi|77459342|ref|YP_348849.1|  ldlatlpvlpehwwrtrnfadgagfeippgsgpykvsavdagrsvkfqrikdwwgrdlpitrglynfd
gi|77461625|ref|YP_351132.1|  enikklhscgvafldsademmptvlnymglnanstnpkdyekatakllavrpyvtyf...........
gi|77458344|ref|YP_347849.1|  kpenaeklkacgisfldsptemipaalhylgypvsdkdaahikeaealfmkirpn.............
gi|77459054|ref|YP_348560.1|  enlkkltqcgvsmmdsadevfpailnymgmdprsekpedykkaeekllsirpyi..............
gi|77461852|ref|YP_351359.1|  fkeenisklkqcgvalldspseilplalqhlgldpnsknpady.........................
gi|77461626|ref|YP_351133.1|  kpenieklkscgvsfldaptemipaalhylgkptnskdkadlkaaedlflkirps.............
gi|77459482|ref|YP_348989.1|  penmeklkscgvamldspseilplalhylgldpnsqnpadyekakdlmlkvrp...............
gi|77458902|ref|YP_348408.1|  peymeklqkcgvaildngpellpaalnylglphhsknpedykkaeallmkvrpyvs............
gi|77458800|ref|YP_348306.1|  peyasklkdcgiaildspqeviglalhylgkdpystdksdlaaaeallqk..................
gi|77459754|ref|YP_349261.1|  nlaklgecgvamldspsemlpvalhylglppnstnaedyqkaealllklrp.................
gi|77456422|ref|YP_345927.1|  ....................................................................
gi|77458599|ref|YP_348104.1|  ....................................................................
gi|77461708|ref|YP_351215.1|  rpdl................................................................
gi|77457818|ref|YP_347323.1|  ....................................................................
gi|77456295|ref|YP_345800.1|  ....................................................................
gi|77458382|ref|YP_347887.1|  avvskfadcgvsllndpnevfaavmkymgldinrqslddlklaeqqlakirpy...............
gi|77456253|ref|YP_345758.1|  ....................................................................
gi|77461459|ref|YP_350966.1|  ....................................................................
gi|77456451|ref|YP_345956.1|  ....................................................................
gi|77459541|ref|YP_349048.1|  ....................................................................
gi|77460565|ref|YP_350072.1|  ....................................................................
gi|77461651|ref|YP_351158.1|  kkvynqsltatmievhgaekteqilkgwvnn.....................................
gi|77458865|ref|YP_348371.1|  eqiagfaekltnkdkeqygiclrgkagwgenmalittvanaygarwfdeqwkpefsgpewknalnfyv
gi|77457833|ref|YP_347338.1|  ....................................................................
gi|77459367|ref|YP_348874.1|  gqlaaldtsssvinaashylnvdectenpqeakrilellqkqkpfl......................
gi|77456472|ref|YP_345977.1|  ....................................................................
gi|77461451|ref|YP_350958.1|  ....................................................................
gi|77456590|ref|YP_346095.1|  ....................................................................
gi|77459062|ref|YP_348568.1|  adfqai..............................................................
gi|77456597|ref|YP_346102.1|  ....................................................................
gi|77456759|ref|YP_346264.1|  gafqeqavaiikkhgreaaeewltglrafg......................................
gi|77461836|ref|YP_351343.1|  ....................................................................
gi|77459394|ref|YP_348901.1|  yrnvssgtteiltrhlnsicptkfatnstfasarlpagstl...........................
gi|77458291|ref|YP_347796.1|  ....................................................................
gi|77460513|ref|YP_350020.1|  ....................................................................
gi|77456539|ref|YP_346044.1|  ....................................................................
gi|77457194|ref|YP_346699.1|  ....................................................................
gi|77461588|ref|YP_351095.1|  kgkivmpnpassgtgfldvsawlqtfgekqgwaymdglhqnigqyv......................
gi|77459463|ref|YP_348970.1|  wpspgvlelalladgvaadklypldl..........................................
gi|77456603|ref|YP_346108.1|  ....................................................................
gi|77460756|ref|YP_350263.1|  ....................................................................
gi|77458562|ref|YP_348067.1|  ....................................................................
gi|77456465|ref|YP_345970.1|  ....................................................................
gi|77457097|ref|YP_346602.1|  ....................................................................
gi|77457032|ref|YP_346537.1|  ldtefanrsdgldg......................................................
gi|77459005|ref|YP_348511.1|  ....................................................................
gi|77461345|ref|YP_350852.1|  rkgakytlefalmadgvapkdvykelaskggq....................................
gi|77457437|ref|YP_346942.1|  ....................................................................
gi|77459166|ref|YP_348672.1|  ....................................................................
gi|77460297|ref|YP_349804.1|  ....................................................................
gi|77459872|ref|YP_349379.1|  ....................................................................
gi|77456456|ref|YP_345961.1|  ....................................................................
gi|77461510|ref|YP_351017.1|  ....................................................................
gi|77459027|ref|YP_348533.1|  ....................................................................
gi|77459852|ref|YP_349359.1|  akfkekygyelgvpvnwsayediakffsedvkeidgkriyghmdygkkdpslgwrftdawfsmagggd
gi|77457275|ref|YP_346780.1|  ....................................................................
gi|77461635|ref|YP_351142.1|  ....................................................................
gi|77459314|ref|YP_348821.1|  ....................................................................
gi|77461680|ref|YP_351187.1|  ....................................................................
gi|77459080|ref|YP_348586.1|  ....................................................................
gi|77460591|ref|YP_350098.1|  ....................................................................
gi|77460690|ref|YP_350197.1|  niflpppnwteamdliiia.................................................
gi|77457351|ref|YP_346856.1|  ....................................................................
gi|77457411|ref|YP_346916.1|  ....................................................................
gi|77460131|ref|YP_349638.1|  iremvlgglgvslspvwl..................................................
gi|77457661|ref|YP_347166.1|  ....................................................................
gi|77458197|ref|YP_347702.1|  ell.................................................................
gi|77460696|ref|YP_350203.1|  ....................................................................
gi|77461371|ref|YP_350878.1|  ....................................................................
gi|77459516|ref|YP_349023.1|  ....................................................................
gi|77460858|ref|YP_350365.1|  mlinssaglhqaartgmg..................................................
gi|77458661|ref|YP_348167.1|  ....................................................................
gi|77459874|ref|YP_349381.1|  ....................................................................
gi|77461861|ref|YP_351368.1|  ....................................................................
gi|77458589|ref|YP_348094.1|  ....................................................................
gi|77460541|ref|YP_350048.1|  ....................................................................
gi|77458304|ref|YP_347809.1|  ....................................................................
gi|77461122|ref|YP_350629.1|  ....................................................................
gi|77460036|ref|YP_349543.1|  ....................................................................
gi|77457913|ref|YP_347418.1|  ....................................................................
gi|77458663|ref|YP_348169.1|  ....................................................................
gi|77456484|ref|YP_345989.1|  ....................................................................
gi|77459913|ref|YP_349420.1|  ....................................................................
gi|77457200|ref|YP_346705.1|  ....................................................................
gi|77461639|ref|YP_351146.1|  ....................................................................
gi|77459501|ref|YP_349008.1|  ....................................................................
gi|77459989|ref|YP_349496.1|  ....................................................................
gi|77459734|ref|YP_349241.1|  ....................................................................
gi|77459646|ref|YP_349153.1|  ....................................................................
gi|77461911|ref|YP_351418.1|  ....................................................................
gi|77458595|ref|YP_348100.1|  ....................................................................
gi|77456947|ref|YP_346452.1|  ....................................................................
gi|77460224|ref|YP_349731.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77460407|ref|YP_349914.1|  ....................................................................
gi|77458938|ref|YP_348444.1|  ....................................................................
gi|77458668|ref|YP_348174.1|  ....................................................................
gi|77459515|ref|YP_349022.1|  ....................................................................
gi|77459029|ref|YP_348535.1|  ....................................................................
gi|77458115|ref|YP_347620.1|  ....................................................................
gi|77458299|ref|YP_347804.1|  ndpmamrkaallglgvtmlvlpdvsaqi........................................
gi|77459590|ref|YP_349097.1|  ....................................................................
gi|77459139|ref|YP_348645.1|  ....................................................................
gi|77461503|ref|YP_351010.1|  ....................................................................
gi|77457545|ref|YP_347050.1|  ....................................................................
gi|77456896|ref|YP_346401.1|  ....................................................................
gi|77457125|ref|YP_346630.1|  ....................................................................
gi|77459733|ref|YP_349240.1|  ....................................................................
gi|77456439|ref|YP_345944.1|  ....................................................................
gi|77457466|ref|YP_346971.1|  llkk................................................................
gi|77458675|ref|YP_348181.1|  ....................................................................
gi|77457981|ref|YP_347486.1|  ....................................................................
gi|77459375|ref|YP_348882.1|  ....................................................................
gi|77458585|ref|YP_348090.1|  ....................................................................
gi|77461591|ref|YP_351098.1|  ....................................................................
gi|77458830|ref|YP_348336.1|  ....................................................................
gi|77458659|ref|YP_348165.1|  ....................................................................
gi|77456943|ref|YP_346448.1|  ....................................................................
gi|77459507|ref|YP_349014.1|  ....................................................................
gi|77457171|ref|YP_346676.1|  ....................................................................
gi|77456255|ref|YP_345760.1|  ....................................................................
gi|77459383|ref|YP_348890.1|  ....................................................................
gi|77459504|ref|YP_349011.1|  ....................................................................
gi|77457677|ref|YP_347182.1|  ....................................................................
gi|77458588|ref|YP_348093.1|  ....................................................................
gi|77457164|ref|YP_346669.1|  ....................................................................
gi|77456645|ref|YP_346150.1|  geamtii.............................................................
gi|77461779|ref|YP_351286.1|  ....................................................................
gi|77457277|ref|YP_346782.1|  ....................................................................
gi|77461152|ref|YP_350659.1|  ....................................................................
gi|77456556|ref|YP_346061.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459903|ref|YP_349410.1|  ....................................................................
gi|77457685|ref|YP_347190.1|  lilvlsgayigy........................................................
gi|77461155|ref|YP_350662.1|  ....................................................................
gi|77457148|ref|YP_346653.1|  ....................................................................
gi|77457225|ref|YP_346730.1|  ....................................................................
gi|77456777|ref|YP_346282.1|  iraaqv..............................................................
gi|77459007|ref|YP_348513.1|  ....................................................................
gi|77458947|ref|YP_348453.1|  ....................................................................
gi|77459604|ref|YP_349111.1|  ....................................................................
gi|77457540|ref|YP_347045.1|  ....................................................................
gi|77458467|ref|YP_347972.1|  ....................................................................
gi|77460123|ref|YP_349630.1|  ....................................................................
gi|77457570|ref|YP_347075.1|  ....................................................................
gi|77456344|ref|YP_345849.1|  ....................................................................
gi|77457610|ref|YP_347115.1|  ....................................................................
gi|77458181|ref|YP_347686.1|  ....................................................................
gi|77459944|ref|YP_349451.1|  ....................................................................
gi|77461472|ref|YP_350979.1|  ....................................................................
gi|77460767|ref|YP_350274.1|  ....................................................................
gi|77458891|ref|YP_348397.1|  ....................................................................
gi|77460119|ref|YP_349626.1|  ....................................................................
gi|77459497|ref|YP_349004.1|  ....................................................................
gi|77456366|ref|YP_345871.1|  ....................................................................
gi|77459144|ref|YP_348650.1|  ....................................................................
gi|77456369|ref|YP_345874.1|  ....................................................................
gi|77457630|ref|YP_347135.1|  ....................................................................
gi|77457486|ref|YP_346991.1|  ....................................................................
gi|77460216|ref|YP_349723.1|  ....................................................................
gi|77461386|ref|YP_350893.1|  ....................................................................
gi|77458645|ref|YP_348151.1|  ....................................................................
gi|77459746|ref|YP_349253.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77461610|ref|YP_351117.1|  ....................................................................
gi|77456717|ref|YP_346222.1|  ....................................................................
gi|77456922|ref|YP_346427.1|  ....................................................................
gi|77458189|ref|YP_347694.1|  ....................................................................
gi|77461512|ref|YP_351019.1|  ....................................................................
gi|77458795|ref|YP_348301.1|  ....................................................................
gi|77459527|ref|YP_349034.1|  ....................................................................
gi|77460812|ref|YP_350319.1|  ....................................................................
gi|77458380|ref|YP_347885.1|  ....................................................................
gi|77457256|ref|YP_346761.1|  ....................................................................
gi|77458417|ref|YP_347922.1|  mmrsmveagegl........................................................
gi|77461348|ref|YP_350855.1|  ....................................................................
gi|77459904|ref|YP_349411.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459579|ref|YP_349086.1|  ....................................................................
gi|77456509|ref|YP_346014.1|  ....................................................................
gi|77460531|ref|YP_350038.1|  ....................................................................
gi|77458432|ref|YP_347937.1|  ....................................................................
gi|77458685|ref|YP_348191.1|  ....................................................................
gi|77456796|ref|YP_346301.1|  ....................................................................
gi|77456443|ref|YP_345948.1|  sllgvvlrs...........................................................
gi|77456440|ref|YP_345945.1|  ....................................................................
gi|77461514|ref|YP_351021.1|  ....................................................................
gi|77457657|ref|YP_347162.1|  ....................................................................
gi|77460336|ref|YP_349843.1|  ....................................................................
gi|77458953|ref|YP_348459.1|  ....................................................................
gi|77460693|ref|YP_350200.1|  ....................................................................
gi|77457612|ref|YP_347117.1|  ....................................................................
gi|77458012|ref|YP_347517.1|  ....................................................................
gi|77461737|ref|YP_351244.1|  ....................................................................
gi|77459929|ref|YP_349436.1|  ....................................................................
gi|77458950|ref|YP_348456.1|  ....................................................................
gi|77458596|ref|YP_348101.1|  vsqllsrkara.........................................................
gi|77460559|ref|YP_350066.1|  ....................................................................
gi|77460164|ref|YP_349671.1|  ....................................................................
gi|77460025|ref|YP_349532.1|  ....................................................................
gi|77458799|ref|YP_348305.1|  ....................................................................
gi|77459649|ref|YP_349156.1|  ....................................................................
gi|77456330|ref|YP_345835.1|  ....................................................................
gi|77456912|ref|YP_346417.1|  ....................................................................
gi|77458376|ref|YP_347881.1|  ....................................................................
gi|77460214|ref|YP_349721.1|  ....................................................................
gi|77460544|ref|YP_350051.1|  ....................................................................
gi|77461845|ref|YP_351352.1|  ....................................................................
gi|77458031|ref|YP_347536.1|  rnqe................................................................
gi|77460241|ref|YP_349748.1|  ....................................................................
gi|77459350|ref|YP_348857.1|  rtrvvrtylesgalepvt..................................................
gi|77461233|ref|YP_350740.1|  ....................................................................
gi|77458508|ref|YP_348013.1|  ....................................................................
gi|77460704|ref|YP_350211.1|  ....................................................................
gi|77459076|ref|YP_348582.1|  ....................................................................
gi|77459000|ref|YP_348506.1|  ....................................................................
gi|77458730|ref|YP_348236.1|  ....................................................................
gi|77460545|ref|YP_350052.1|  ....................................................................
gi|77457580|ref|YP_347085.1|  ....................................................................
gi|77456527|ref|YP_346032.1|  ....................................................................
gi|77457259|ref|YP_346764.1|  ....................................................................
gi|77460567|ref|YP_350074.1|  ....................................................................


                                                                                                    
                                                                                                    
d1us5a_                         ....................................................................
gi|77457042|ref|YP_346547.1|  psrvklknlifaintdasvrvqklkagecqitlhprpadvpalkndpklqliekpgfnlgyiaynvrh
gi|77457043|ref|YP_346548.1|  ....................................................................
gi|77457040|ref|YP_346545.1|  gkapadalilaiatdnnvrlqklkanecqialypkpddipsikkdsnlkvdeldamtvsyvamntqhk
gi|77461759|ref|YP_351266.1|  gkpavdplifaitpdanvrlqklrrnecqialspkpldvqaakqeptlkvektdafmtafvginsqhp
gi|77458408|ref|YP_347913.1|  tdyyrd..............................................................
gi|77458409|ref|YP_347914.1|  pvnrgkynv...........................................................
gi|77459295|ref|YP_348802.1|  hfsieyfgdtdvarqvlrggaydynrefsatgysigyespalsdgrlqkahlateapqsaqgfvfnlq
gi|77459963|ref|YP_349470.1|  dsltvnfygdtdvarqllqagafdynrefsssgyvvgydspalrdgrlqqailapdkptcaqgfvfnl
gi|77459342|ref|YP_348849.1|  qlsveffadtdvsrqvlkaggfdynrefsatsytigyagaaleqgkllrehlapgaaqgaqgfafnlq
gi|77461625|ref|YP_351132.1|  ....................................................................
gi|77458344|ref|YP_347849.1|  ....................................................................
gi|77459054|ref|YP_348560.1|  ....................................................................
gi|77461852|ref|YP_351359.1|  ....................................................................
gi|77461626|ref|YP_351133.1|  ....................................................................
gi|77459482|ref|YP_348989.1|  ....................................................................
gi|77458902|ref|YP_348408.1|  ....................................................................
gi|77458800|ref|YP_348306.1|  ....................................................................
gi|77459754|ref|YP_349261.1|  ....................................................................
gi|77456422|ref|YP_345927.1|  ....................................................................
gi|77458599|ref|YP_348104.1|  ....................................................................
gi|77461708|ref|YP_351215.1|  ....................................................................
gi|77457818|ref|YP_347323.1|  ....................................................................
gi|77456295|ref|YP_345800.1|  ....................................................................
gi|77458382|ref|YP_347887.1|  ....................................................................
gi|77456253|ref|YP_345758.1|  ....................................................................
gi|77461459|ref|YP_350966.1|  ....................................................................
gi|77456451|ref|YP_345956.1|  ....................................................................
gi|77459541|ref|YP_349048.1|  ....................................................................
gi|77460565|ref|YP_350072.1|  ....................................................................
gi|77461651|ref|YP_351158.1|  ....................................................................
gi|77458865|ref|YP_348371.1|  dtmkksgppgass.......................................................
gi|77457833|ref|YP_347338.1|  ....................................................................
gi|77459367|ref|YP_348874.1|  ....................................................................
gi|77456472|ref|YP_345977.1|  ....................................................................
gi|77461451|ref|YP_350958.1|  ....................................................................
gi|77456590|ref|YP_346095.1|  ....................................................................
gi|77459062|ref|YP_348568.1|  ....................................................................
gi|77456597|ref|YP_346102.1|  ....................................................................
gi|77456759|ref|YP_346264.1|  ....................................................................
gi|77461836|ref|YP_351343.1|  ....................................................................
gi|77459394|ref|YP_348901.1|  ....................................................................
gi|77458291|ref|YP_347796.1|  ....................................................................
gi|77460513|ref|YP_350020.1|  ....................................................................
gi|77456539|ref|YP_346044.1|  ....................................................................
gi|77457194|ref|YP_346699.1|  ....................................................................
gi|77461588|ref|YP_351095.1|  ....................................................................
gi|77459463|ref|YP_348970.1|  ....................................................................
gi|77456603|ref|YP_346108.1|  ....................................................................
gi|77460756|ref|YP_350263.1|  ....................................................................
gi|77458562|ref|YP_348067.1|  ....................................................................
gi|77456465|ref|YP_345970.1|  ....................................................................
gi|77457097|ref|YP_346602.1|  ....................................................................
gi|77457032|ref|YP_346537.1|  ....................................................................
gi|77459005|ref|YP_348511.1|  ....................................................................
gi|77461345|ref|YP_350852.1|  ....................................................................
gi|77457437|ref|YP_346942.1|  ....................................................................
gi|77459166|ref|YP_348672.1|  ....................................................................
gi|77460297|ref|YP_349804.1|  ....................................................................
gi|77459872|ref|YP_349379.1|  ....................................................................
gi|77456456|ref|YP_345961.1|  ....................................................................
gi|77461510|ref|YP_351017.1|  ....................................................................
gi|77459027|ref|YP_348533.1|  ....................................................................
gi|77459852|ref|YP_349359.1|  kgipnglpvdewgirvedchpvgssvtrggdtngpaavfattkyvdwlkkyappe.............
gi|77457275|ref|YP_346780.1|  ....................................................................
gi|77461635|ref|YP_351142.1|  ....................................................................
gi|77459314|ref|YP_348821.1|  ....................................................................
gi|77461680|ref|YP_351187.1|  ....................................................................
gi|77459080|ref|YP_348586.1|  ....................................................................
gi|77460591|ref|YP_350098.1|  ....................................................................
gi|77460690|ref|YP_350197.1|  ....................................................................
gi|77457351|ref|YP_346856.1|  ....................................................................
gi|77457411|ref|YP_346916.1|  ....................................................................
gi|77460131|ref|YP_349638.1|  ....................................................................
gi|77457661|ref|YP_347166.1|  ....................................................................
gi|77458197|ref|YP_347702.1|  ....................................................................
gi|77460696|ref|YP_350203.1|  ....................................................................
gi|77461371|ref|YP_350878.1|  ....................................................................
gi|77459516|ref|YP_349023.1|  ....................................................................
gi|77460858|ref|YP_350365.1|  ....................................................................
gi|77458661|ref|YP_348167.1|  ....................................................................
gi|77459874|ref|YP_349381.1|  ....................................................................
gi|77461861|ref|YP_351368.1|  ....................................................................
gi|77458589|ref|YP_348094.1|  ....................................................................
gi|77460541|ref|YP_350048.1|  ....................................................................
gi|77458304|ref|YP_347809.1|  ....................................................................
gi|77461122|ref|YP_350629.1|  ....................................................................
gi|77460036|ref|YP_349543.1|  ....................................................................
gi|77457913|ref|YP_347418.1|  ....................................................................
gi|77458663|ref|YP_348169.1|  ....................................................................
gi|77456484|ref|YP_345989.1|  ....................................................................
gi|77459913|ref|YP_349420.1|  ....................................................................
gi|77457200|ref|YP_346705.1|  ....................................................................
gi|77461639|ref|YP_351146.1|  ....................................................................
gi|77459501|ref|YP_349008.1|  ....................................................................
gi|77459989|ref|YP_349496.1|  ....................................................................
gi|77459734|ref|YP_349241.1|  ....................................................................
gi|77459646|ref|YP_349153.1|  ....................................................................
gi|77461911|ref|YP_351418.1|  ....................................................................
gi|77458595|ref|YP_348100.1|  ....................................................................
gi|77456947|ref|YP_346452.1|  ....................................................................
gi|77460224|ref|YP_349731.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77460407|ref|YP_349914.1|  ....................................................................
gi|77458938|ref|YP_348444.1|  ....................................................................
gi|77458668|ref|YP_348174.1|  ....................................................................
gi|77459515|ref|YP_349022.1|  ....................................................................
gi|77459029|ref|YP_348535.1|  ....................................................................
gi|77458115|ref|YP_347620.1|  ....................................................................
gi|77458299|ref|YP_347804.1|  ....................................................................
gi|77459590|ref|YP_349097.1|  ....................................................................
gi|77459139|ref|YP_348645.1|  ....................................................................
gi|77461503|ref|YP_351010.1|  ....................................................................
gi|77457545|ref|YP_347050.1|  ....................................................................
gi|77456896|ref|YP_346401.1|  ....................................................................
gi|77457125|ref|YP_346630.1|  ....................................................................
gi|77459733|ref|YP_349240.1|  ....................................................................
gi|77456439|ref|YP_345944.1|  ....................................................................
gi|77457466|ref|YP_346971.1|  ....................................................................
gi|77458675|ref|YP_348181.1|  ....................................................................
gi|77457981|ref|YP_347486.1|  ....................................................................
gi|77459375|ref|YP_348882.1|  ....................................................................
gi|77458585|ref|YP_348090.1|  ....................................................................
gi|77461591|ref|YP_351098.1|  ....................................................................
gi|77458830|ref|YP_348336.1|  ....................................................................
gi|77458659|ref|YP_348165.1|  ....................................................................
gi|77456943|ref|YP_346448.1|  ....................................................................
gi|77459507|ref|YP_349014.1|  ....................................................................
gi|77457171|ref|YP_346676.1|  ....................................................................
gi|77456255|ref|YP_345760.1|  ....................................................................
gi|77459383|ref|YP_348890.1|  ....................................................................
gi|77459504|ref|YP_349011.1|  ....................................................................
gi|77457677|ref|YP_347182.1|  ....................................................................
gi|77458588|ref|YP_348093.1|  ....................................................................
gi|77457164|ref|YP_346669.1|  ....................................................................
gi|77456645|ref|YP_346150.1|  ....................................................................
gi|77461779|ref|YP_351286.1|  ....................................................................
gi|77457277|ref|YP_346782.1|  ....................................................................
gi|77461152|ref|YP_350659.1|  ....................................................................
gi|77456556|ref|YP_346061.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459903|ref|YP_349410.1|  ....................................................................
gi|77457685|ref|YP_347190.1|  ....................................................................
gi|77461155|ref|YP_350662.1|  ....................................................................
gi|77457148|ref|YP_346653.1|  ....................................................................
gi|77457225|ref|YP_346730.1|  ....................................................................
gi|77456777|ref|YP_346282.1|  ....................................................................
gi|77459007|ref|YP_348513.1|  ....................................................................
gi|77458947|ref|YP_348453.1|  ....................................................................
gi|77459604|ref|YP_349111.1|  ....................................................................
gi|77457540|ref|YP_347045.1|  ....................................................................
gi|77458467|ref|YP_347972.1|  ....................................................................
gi|77460123|ref|YP_349630.1|  ....................................................................
gi|77457570|ref|YP_347075.1|  ....................................................................
gi|77456344|ref|YP_345849.1|  ....................................................................
gi|77457610|ref|YP_347115.1|  ....................................................................
gi|77458181|ref|YP_347686.1|  ....................................................................
gi|77459944|ref|YP_349451.1|  ....................................................................
gi|77461472|ref|YP_350979.1|  ....................................................................
gi|77460767|ref|YP_350274.1|  ....................................................................
gi|77458891|ref|YP_348397.1|  ....................................................................
gi|77460119|ref|YP_349626.1|  ....................................................................
gi|77459497|ref|YP_349004.1|  ....................................................................
gi|77456366|ref|YP_345871.1|  ....................................................................
gi|77459144|ref|YP_348650.1|  ....................................................................
gi|77456369|ref|YP_345874.1|  ....................................................................
gi|77457630|ref|YP_347135.1|  ....................................................................
gi|77457486|ref|YP_346991.1|  ....................................................................
gi|77460216|ref|YP_349723.1|  ....................................................................
gi|77461386|ref|YP_350893.1|  ....................................................................
gi|77458645|ref|YP_348151.1|  ....................................................................
gi|77459746|ref|YP_349253.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77461610|ref|YP_351117.1|  ....................................................................
gi|77456717|ref|YP_346222.1|  ....................................................................
gi|77456922|ref|YP_346427.1|  ....................................................................
gi|77458189|ref|YP_347694.1|  ....................................................................
gi|77461512|ref|YP_351019.1|  ....................................................................
gi|77458795|ref|YP_348301.1|  ....................................................................
gi|77459527|ref|YP_349034.1|  ....................................................................
gi|77460812|ref|YP_350319.1|  ....................................................................
gi|77458380|ref|YP_347885.1|  ....................................................................
gi|77457256|ref|YP_346761.1|  ....................................................................
gi|77458417|ref|YP_347922.1|  ....................................................................
gi|77461348|ref|YP_350855.1|  ....................................................................
gi|77459904|ref|YP_349411.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459579|ref|YP_349086.1|  ....................................................................
gi|77456509|ref|YP_346014.1|  ....................................................................
gi|77460531|ref|YP_350038.1|  ....................................................................
gi|77458432|ref|YP_347937.1|  ....................................................................
gi|77458685|ref|YP_348191.1|  ....................................................................
gi|77456796|ref|YP_346301.1|  ....................................................................
gi|77456443|ref|YP_345948.1|  ....................................................................
gi|77456440|ref|YP_345945.1|  ....................................................................
gi|77461514|ref|YP_351021.1|  ....................................................................
gi|77457657|ref|YP_347162.1|  ....................................................................
gi|77460336|ref|YP_349843.1|  ....................................................................
gi|77458953|ref|YP_348459.1|  ....................................................................
gi|77460693|ref|YP_350200.1|  ....................................................................
gi|77457612|ref|YP_347117.1|  ....................................................................
gi|77458012|ref|YP_347517.1|  ....................................................................
gi|77461737|ref|YP_351244.1|  ....................................................................
gi|77459929|ref|YP_349436.1|  ....................................................................
gi|77458950|ref|YP_348456.1|  ....................................................................
gi|77458596|ref|YP_348101.1|  ....................................................................
gi|77460559|ref|YP_350066.1|  ....................................................................
gi|77460164|ref|YP_349671.1|  ....................................................................
gi|77460025|ref|YP_349532.1|  ....................................................................
gi|77458799|ref|YP_348305.1|  ....................................................................
gi|77459649|ref|YP_349156.1|  ....................................................................
gi|77456330|ref|YP_345835.1|  ....................................................................
gi|77456912|ref|YP_346417.1|  ....................................................................
gi|77458376|ref|YP_347881.1|  ....................................................................
gi|77460214|ref|YP_349721.1|  ....................................................................
gi|77460544|ref|YP_350051.1|  ....................................................................
gi|77461845|ref|YP_351352.1|  ....................................................................
gi|77458031|ref|YP_347536.1|  ....................................................................
gi|77460241|ref|YP_349748.1|  ....................................................................
gi|77459350|ref|YP_348857.1|  ....................................................................
gi|77461233|ref|YP_350740.1|  ....................................................................
gi|77458508|ref|YP_348013.1|  ....................................................................
gi|77460704|ref|YP_350211.1|  ....................................................................
gi|77459076|ref|YP_348582.1|  ....................................................................
gi|77459000|ref|YP_348506.1|  ....................................................................
gi|77458730|ref|YP_348236.1|  ....................................................................
gi|77460545|ref|YP_350052.1|  ....................................................................
gi|77457580|ref|YP_347085.1|  ....................................................................
gi|77456527|ref|YP_346032.1|  ....................................................................
gi|77457259|ref|YP_346764.1|  ....................................................................
gi|77460567|ref|YP_350074.1|  ....................................................................


                                                                                                    
                                                                                                    
d1us5a_                         ....................................................................
gi|77457042|ref|YP_346547.1|  kpfdqlevrqaldmavnkqgilnavyqgagqlavnampptqwsyddtikdaaynpekakellkaagvk
gi|77457043|ref|YP_346548.1|  ....................................................................
gi|77457040|ref|YP_346545.1|  yisdvrvrkaidiafdkeayvnalfgkgnasvavnpypptllgynhelknpprdldkarallkeagvp
gi|77461759|ref|YP_351266.1|  pldkpevrqainlafdkanylkavfedtaea.....................................
gi|77458408|ref|YP_347913.1|  ....................................................................
gi|77458409|ref|YP_347914.1|  ....................................................................
gi|77459295|ref|YP_348802.1|  kpmfqdrrvrqalamlwdfewsnrqmmrnmyirqqsyfsntdlaarqlpdaaelkileplrgqipdev
gi|77459963|ref|YP_349470.1|  qnplfkdrrvrqalsllwdfewtnkqmmrgfyvrqnsywpksemaatalpdagelaileplrgqipde
gi|77459342|ref|YP_348849.1|  kpvfqdrrvrqaiamlwdfewsnrqmmrsmylrqrsffshsalsatelpdaeelkilepwrgkipdev
gi|77461625|ref|YP_351132.1|  ....................................................................
gi|77458344|ref|YP_347849.1|  ....................................................................
gi|77459054|ref|YP_348560.1|  ....................................................................
gi|77461852|ref|YP_351359.1|  ....................................................................
gi|77461626|ref|YP_351133.1|  ....................................................................
gi|77459482|ref|YP_348989.1|  ....................................................................
gi|77458902|ref|YP_348408.1|  ....................................................................
gi|77458800|ref|YP_348306.1|  ....................................................................
gi|77459754|ref|YP_349261.1|  ....................................................................
gi|77456422|ref|YP_345927.1|  ....................................................................
gi|77458599|ref|YP_348104.1|  ....................................................................
gi|77461708|ref|YP_351215.1|  ....................................................................
gi|77457818|ref|YP_347323.1|  ....................................................................
gi|77456295|ref|YP_345800.1|  ....................................................................
gi|77458382|ref|YP_347887.1|  ....................................................................
gi|77456253|ref|YP_345758.1|  ....................................................................
gi|77461459|ref|YP_350966.1|  ....................................................................
gi|77456451|ref|YP_345956.1|  ....................................................................
gi|77459541|ref|YP_349048.1|  ....................................................................
gi|77460565|ref|YP_350072.1|  ....................................................................
gi|77461651|ref|YP_351158.1|  ....................................................................
gi|77458865|ref|YP_348371.1|  ....................................................................
gi|77457833|ref|YP_347338.1|  ....................................................................
gi|77459367|ref|YP_348874.1|  ....................................................................
gi|77456472|ref|YP_345977.1|  ....................................................................
gi|77461451|ref|YP_350958.1|  ....................................................................
gi|77456590|ref|YP_346095.1|  ....................................................................
gi|77459062|ref|YP_348568.1|  ....................................................................
gi|77456597|ref|YP_346102.1|  ....................................................................
gi|77456759|ref|YP_346264.1|  ....................................................................
gi|77461836|ref|YP_351343.1|  ....................................................................
gi|77459394|ref|YP_348901.1|  ....................................................................
gi|77458291|ref|YP_347796.1|  ....................................................................
gi|77460513|ref|YP_350020.1|  ....................................................................
gi|77456539|ref|YP_346044.1|  ....................................................................
gi|77457194|ref|YP_346699.1|  ....................................................................
gi|77461588|ref|YP_351095.1|  ....................................................................
gi|77459463|ref|YP_348970.1|  ....................................................................
gi|77456603|ref|YP_346108.1|  ....................................................................
gi|77460756|ref|YP_350263.1|  ....................................................................
gi|77458562|ref|YP_348067.1|  ....................................................................
gi|77456465|ref|YP_345970.1|  ....................................................................
gi|77457097|ref|YP_346602.1|  ....................................................................
gi|77457032|ref|YP_346537.1|  ....................................................................
gi|77459005|ref|YP_348511.1|  ....................................................................
gi|77461345|ref|YP_350852.1|  ....................................................................
gi|77457437|ref|YP_346942.1|  ....................................................................
gi|77459166|ref|YP_348672.1|  ....................................................................
gi|77460297|ref|YP_349804.1|  ....................................................................
gi|77459872|ref|YP_349379.1|  ....................................................................
gi|77456456|ref|YP_345961.1|  ....................................................................
gi|77461510|ref|YP_351017.1|  ....................................................................
gi|77459027|ref|YP_348533.1|  ....................................................................
gi|77459852|ref|YP_349359.1|  ....................................................................
gi|77457275|ref|YP_346780.1|  ....................................................................
gi|77461635|ref|YP_351142.1|  ....................................................................
gi|77459314|ref|YP_348821.1|  ....................................................................
gi|77461680|ref|YP_351187.1|  ....................................................................
gi|77459080|ref|YP_348586.1|  ....................................................................
gi|77460591|ref|YP_350098.1|  ....................................................................
gi|77460690|ref|YP_350197.1|  ....................................................................
gi|77457351|ref|YP_346856.1|  ....................................................................
gi|77457411|ref|YP_346916.1|  ....................................................................
gi|77460131|ref|YP_349638.1|  ....................................................................
gi|77457661|ref|YP_347166.1|  ....................................................................
gi|77458197|ref|YP_347702.1|  ....................................................................
gi|77460696|ref|YP_350203.1|  ....................................................................
gi|77461371|ref|YP_350878.1|  ....................................................................
gi|77459516|ref|YP_349023.1|  ....................................................................
gi|77460858|ref|YP_350365.1|  ....................................................................
gi|77458661|ref|YP_348167.1|  ....................................................................
gi|77459874|ref|YP_349381.1|  ....................................................................
gi|77461861|ref|YP_351368.1|  ....................................................................
gi|77458589|ref|YP_348094.1|  ....................................................................
gi|77460541|ref|YP_350048.1|  ....................................................................
gi|77458304|ref|YP_347809.1|  ....................................................................
gi|77461122|ref|YP_350629.1|  ....................................................................
gi|77460036|ref|YP_349543.1|  ....................................................................
gi|77457913|ref|YP_347418.1|  ....................................................................
gi|77458663|ref|YP_348169.1|  ....................................................................
gi|77456484|ref|YP_345989.1|  ....................................................................
gi|77459913|ref|YP_349420.1|  ....................................................................
gi|77457200|ref|YP_346705.1|  ....................................................................
gi|77461639|ref|YP_351146.1|  ....................................................................
gi|77459501|ref|YP_349008.1|  ....................................................................
gi|77459989|ref|YP_349496.1|  ....................................................................
gi|77459734|ref|YP_349241.1|  ....................................................................
gi|77459646|ref|YP_349153.1|  ....................................................................
gi|77461911|ref|YP_351418.1|  ....................................................................
gi|77458595|ref|YP_348100.1|  ....................................................................
gi|77456947|ref|YP_346452.1|  ....................................................................
gi|77460224|ref|YP_349731.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77460407|ref|YP_349914.1|  ....................................................................
gi|77458938|ref|YP_348444.1|  ....................................................................
gi|77458668|ref|YP_348174.1|  ....................................................................
gi|77459515|ref|YP_349022.1|  ....................................................................
gi|77459029|ref|YP_348535.1|  ....................................................................
gi|77458115|ref|YP_347620.1|  ....................................................................
gi|77458299|ref|YP_347804.1|  ....................................................................
gi|77459590|ref|YP_349097.1|  ....................................................................
gi|77459139|ref|YP_348645.1|  ....................................................................
gi|77461503|ref|YP_351010.1|  ....................................................................
gi|77457545|ref|YP_347050.1|  ....................................................................
gi|77456896|ref|YP_346401.1|  ....................................................................
gi|77457125|ref|YP_346630.1|  ....................................................................
gi|77459733|ref|YP_349240.1|  ....................................................................
gi|77456439|ref|YP_345944.1|  ....................................................................
gi|77457466|ref|YP_346971.1|  ....................................................................
gi|77458675|ref|YP_348181.1|  ....................................................................
gi|77457981|ref|YP_347486.1|  ....................................................................
gi|77459375|ref|YP_348882.1|  ....................................................................
gi|77458585|ref|YP_348090.1|  ....................................................................
gi|77461591|ref|YP_351098.1|  ....................................................................
gi|77458830|ref|YP_348336.1|  ....................................................................
gi|77458659|ref|YP_348165.1|  ....................................................................
gi|77456943|ref|YP_346448.1|  ....................................................................
gi|77459507|ref|YP_349014.1|  ....................................................................
gi|77457171|ref|YP_346676.1|  ....................................................................
gi|77456255|ref|YP_345760.1|  ....................................................................
gi|77459383|ref|YP_348890.1|  ....................................................................
gi|77459504|ref|YP_349011.1|  ....................................................................
gi|77457677|ref|YP_347182.1|  ....................................................................
gi|77458588|ref|YP_348093.1|  ....................................................................
gi|77457164|ref|YP_346669.1|  ....................................................................
gi|77456645|ref|YP_346150.1|  ....................................................................
gi|77461779|ref|YP_351286.1|  ....................................................................
gi|77457277|ref|YP_346782.1|  ....................................................................
gi|77461152|ref|YP_350659.1|  ....................................................................
gi|77456556|ref|YP_346061.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459903|ref|YP_349410.1|  ....................................................................
gi|77457685|ref|YP_347190.1|  ....................................................................
gi|77461155|ref|YP_350662.1|  ....................................................................
gi|77457148|ref|YP_346653.1|  ....................................................................
gi|77457225|ref|YP_346730.1|  ....................................................................
gi|77456777|ref|YP_346282.1|  ....................................................................
gi|77459007|ref|YP_348513.1|  ....................................................................
gi|77458947|ref|YP_348453.1|  ....................................................................
gi|77459604|ref|YP_349111.1|  ....................................................................
gi|77457540|ref|YP_347045.1|  ....................................................................
gi|77458467|ref|YP_347972.1|  ....................................................................
gi|77460123|ref|YP_349630.1|  ....................................................................
gi|77457570|ref|YP_347075.1|  ....................................................................
gi|77456344|ref|YP_345849.1|  ....................................................................
gi|77457610|ref|YP_347115.1|  ....................................................................
gi|77458181|ref|YP_347686.1|  ....................................................................
gi|77459944|ref|YP_349451.1|  ....................................................................
gi|77461472|ref|YP_350979.1|  ....................................................................
gi|77460767|ref|YP_350274.1|  ....................................................................
gi|77458891|ref|YP_348397.1|  ....................................................................
gi|77460119|ref|YP_349626.1|  ....................................................................
gi|77459497|ref|YP_349004.1|  ....................................................................
gi|77456366|ref|YP_345871.1|  ....................................................................
gi|77459144|ref|YP_348650.1|  ....................................................................
gi|77456369|ref|YP_345874.1|  ....................................................................
gi|77457630|ref|YP_347135.1|  ....................................................................
gi|77457486|ref|YP_346991.1|  ....................................................................
gi|77460216|ref|YP_349723.1|  ....................................................................
gi|77461386|ref|YP_350893.1|  ....................................................................
gi|77458645|ref|YP_348151.1|  ....................................................................
gi|77459746|ref|YP_349253.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77461610|ref|YP_351117.1|  ....................................................................
gi|77456717|ref|YP_346222.1|  ....................................................................
gi|77456922|ref|YP_346427.1|  ....................................................................
gi|77458189|ref|YP_347694.1|  ....................................................................
gi|77461512|ref|YP_351019.1|  ....................................................................
gi|77458795|ref|YP_348301.1|  ....................................................................
gi|77459527|ref|YP_349034.1|  ....................................................................
gi|77460812|ref|YP_350319.1|  ....................................................................
gi|77458380|ref|YP_347885.1|  ....................................................................
gi|77457256|ref|YP_346761.1|  ....................................................................
gi|77458417|ref|YP_347922.1|  ....................................................................
gi|77461348|ref|YP_350855.1|  ....................................................................
gi|77459904|ref|YP_349411.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459579|ref|YP_349086.1|  ....................................................................
gi|77456509|ref|YP_346014.1|  ....................................................................
gi|77460531|ref|YP_350038.1|  ....................................................................
gi|77458432|ref|YP_347937.1|  ....................................................................
gi|77458685|ref|YP_348191.1|  ....................................................................
gi|77456796|ref|YP_346301.1|  ....................................................................
gi|77456443|ref|YP_345948.1|  ....................................................................
gi|77456440|ref|YP_345945.1|  ....................................................................
gi|77461514|ref|YP_351021.1|  ....................................................................
gi|77457657|ref|YP_347162.1|  ....................................................................
gi|77460336|ref|YP_349843.1|  ....................................................................
gi|77458953|ref|YP_348459.1|  ....................................................................
gi|77460693|ref|YP_350200.1|  ....................................................................
gi|77457612|ref|YP_347117.1|  ....................................................................
gi|77458012|ref|YP_347517.1|  ....................................................................
gi|77461737|ref|YP_351244.1|  ....................................................................
gi|77459929|ref|YP_349436.1|  ....................................................................
gi|77458950|ref|YP_348456.1|  ....................................................................
gi|77458596|ref|YP_348101.1|  ....................................................................
gi|77460559|ref|YP_350066.1|  ....................................................................
gi|77460164|ref|YP_349671.1|  ....................................................................
gi|77460025|ref|YP_349532.1|  ....................................................................
gi|77458799|ref|YP_348305.1|  ....................................................................
gi|77459649|ref|YP_349156.1|  ....................................................................
gi|77456330|ref|YP_345835.1|  ....................................................................
gi|77456912|ref|YP_346417.1|  ....................................................................
gi|77458376|ref|YP_347881.1|  ....................................................................
gi|77460214|ref|YP_349721.1|  ....................................................................
gi|77460544|ref|YP_350051.1|  ....................................................................
gi|77461845|ref|YP_351352.1|  ....................................................................
gi|77458031|ref|YP_347536.1|  ....................................................................
gi|77460241|ref|YP_349748.1|  ....................................................................
gi|77459350|ref|YP_348857.1|  ....................................................................
gi|77461233|ref|YP_350740.1|  ....................................................................
gi|77458508|ref|YP_348013.1|  ....................................................................
gi|77460704|ref|YP_350211.1|  ....................................................................
gi|77459076|ref|YP_348582.1|  ....................................................................
gi|77459000|ref|YP_348506.1|  ....................................................................
gi|77458730|ref|YP_348236.1|  ....................................................................
gi|77460545|ref|YP_350052.1|  ....................................................................
gi|77457580|ref|YP_347085.1|  ....................................................................
gi|77456527|ref|YP_346032.1|  ....................................................................
gi|77457259|ref|YP_346764.1|  ....................................................................
gi|77460567|ref|YP_350074.1|  ....................................................................


                                                                                                    
                                                                                                    
d1us5a_                         ....................................................................
gi|77457042|ref|YP_346547.1|  egt.................................................................
gi|77457043|ref|YP_346548.1|  ....................................................................
gi|77457040|ref|YP_346545.1|  egt.................................................................
gi|77461759|ref|YP_351266.1|  ....................................................................
gi|77458408|ref|YP_347913.1|  ....................................................................
gi|77458409|ref|YP_347914.1|  ....................................................................
gi|77459295|ref|YP_348802.1|  ftrvfeapktdgsgiirdkqlqalelleqagwkpdgdqlvnergeplsftflvsqngmdrlllpyk..
gi|77459963|ref|YP_349470.1|  vfsrvyqapktdgsgyirdkqlqalkllaeagwtpknnrlvnaagepfeftfldgqggfdrmllpykr
gi|77459342|ref|YP_348849.1|  fsqvfeaprtdgsgnvraqqlqalklleaagwkprgdqlvnaagdplrftflngqkgferlllpf...
gi|77461625|ref|YP_351132.1|  ....................................................................
gi|77458344|ref|YP_347849.1|  ....................................................................
gi|77459054|ref|YP_348560.1|  ....................................................................
gi|77461852|ref|YP_351359.1|  ....................................................................
gi|77461626|ref|YP_351133.1|  ....................................................................
gi|77459482|ref|YP_348989.1|  ....................................................................
gi|77458902|ref|YP_348408.1|  ....................................................................
gi|77458800|ref|YP_348306.1|  ....................................................................
gi|77459754|ref|YP_349261.1|  ....................................................................
gi|77456422|ref|YP_345927.1|  ....................................................................
gi|77458599|ref|YP_348104.1|  ....................................................................
gi|77461708|ref|YP_351215.1|  ....................................................................
gi|77457818|ref|YP_347323.1|  ....................................................................
gi|77456295|ref|YP_345800.1|  ....................................................................
gi|77458382|ref|YP_347887.1|  ....................................................................
gi|77456253|ref|YP_345758.1|  ....................................................................
gi|77461459|ref|YP_350966.1|  ....................................................................
gi|77456451|ref|YP_345956.1|  ....................................................................
gi|77459541|ref|YP_349048.1|  ....................................................................
gi|77460565|ref|YP_350072.1|  ....................................................................
gi|77461651|ref|YP_351158.1|  ....................................................................
gi|77458865|ref|YP_348371.1|  ....................................................................
gi|77457833|ref|YP_347338.1|  ....................................................................
gi|77459367|ref|YP_348874.1|  ....................................................................
gi|77456472|ref|YP_345977.1|  ....................................................................
gi|77461451|ref|YP_350958.1|  ....................................................................
gi|77456590|ref|YP_346095.1|  ....................................................................
gi|77459062|ref|YP_348568.1|  ....................................................................
gi|77456597|ref|YP_346102.1|  ....................................................................
gi|77456759|ref|YP_346264.1|  ....................................................................
gi|77461836|ref|YP_351343.1|  ....................................................................
gi|77459394|ref|YP_348901.1|  ....................................................................
gi|77458291|ref|YP_347796.1|  ....................................................................
gi|77460513|ref|YP_350020.1|  ....................................................................
gi|77456539|ref|YP_346044.1|  ....................................................................
gi|77457194|ref|YP_346699.1|  ....................................................................
gi|77461588|ref|YP_351095.1|  ....................................................................
gi|77459463|ref|YP_348970.1|  ....................................................................
gi|77456603|ref|YP_346108.1|  ....................................................................
gi|77460756|ref|YP_350263.1|  ....................................................................
gi|77458562|ref|YP_348067.1|  ....................................................................
gi|77456465|ref|YP_345970.1|  ....................................................................
gi|77457097|ref|YP_346602.1|  ....................................................................
gi|77457032|ref|YP_346537.1|  ....................................................................
gi|77459005|ref|YP_348511.1|  ....................................................................
gi|77461345|ref|YP_350852.1|  ....................................................................
gi|77457437|ref|YP_346942.1|  ....................................................................
gi|77459166|ref|YP_348672.1|  ....................................................................
gi|77460297|ref|YP_349804.1|  ....................................................................
gi|77459872|ref|YP_349379.1|  ....................................................................
gi|77456456|ref|YP_345961.1|  ....................................................................
gi|77461510|ref|YP_351017.1|  ....................................................................
gi|77459027|ref|YP_348533.1|  ....................................................................
gi|77459852|ref|YP_349359.1|  ....................................................................
gi|77457275|ref|YP_346780.1|  ....................................................................
gi|77461635|ref|YP_351142.1|  ....................................................................
gi|77459314|ref|YP_348821.1|  ....................................................................
gi|77461680|ref|YP_351187.1|  ....................................................................
gi|77459080|ref|YP_348586.1|  ....................................................................
gi|77460591|ref|YP_350098.1|  ....................................................................
gi|77460690|ref|YP_350197.1|  ....................................................................
gi|77457351|ref|YP_346856.1|  ....................................................................
gi|77457411|ref|YP_346916.1|  ....................................................................
gi|77460131|ref|YP_349638.1|  ....................................................................
gi|77457661|ref|YP_347166.1|  ....................................................................
gi|77458197|ref|YP_347702.1|  ....................................................................
gi|77460696|ref|YP_350203.1|  ....................................................................
gi|77461371|ref|YP_350878.1|  ....................................................................
gi|77459516|ref|YP_349023.1|  ....................................................................
gi|77460858|ref|YP_350365.1|  ....................................................................
gi|77458661|ref|YP_348167.1|  ....................................................................
gi|77459874|ref|YP_349381.1|  ....................................................................
gi|77461861|ref|YP_351368.1|  ....................................................................
gi|77458589|ref|YP_348094.1|  ....................................................................
gi|77460541|ref|YP_350048.1|  ....................................................................
gi|77458304|ref|YP_347809.1|  ....................................................................
gi|77461122|ref|YP_350629.1|  ....................................................................
gi|77460036|ref|YP_349543.1|  ....................................................................
gi|77457913|ref|YP_347418.1|  ....................................................................
gi|77458663|ref|YP_348169.1|  ....................................................................
gi|77456484|ref|YP_345989.1|  ....................................................................
gi|77459913|ref|YP_349420.1|  ....................................................................
gi|77457200|ref|YP_346705.1|  ....................................................................
gi|77461639|ref|YP_351146.1|  ....................................................................
gi|77459501|ref|YP_349008.1|  ....................................................................
gi|77459989|ref|YP_349496.1|  ....................................................................
gi|77459734|ref|YP_349241.1|  ....................................................................
gi|77459646|ref|YP_349153.1|  ....................................................................
gi|77461911|ref|YP_351418.1|  ....................................................................
gi|77458595|ref|YP_348100.1|  ....................................................................
gi|77456947|ref|YP_346452.1|  ....................................................................
gi|77460224|ref|YP_349731.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77460407|ref|YP_349914.1|  ....................................................................
gi|77458938|ref|YP_348444.1|  ....................................................................
gi|77458668|ref|YP_348174.1|  ....................................................................
gi|77459515|ref|YP_349022.1|  ....................................................................
gi|77459029|ref|YP_348535.1|  ....................................................................
gi|77458115|ref|YP_347620.1|  ....................................................................
gi|77458299|ref|YP_347804.1|  ....................................................................
gi|77459590|ref|YP_349097.1|  ....................................................................
gi|77459139|ref|YP_348645.1|  ....................................................................
gi|77461503|ref|YP_351010.1|  ....................................................................
gi|77457545|ref|YP_347050.1|  ....................................................................
gi|77456896|ref|YP_346401.1|  ....................................................................
gi|77457125|ref|YP_346630.1|  ....................................................................
gi|77459733|ref|YP_349240.1|  ....................................................................
gi|77456439|ref|YP_345944.1|  ....................................................................
gi|77457466|ref|YP_346971.1|  ....................................................................
gi|77458675|ref|YP_348181.1|  ....................................................................
gi|77457981|ref|YP_347486.1|  ....................................................................
gi|77459375|ref|YP_348882.1|  ....................................................................
gi|77458585|ref|YP_348090.1|  ....................................................................
gi|77461591|ref|YP_351098.1|  ....................................................................
gi|77458830|ref|YP_348336.1|  ....................................................................
gi|77458659|ref|YP_348165.1|  ....................................................................
gi|77456943|ref|YP_346448.1|  ....................................................................
gi|77459507|ref|YP_349014.1|  ....................................................................
gi|77457171|ref|YP_346676.1|  ....................................................................
gi|77456255|ref|YP_345760.1|  ....................................................................
gi|77459383|ref|YP_348890.1|  ....................................................................
gi|77459504|ref|YP_349011.1|  ....................................................................
gi|77457677|ref|YP_347182.1|  ....................................................................
gi|77458588|ref|YP_348093.1|  ....................................................................
gi|77457164|ref|YP_346669.1|  ....................................................................
gi|77456645|ref|YP_346150.1|  ....................................................................
gi|77461779|ref|YP_351286.1|  ....................................................................
gi|77457277|ref|YP_346782.1|  ....................................................................
gi|77461152|ref|YP_350659.1|  ....................................................................
gi|77456556|ref|YP_346061.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459903|ref|YP_349410.1|  ....................................................................
gi|77457685|ref|YP_347190.1|  ....................................................................
gi|77461155|ref|YP_350662.1|  ....................................................................
gi|77457148|ref|YP_346653.1|  ....................................................................
gi|77457225|ref|YP_346730.1|  ....................................................................
gi|77456777|ref|YP_346282.1|  ....................................................................
gi|77459007|ref|YP_348513.1|  ....................................................................
gi|77458947|ref|YP_348453.1|  ....................................................................
gi|77459604|ref|YP_349111.1|  ....................................................................
gi|77457540|ref|YP_347045.1|  ....................................................................
gi|77458467|ref|YP_347972.1|  ....................................................................
gi|77460123|ref|YP_349630.1|  ....................................................................
gi|77457570|ref|YP_347075.1|  ....................................................................
gi|77456344|ref|YP_345849.1|  ....................................................................
gi|77457610|ref|YP_347115.1|  ....................................................................
gi|77458181|ref|YP_347686.1|  ....................................................................
gi|77459944|ref|YP_349451.1|  ....................................................................
gi|77461472|ref|YP_350979.1|  ....................................................................
gi|77460767|ref|YP_350274.1|  ....................................................................
gi|77458891|ref|YP_348397.1|  ....................................................................
gi|77460119|ref|YP_349626.1|  ....................................................................
gi|77459497|ref|YP_349004.1|  ....................................................................
gi|77456366|ref|YP_345871.1|  ....................................................................
gi|77459144|ref|YP_348650.1|  ....................................................................
gi|77456369|ref|YP_345874.1|  ....................................................................
gi|77457630|ref|YP_347135.1|  ....................................................................
gi|77457486|ref|YP_346991.1|  ....................................................................
gi|77460216|ref|YP_349723.1|  ....................................................................
gi|77461386|ref|YP_350893.1|  ....................................................................
gi|77458645|ref|YP_348151.1|  ....................................................................
gi|77459746|ref|YP_349253.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77461610|ref|YP_351117.1|  ....................................................................
gi|77456717|ref|YP_346222.1|  ....................................................................
gi|77456922|ref|YP_346427.1|  ....................................................................
gi|77458189|ref|YP_347694.1|  ....................................................................
gi|77461512|ref|YP_351019.1|  ....................................................................
gi|77458795|ref|YP_348301.1|  ....................................................................
gi|77459527|ref|YP_349034.1|  ....................................................................
gi|77460812|ref|YP_350319.1|  ....................................................................
gi|77458380|ref|YP_347885.1|  ....................................................................
gi|77457256|ref|YP_346761.1|  ....................................................................
gi|77458417|ref|YP_347922.1|  ....................................................................
gi|77461348|ref|YP_350855.1|  ....................................................................
gi|77459904|ref|YP_349411.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459579|ref|YP_349086.1|  ....................................................................
gi|77456509|ref|YP_346014.1|  ....................................................................
gi|77460531|ref|YP_350038.1|  ....................................................................
gi|77458432|ref|YP_347937.1|  ....................................................................
gi|77458685|ref|YP_348191.1|  ....................................................................
gi|77456796|ref|YP_346301.1|  ....................................................................
gi|77456443|ref|YP_345948.1|  ....................................................................
gi|77456440|ref|YP_345945.1|  ....................................................................
gi|77461514|ref|YP_351021.1|  ....................................................................
gi|77457657|ref|YP_347162.1|  ....................................................................
gi|77460336|ref|YP_349843.1|  ....................................................................
gi|77458953|ref|YP_348459.1|  ....................................................................
gi|77460693|ref|YP_350200.1|  ....................................................................
gi|77457612|ref|YP_347117.1|  ....................................................................
gi|77458012|ref|YP_347517.1|  ....................................................................
gi|77461737|ref|YP_351244.1|  ....................................................................
gi|77459929|ref|YP_349436.1|  ....................................................................
gi|77458950|ref|YP_348456.1|  ....................................................................
gi|77458596|ref|YP_348101.1|  ....................................................................
gi|77460559|ref|YP_350066.1|  ....................................................................
gi|77460164|ref|YP_349671.1|  ....................................................................
gi|77460025|ref|YP_349532.1|  ....................................................................
gi|77458799|ref|YP_348305.1|  ....................................................................
gi|77459649|ref|YP_349156.1|  ....................................................................
gi|77456330|ref|YP_345835.1|  ....................................................................
gi|77456912|ref|YP_346417.1|  ....................................................................
gi|77458376|ref|YP_347881.1|  ....................................................................
gi|77460214|ref|YP_349721.1|  ....................................................................
gi|77460544|ref|YP_350051.1|  ....................................................................
gi|77461845|ref|YP_351352.1|  ....................................................................
gi|77458031|ref|YP_347536.1|  ....................................................................
gi|77460241|ref|YP_349748.1|  ....................................................................
gi|77459350|ref|YP_348857.1|  ....................................................................
gi|77461233|ref|YP_350740.1|  ....................................................................
gi|77458508|ref|YP_348013.1|  ....................................................................
gi|77460704|ref|YP_350211.1|  ....................................................................
gi|77459076|ref|YP_348582.1|  ....................................................................
gi|77459000|ref|YP_348506.1|  ....................................................................
gi|77458730|ref|YP_348236.1|  ....................................................................
gi|77460545|ref|YP_350052.1|  ....................................................................
gi|77457580|ref|YP_347085.1|  ....................................................................
gi|77456527|ref|YP_346032.1|  ....................................................................
gi|77457259|ref|YP_346764.1|  ....................................................................
gi|77460567|ref|YP_350074.1|  ....................................................................


                                                   10         20        30               40         
                                                    |          |         |                |         
d1us5a_                         .-QEFITIGS..........GSTTGVYF.PVATGIAKLVNDAN......VGIRANAR.STGG.....S
gi|77457042|ref|YP_346547.1|  .---EITLWA..........MPVQRPYN.PNAKLMAEMLQADWak....IGLKVKIV.SYE-.....W
gi|77457043|ref|YP_346548.1|  .---------..........--------.---------YFTD-......MGLNTTIK.SVEK.....L
gi|77457040|ref|YP_346545.1|  .---TFTLFTrng.......GGPTNPNP.MLGAQMMQADLAK-......VGIKIDIR.VME-.....W
gi|77461759|ref|YP_351266.1|  .---------..........--------.--------------......--------.----.....-
gi|77458408|ref|YP_347913.1|  .---------..........--------.--------------......--------.----.....-
gi|77458409|ref|YP_347914.1|  .---------..........--------.--------------......--------.----.....-
gi|77459295|ref|YP_348802.1|  .---------..........--------.--------------......--------.----.....-
gi|77459963|ref|YP_349470.1|  t---------..........--------.----------LAQ-......IGITLNLR.RID-.....S
gi|77459342|ref|YP_348849.1|  .---------..........--------.--------------......--------.----.....-
gi|77461625|ref|YP_351132.1|  .---------..........--------.--------------......--------.--H-.....S
gi|77458344|ref|YP_347849.1|  .---------..........--------.--------------......--------.----.....-
gi|77459054|ref|YP_348560.1|  .---------..........--------.--------------......--------.----.....-
gi|77461852|ref|YP_351359.1|  .---------..........--------.--------------......--------.----.....-
gi|77461626|ref|YP_351133.1|  .---------..........--------.--------------......--------.----.....-
gi|77459482|ref|YP_348989.1|  .---------..........--------.--------------......--------.----.....-
gi|77458902|ref|YP_348408.1|  .---------..........--------.--------------......--------.----.....-
gi|77458800|ref|YP_348306.1|  .---------..........--------.--------------......--------.----.....-
gi|77459754|ref|YP_349261.1|  .---------..........--------.--------------......--------.----.....-
gi|77456422|ref|YP_345927.1|  .---------..........--TRELYQ.DYNAEFVKYWQSEH......AGDTVKIQ.QSHGgsgkqG
gi|77458599|ref|YP_348104.1|  .---------..........--------.--------------......TGIKVIYD.VMDG.....S
gi|77461708|ref|YP_351215.1|  .---------..........--------.--------------......--------.----.....-
gi|77457818|ref|YP_347323.1|  .--------Y..........DVMRDFYK.DYNTAFQKHWQAE-......HNENITVQmSFGG.....S
gi|77456295|ref|YP_345800.1|  .---------..........--------.-------KPALAK-......EGVDLKVK.VFTD.....Y
gi|77458382|ref|YP_347887.1|  .---------..........--------.--------------......--------.----.....-
gi|77456253|ref|YP_345758.1|  .---TVKMA-..........-DPGWSDI.AATNAITGFLLDG-......MGYKAKVD.TLA-.....V
gi|77461459|ref|YP_350966.1|  .---------..........--------.--------------......--------.----.....-
gi|77456451|ref|YP_345956.1|  .---------..........--------.---E-LIKPTLAK-......EGVDLEIK.VFTD.....Y
gi|77459541|ref|YP_349048.1|  .---------..........--------.--------------......--------.----.....-
gi|77460565|ref|YP_350072.1|  .---------..........GYPTDTLP.GSTVSLEAALAKN-......-DIQVIGE.EWAGr....S
gi|77461651|ref|YP_351158.1|  .---------..........--------.--------------......----LSTD.VFSD.....D
gi|77458865|ref|YP_348371.1|  .---------..........--------.--------------......--------.--N-.....-
gi|77457833|ref|YP_347338.1|  .-KQTLNIGY..........VDGWSDSV.ATTHVAAEVIKQK-......LGYDVKLQ.AVA-.....T
gi|77459367|ref|YP_348874.1|  .---------..........--------.--------------......--------.----.....-
gi|77456472|ref|YP_345977.1|  .---------..........-DADGKLS.GFEVELSEALAKK-......LGVKAKIQ.PTK-.....W
gi|77461451|ref|YP_350958.1|  .----VRMG-..........-VVNWTDV.IATSAMAQVLLDG-......LGYSTKQT.SAS-.....Q
gi|77456590|ref|YP_346095.1|  .---------..........--------.------LQVVLEK-......-GYDCKTD.SLPGn....S
gi|77459062|ref|YP_348568.1|  .---------..........--------.VAAVLEQKGEAATLewl...KGMKANFT.AYRG.....N
gi|77456597|ref|YP_346102.1|  .--KTVRMGV..........--VNWTDV.IATSGMADVLLNG-......LGYESKQT.SAV-.....Q
gi|77456759|ref|YP_346264.1|  .---------..........--------.--------------......--------.----.....-
gi|77461836|ref|YP_351343.1|  .---------..........------LA.NLMTLWAENYKKEY......PNVNIQIQ.AAG-.....S
gi|77459394|ref|YP_348901.1|  .---------..........--------.--------------......---PTTWV.GVAG.....T
gi|77458291|ref|YP_347796.1|  .-----RIGIeagyppfsm.KTPDGKLA.GFDVDIGDALCEQ-......MKVKCTWV.EQE-.....F
gi|77460513|ref|YP_350020.1|  .---------..........KAPDGSIV.GFDYDIGNALCEE-......MKVKCQWV.EQE-.....F
gi|77456539|ref|YP_346044.1|  .---------..........-DASGNVV.GFDKDIGDALCAK-......MKVECSVV.TSD-.....W
gi|77457194|ref|YP_346699.1|  .---TLRIGIeaayppfas.KTDKGEIV.GFDYDIGNALCAQ-......MQVKCVWV.EGE-.....F
gi|77461588|ref|YP_351095.1|  .---------..........--------.--------------......--------.--HS.....G
gi|77459463|ref|YP_348970.1|  .---------..........--------.-------DRAFKKL......DTIKKDIV.WWGG.....G
gi|77456603|ref|YP_346108.1|  .---------..........--KRGEII.GFEVDILKAMTKA-......MGVKLELV.STG-.....Y
gi|77460756|ref|YP_350263.1|  .---------..........GKPVGYSH.DIQLAIVEAIKKDLdl....PNLQVKYN.LVT-.....S
gi|77458562|ref|YP_348067.1|  .---------..........--------.------------KLd.....PQLNLKVI.EIPQ.....G
gi|77456465|ref|YP_345970.1|  .---------..........----GTTA.AFAIPLEAAVEEASk.....QGLKVELV.EFTD.....W
gi|77457097|ref|YP_346602.1|  .---------..........--------.--------------......--------.----.....-
gi|77457032|ref|YP_346537.1|  .---------..........--------.--------------......--------.----.....-
gi|77459005|ref|YP_348511.1|  .---------..........--------.--------------......--------.----.....-
gi|77461345|ref|YP_350852.1|  .---------..........--------.-------DRAFKKL......DELKPNIQ.WWEA.....G
gi|77457437|ref|YP_346942.1|  .---------..........-AADGSLV.GFDIDLGNAICAE-......LKVKCKWV.ESD-.....F
gi|77459166|ref|YP_348672.1|  .---------..........--------.-YGLAATQVLEKLKlt....EATKAKIV.EGQN.....I
gi|77460297|ref|YP_349804.1|  .---------..........--------.------------H-......FGHAVISK.PMAA.....I
gi|77459872|ref|YP_349379.1|  .---------..........--------.--------------......--------.----.....-
gi|77456456|ref|YP_345961.1|  .-------GF..........VNEAGRYV.GFDTDIGRQFAKDLlg....DENKVEFV.AVE-.....P
gi|77461510|ref|YP_351017.1|  .--------YrdasvpfsyvGDHTGQPM.GYSVELADKIVERIkqqlalPELKVKYN.LVT-.....S
gi|77459027|ref|YP_348533.1|  .---------..........-------D.GFDVDVAKAVAER-......LGVKLKLE.TPS-.....-
gi|77459852|ref|YP_349359.1|  .---------..........--------.--------------......--------.----.....-
gi|77457275|ref|YP_346780.1|  .---------..........--------.---YDWVTGFEKE-......TGCKVNVK.TAAT.....S
gi|77461635|ref|YP_351142.1|  .--ETLRIGY..........QKYG----.TLVLLKAKGTLEKRlaa...QGVDVQWT.EFPG.....G
gi|77459314|ref|YP_348821.1|  .---------..........GKLQGFDI.DIARMVAKGLFND-......-PSKVEFV.VQS-.....S
gi|77461680|ref|YP_351187.1|  .------FGS..........VGPDMKPR.GLDIDTAKLLAEQ-......LKVKLELT.PVN-.....S
gi|77459080|ref|YP_348586.1|  .---------..........--------.GLDYDLGNALAER-......LGVKIKWQ.ETG-.....F
gi|77460591|ref|YP_350098.1|  .---------..........--------.--------------......--------.----.....-
gi|77460690|ref|YP_350197.1|  .---------..........--------.--------------......--------.----.....-
gi|77457351|ref|YP_346856.1|  .---------..........--------.--------------......--------.----.....-
gi|77457411|ref|YP_346916.1|  .---------..........--------.YLATLLIGGFMQRH......PESQVKLH.VQN-.....T
gi|77460131|ref|YP_349638.1|  .---------..........--------.--------------......--------.----.....-
gi|77457661|ref|YP_347166.1|  .---------..........--------.--------------......--------.----.....-
gi|77458197|ref|YP_347702.1|  .---------..........--------.--------------......--------.----.....-
gi|77460696|ref|YP_350203.1|  .---------..........------QA.QLADAMAAFVKAY-......PGVNIDLQ.MLD-.....-
gi|77461371|ref|YP_350878.1|  .---------..........--DQSRYQ.GLAADYIDVIRQR-......LAIKLTPI.EPVS.....W
gi|77459516|ref|YP_349023.1|  .---------..........--------.-----------KAL......PQSKVSWV.LSQG.....S
gi|77460858|ref|YP_350365.1|  .---------..........--------.--------------......--------.----.....-
gi|77458661|ref|YP_348167.1|  .-------SV..........-PTTYGHY.RLPAMLARFTRQH-......PQVRVELS.ISNR.....-
gi|77459874|ref|YP_349381.1|  .---------..........--------.--------------......--------.----.....-
gi|77461861|ref|YP_351368.1|  .---------..........--------.-----LFAAFKRQH......PEVNLQLT.VVN-.....R
gi|77458589|ref|YP_348094.1|  .---------..........--------.--------------......--------.----.....-
gi|77460541|ref|YP_350048.1|  .---------..........--------.--------------......--------.----.....-
gi|77458304|ref|YP_347809.1|  .---------..........--------.-------KTFRARY......PNVNVTVN.DVI-.....N
gi|77461122|ref|YP_350629.1|  .---------..........--------.--------------......--------.----.....-
gi|77460036|ref|YP_349543.1|  .---------..........KRPDGGFE.GIDIAMAQTLADS-......LGVKVEWV.QTT-.....W
gi|77457913|ref|YP_347418.1|  .---------..........--------.--------------......--------.----.....-
gi|77458663|ref|YP_348169.1|  .---------..........--------.--------------......--------.----.....-
gi|77456484|ref|YP_345989.1|  .---------..........--YQTTVD.PAKVAQADGAYEKA......TKADINWR.KFDN.....G
gi|77459913|ref|YP_349420.1|  .---------..........--------.--------------......--------.----.....-
gi|77457200|ref|YP_346705.1|  .---------..........---TGKIV.GIDADVCRAVAAAVfg....DATKVKFS.QLN-.....A
gi|77461639|ref|YP_351146.1|  .---------..........----TGID.PSKVPQADGVYEKT......IGEKIDWR.RFNS.....G
gi|77459501|ref|YP_349008.1|  .---------..........--------.--------------......--------.----.....-
gi|77459989|ref|YP_349496.1|  .---------..........--------.--------------......--------.----.....-
gi|77459734|ref|YP_349241.1|  .---------..........-VPSAAYY.FMPSVVARYHRQF-......PRIKVKVL.DSS-.....A
gi|77459646|ref|YP_349153.1|  .---------..........--------.--------------......--------.----.....-
gi|77461911|ref|YP_351418.1|  .---------..........--------.--------------......--------.----.....-
gi|77458595|ref|YP_348100.1|  .---------..........--------.--------------......--------.----.....-
gi|77456947|ref|YP_346452.1|  .---------..........--------.--------------......--------.----.....-
gi|77460224|ref|YP_349731.1|  .---TLSIAT..........-THTQARY.ALPPVISNFIKQY-......PDVALHMH.QGS-.....P
gi|77458091|ref|YP_347596.1|  .---------..........FDTDGRFS.GLVAQLLNLISQR-......SGLTFEVV.RGQS.....L
gi|77460407|ref|YP_349914.1|  .---------..........--------.--------------......--------.----.....-
gi|77458938|ref|YP_348444.1|  .---------..........--------.--------------......--------.----.....-
gi|77458668|ref|YP_348174.1|  .---------..........--------.--------------......--------.----.....-
gi|77459515|ref|YP_349022.1|  .---------..........-----YYN.IRASIEASGVLKD-......APYTVDWK.HFQA.....A
gi|77459029|ref|YP_348535.1|  .---------..........--------.--------------......--------.----.....-
gi|77458115|ref|YP_347620.1|  .---------..........--------.--------------......-QVALDIQ.FLD-.....S
gi|77458299|ref|YP_347804.1|  .---------..........--------.--------------......--------.----.....-
gi|77459590|ref|YP_349097.1|  .---------..........--PTFMAY.LVGPLVRDYVARY-......PGIHLEIF.ELS-.....M
gi|77459139|ref|YP_348645.1|  .---------..........--------.--------------......--------.----.....-
gi|77461503|ref|YP_351010.1|  .---KLRIVTepwapyv...YEQDGKNL.GLDYETTAIVFKR-......LGIEVEWQ.FLP-.....W
gi|77457545|ref|YP_347050.1|  .---------..........--------.-----------EA-......PGIDLQIS.HAS-.....R
gi|77456896|ref|YP_346401.1|  .---------..........--------.--------------......--------.----.....-
gi|77457125|ref|YP_346630.1|  .---------..........----GSDA.LFAGLFAEYRRRY-......PNISVQLL.EGG-.....S
gi|77459733|ref|YP_349240.1|  .----LRVMTs.........GGFTAAYK.ILGPKFAAATGNT-......LDTQLGPS.MGKA.....P
gi|77456439|ref|YP_345944.1|  .---------..........--GGIVDV.LRDQQIFEKAFAD-......QGIKIQWS.FFKGa....G
gi|77457466|ref|YP_346971.1|  .---------..........--------.--------------......--------.----.....-
gi|77458675|ref|YP_348181.1|  .---------..........--------.--------------......--------.----.....-
gi|77457981|ref|YP_347486.1|  .---------..........--------.--------------......--------.----.....-
gi|77459375|ref|YP_348882.1|  .---------..........--------.--------------......--------.----.....-
gi|77458585|ref|YP_348090.1|  .---------..........--------.--------------......--------.----.....-
gi|77461591|ref|YP_351098.1|  .---------..........--------.YYILDLVKTFRERL......PQVEVSVE.IGN-.....S
gi|77458830|ref|YP_348336.1|  .---------..........--------.--------------......--------.----.....-
gi|77458659|ref|YP_348165.1|  .---------..........--------.-------KYLQQQ-......LGMDVQFV.PVAD.....Y
gi|77456943|ref|YP_346448.1|  .---------..........--------.--PEVLADFLREH-......PNLDIDLQ.ELP-.....S
gi|77459507|ref|YP_349014.1|  .---------..........-----VYE.FLPKVIAEARLKQ-......PQVKIDLT.EMN-.....T
gi|77457171|ref|YP_346676.1|  .---------..........--------.--------------......--------.----.....-
gi|77456255|ref|YP_345760.1|  .---------..........--------.--------------......--------.----.....-
gi|77459383|ref|YP_348890.1|  .---------..........--------.-----------KD-......ARYDVQWK.NFTS.....G
gi|77459504|ref|YP_349011.1|  .---------..........--------.--------------......--------.----.....-
gi|77457677|ref|YP_347182.1|  .---------..........--------.-HLPALLARYHKQY......PAVNLQVQ.SGP-.....S
gi|77458588|ref|YP_348093.1|  .---------..........--------.--------------......--------.----.....-
gi|77457164|ref|YP_346669.1|  .---------..........--------.----------F---......--------.----.....-
gi|77456645|ref|YP_346150.1|  .---------..........--------.--------------......--------.----.....-
gi|77461779|ref|YP_351286.1|  .---------..........--------.--------------......--------.----.....-
gi|77457277|ref|YP_346782.1|  .---------..........--------.YYLADLLTRFQRAY......PNVEIRVM.EDE-.....R
gi|77461152|ref|YP_350659.1|  .---TLSIGH..........-TTWVGYG.TLYLAQDLGYFKE-......NGLTVELP.VVEE.....A
gi|77456556|ref|YP_346061.1|  .---------..........--------.--------------......--------.----.....-
gi|77460196|ref|YP_349703.1|  .---------..........--SDGNFR.GISADLLELIRLR-......TGLRFEIR.RSRS.....D
gi|77459903|ref|YP_349410.1|  .---------..........--------.---------C-ERY......PGISVKIE.TGN-.....T
gi|77457685|ref|YP_347190.1|  .---------..........--------.--------------......--------.----.....-
gi|77461155|ref|YP_350662.1|  .---------..........--------.---------FSALY......PGVKIRIR.DGE-.....Q
gi|77457148|ref|YP_346653.1|  .---------..........--------.--------------......--------.----.....-
gi|77457225|ref|YP_346730.1|  .---------..........--------.GFEYELVKRFADD-......LGVELKIE.TADN.....L
gi|77456777|ref|YP_346282.1|  .---------..........--------.--------------......--------.----.....-
gi|77459007|ref|YP_348513.1|  .---------..........--------.--------------......--------.----.....-
gi|77458947|ref|YP_348453.1|  .---------..........--------.--------------......--------.----.....-
gi|77459604|ref|YP_349111.1|  .-------TL..........RNTDGFVE.TFAAALLARIAEEA......PGVRLRFV.QKAD.....K
gi|77457540|ref|YP_347045.1|  .---------..........--------.------------Q-......PQVKTDLE.ERP-.....S
gi|77458467|ref|YP_347972.1|  .---------..........--------.--------------......---RTRVV.PGL-.....S
gi|77460123|ref|YP_349630.1|  .---------..........--------.----------ETH-......PKIELEVE.VMG-.....S
gi|77457570|ref|YP_347075.1|  .---------..........-------Y.AGSQGIVDKWAKK-......YGIKIDVV.QLND.....Y
gi|77456344|ref|YP_345849.1|  .---------..........--------.--------------......--------.----.....-
gi|77457610|ref|YP_347115.1|  .---------..........--------.--------------......--------.----.....-
gi|77458181|ref|YP_347686.1|  .---------..........--------.--------------......--------.----.....-
gi|77459944|ref|YP_349451.1|  .---------..........--------.--------------......--------.----.....-
gi|77461472|ref|YP_350979.1|  .---------..........--------.--------------......--------.----.....-
gi|77460767|ref|YP_350274.1|  .---------..........--------.--------------......-------A.SGF-.....S
gi|77458891|ref|YP_348397.1|  .-----RIGL..........-SDDVEFA.LLPMLLKRLRAEA-......PGIVLVVR.RVN-.....Y
gi|77460119|ref|YP_349626.1|  .---------..........--------.--------------......--------.----.....-
gi|77459497|ref|YP_349004.1|  .---------..........----STAA.VRIPGLLATYNQQH......PKVDLDLS.TGP-.....S
gi|77456366|ref|YP_345871.1|  .---------..........--------.-----RDQGLIEKYgkqeg.LDIKVDWT.QLSG.....G
gi|77459144|ref|YP_348650.1|  .---TLRIGS..........FGPTSSIK.LLPRILQQYREAH-......PGIEVHID.EGP-.....D
gi|77456369|ref|YP_345874.1|  .---------..........--------.--------------......-----ELR.FVPE.....G
gi|77457630|ref|YP_347135.1|  .---------..........--------.--------------......PRVEIELV.ADT-.....S
gi|77457486|ref|YP_346991.1|  .---------..........--------.---PRLADFNAKY-......PNIHVELL.----.....P
gi|77460216|ref|YP_349723.1|  .---------..........--------.--------------......--------.----.....-
gi|77461386|ref|YP_350893.1|  .------IG-..........-VLQTVHTsLVPQMLERVRKAQ-......PHLVVQIY.ELT-.....G
gi|77458645|ref|YP_348151.1|  .---------..........--------.--------------......--------.----.....-
gi|77459746|ref|YP_349253.1|  .---------..........--------.-----------DR-......PNVHVALY.NLS-.....S
gi|77458091|ref|YP_347596.1|  .---------..........--------.-LTADYADAIAQI-......LNIDVEVW.CHAN.....R
gi|77461610|ref|YP_351117.1|  .---------..........--DGDTLT.GFEVELGQLLANE-......LDVRADFI.VTD-.....E
gi|77456717|ref|YP_346222.1|  .---------..........--------.--------------......--------.----.....-
gi|77456922|ref|YP_346427.1|  .---------..........--------.--------------......--------.----.....-
gi|77458189|ref|YP_347694.1|  .---------..........--------.-------RQLQEEA......PGIVVVVR.RAN-.....Y
gi|77461512|ref|YP_351019.1|  .---------..........--------.----AIQQWTAQF-......PDIACELS.SAH-.....S
gi|77458795|ref|YP_348301.1|  .---------..........-----FEI.AYGRRLIEEIARRA......PKLRLIFR.QTH-.....S
gi|77459527|ref|YP_349034.1|  .---------..........--------.--------------......--------.----.....-
gi|77460812|ref|YP_350319.1|  .---TLRLCH..........SSTVPISG.RLLRDMSAYLEQQ-......PGVSLDIG.TLS-.....S
gi|77458380|ref|YP_347885.1|  .---------..........--------.-------Q------......--------.----.....-
gi|77457256|ref|YP_346761.1|  .---------..........--------.--------HISTM-......TGLQFVHQ.ESFS.....T
gi|77458417|ref|YP_347922.1|  .---------..........--------.--------------......--------.----.....-
gi|77461348|ref|YP_350855.1|  .---------..........--------.---VEVMKALARA-......LNVELSWR.NFQD.....L
gi|77459904|ref|YP_349411.1|  .---------..........--------.----------ARY-......PGITVNLR.LGN-.....A
gi|77460196|ref|YP_349703.1|  .---------..........---GHDYE.GFTADYAVLVGQA-......IGLPIRVK.RFAS.....R
gi|77459579|ref|YP_349086.1|  .--------V..........GVTEGLGI.MFLASRMIGLFERY......LGLEVELV.AVPR.....F
gi|77456509|ref|YP_346014.1|  .---------..........-------F.DALPLMQRLHAQH-......PNLRFELS.SLS-.....S
gi|77460531|ref|YP_350038.1|  .---------..........--------.--------------......--------.----.....-
gi|77458432|ref|YP_347937.1|  .---------..........---GIGYL.ILDVVRDQQLIEKHgkaqg.LDIKVDWN.SISG.....A
gi|77458685|ref|YP_348191.1|  .----VTFQVg.........LSDDVEYA.LLPRLLRQLRSEA-......PNIALVVL.RVD-.....Q
gi|77456796|ref|YP_346301.1|  .---------..........--------.--------------......--------.----.....-
gi|77456443|ref|YP_345948.1|  .---------..........--------.--------------......--------.----.....-
gi|77456440|ref|YP_345945.1|  .---------..........--------.--------------......--------.----.....-
gi|77461514|ref|YP_351021.1|  .---------..........--------.--------------......--------.----.....-
gi|77457657|ref|YP_347162.1|  .---------..........--------.--------------......--------.----.....-
gi|77460336|ref|YP_349843.1|  .---------..........--------.-ASADLLQQVAKE-......LGIKVDLL.YAGK.....R
gi|77458953|ref|YP_348459.1|  .---------..........--------.--------------......--------.----.....-
gi|77460693|ref|YP_350200.1|  .---------..........--------.--------------......--------.----.....-
gi|77457612|ref|YP_347117.1|  .---------..........--------.--------------......--------.----.....-
gi|77458012|ref|YP_347517.1|  .---------..........-------A.SLVVAATQGFAQP-......YGLTLNLK.RQSS.....W
gi|77461737|ref|YP_351244.1|  .---------..........--------.--------------......--------.----.....-
gi|77459929|ref|YP_349436.1|  .---------..........--------.--------------......--------.----.....-
gi|77458950|ref|YP_348456.1|  .---------..........--------.--------------......--------.----.....-
gi|77458596|ref|YP_348101.1|  .---------..........--------.--------------......--------.----.....-
gi|77460559|ref|YP_350066.1|  .---------..........--------.--------------......--------.----.....-
gi|77460164|ref|YP_349671.1|  .---------..........----GADT.GLLPELVAALNSAQ......SDYRFELV.PTS-.....I
gi|77460025|ref|YP_349532.1|  .---------..........--------.------LAGFTRSH......PQARLETV.SGM-.....S
gi|77458799|ref|YP_348305.1|  .---------..........AVDQSVLQ.RVADAIRRFRKRD-......ESVRIELI.SAM-.....P
gi|77459649|ref|YP_349156.1|  .---------..........--------.--------------......--------.----.....-
gi|77456330|ref|YP_345835.1|  .---------..........--------.--------------......--------.----.....-
gi|77456912|ref|YP_346417.1|  .---------..........-LVTLPHM.RITHALAQLKERG-......PDVQIQIR.MIA-.....P
gi|77458376|ref|YP_347881.1|  .---------..........--------.-----GLSGIFPE-......--LKYSLS.SLS-.....S
gi|77460214|ref|YP_349721.1|  .---------..........--------.--------------......--------.----.....-
gi|77460544|ref|YP_350051.1|  .---------..........--------.--------------......--LELECL.IAE-.....C
gi|77461845|ref|YP_351352.1|  .---------..........--------.FFPRWIAQLRNEG-......LNIATRLV.ATN-.....V
gi|77458031|ref|YP_347536.1|  .---------..........--------.--------------......--------.----.....-
gi|77460241|ref|YP_349748.1|  .---------..........--------.-------NGHARDG......QEITLKII.PKA-.....K
gi|77459350|ref|YP_348857.1|  .---------..........--------.--------------......--------.----.....-
gi|77461233|ref|YP_350740.1|  .---------..........--------.--------------......--------.----.....-
gi|77458508|ref|YP_348013.1|  .---------..........--------.--------------......--------.----.....-
gi|77460704|ref|YP_350211.1|  .---------..........--------.--------------......--------.----.....-
gi|77459076|ref|YP_348582.1|  .---------..........--------.--------------......--------.----.....-
gi|77459000|ref|YP_348506.1|  .---------..........--------.--------------......--------.----.....-
gi|77458730|ref|YP_348236.1|  .---------..........--------.--------------......--------.----.....-
gi|77460545|ref|YP_350052.1|  .---------..........--------.--------------......--------.----.....-
gi|77457580|ref|YP_347085.1|  .---------..........--------.----------NEKLlt....KPMRVTYM.PGGV.....G
gi|77456527|ref|YP_346032.1|  .---------..........--------.--------------......--YQMEFS.YAE-.....S
gi|77457259|ref|YP_346764.1|  .---------..........--------.--------------......--------.---G.....-
gi|77460567|ref|YP_350074.1|  .---------..........--------.--------------......--------.----.....-


                                    50                 60           70        80            90      
                                     |                  |            |         |             |      
d1us5a_                         VANINAIN.AGE..FEM......ALAQN...DIAYYAYQGCCIPAFEGKP...VKT.IRALA..ALY.
gi|77457042|ref|YP_346547.1|  GEYIKRTK.NGE..HDI......SLIGW...T------------------...---.-----..---.
gi|77457043|ref|YP_346548.1|  DDNTVRFN.LNN..VDA......AFVQN...LAMSFASV-------QSAE...---.--YAA..QLL.
gi|77457040|ref|YP_346545.1|  GEMLKRAK.AGE..HDM......VSAGW...-------------------...---.-----..---.
gi|77461759|ref|YP_351266.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458408|ref|YP_347913.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458409|ref|YP_347914.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459295|ref|YP_348802.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459963|ref|YP_349470.1|  AQYINRLN.ARD..YDM......IVTS-...-------------------...---.-----..---.
gi|77459342|ref|YP_348849.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461625|ref|YP_351132.1|  SKYIGDLA.NGD..ICV......AIGFS...GDIFQAKN-----------...---.-----..---.
gi|77458344|ref|YP_347849.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459054|ref|YP_348560.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461852|ref|YP_351359.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461626|ref|YP_351133.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459482|ref|YP_348989.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458902|ref|YP_348408.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458800|ref|YP_348306.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459754|ref|YP_349261.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456422|ref|YP_345927.1|  RAVIDGLR.ADV..VTL......ALAGD...IDEIAKLG-------KTLPadwQKR.LPDAS..TPY.
gi|77458599|ref|YP_348104.1|  ETLEAKML.SGGsgYDL......IFPGD...TVAERLMR-----------...---.-----..---.
gi|77461708|ref|YP_351215.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457818|ref|YP_347323.1|  SKQARSVI.DGLp.ADV......ITMNM...ATDINALADNGQLVPKDWV...---.TRLPNnsAPF.
gi|77456295|ref|YP_345800.1|  VQPNVQVA.EKR..LDA......NFFQH...QPYLDEFN-----KAKGTS...---.LVSVT..GVH.
gi|77458382|ref|YP_347887.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456253|ref|YP_345758.1|  PITFGGLK.DGQ..VDV......FLGNW...MPAQQGFYDKFVATG---D...---.VTQLA..KNLd
gi|77461459|ref|YP_350966.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456451|ref|YP_345956.1|  VQPNVQVG.EKR..LDA......NYFQT...KPYLDSFNAGKYKDDKAK-...--Y.LVTVQ..GVH.
gi|77459541|ref|YP_349048.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460565|ref|YP_350072.1|  PAWVKAAA.EGK..VFGlgdtvkGATEG...WWVPEYVI-------KGDP...ERG.IKPLA..P--.
gi|77461651|ref|YP_351158.1|  VAVLEAIN.AGQ..CDV......GIVNT...YYYGRLHK-----------...---.-----..---.
gi|77458865|ref|YP_348371.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457833|ref|YP_347338.1|  GIMWQGVA.TGK..LDA......MLSAW...LPVTHGEY-------WTKN...KDQ.VVDYG..PNFk
gi|77459367|ref|YP_348874.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456472|ref|YP_345977.1|  DGILAALE.SKR..LDV......VVNQV...TISEERKK----------K...---.YDFSE..PYT.
gi|77461451|ref|YP_350958.1|  QIVFAGIR.DQR..LDL......FLGYW...NPLMTQTI-TPFVDANQVK...---.VLEAP..SLK.
gi|77456590|ref|YP_346095.1|  ITMENALS.SND..IQI......FAEEW...VGRSEVWN-------KAEK...AGK.VVGVGa.PVV.
gi|77459062|ref|YP_348568.1|  SSVLKAVN.AGQ..VDS......GVIYH...YYAFVDQAKTGE-------...---.-----..---.
gi|77456597|ref|YP_346102.1|  QIIFAGIR.DKR..LDI......FLGYW...KPAMDKNIAPFLAA-NQVK...---.VMDKP..SLA.
gi|77456759|ref|YP_346264.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461836|ref|YP_351343.1|  ATAPPALT.EGT..SNL......GPMSRkmkDTELAAFE-------QKYG...---.YKPTAi.PVA.
gi|77459394|ref|YP_348901.1|  ADVATQVN.AVD..GSI......GYVGP...DGVNAASN-----------...---.-----..---.
gi|77458291|ref|YP_347796.1|  DGLIPALK.VKK..IDA......ILSSM...TITDDRKK----------N...---.VDFTI..KYY.
gi|77460513|ref|YP_350020.1|  DGLIPALK.VRK..IDA......ILSSM...SITDDRKK----------S...---.VDFTN..KYY.
gi|77456539|ref|YP_346044.1|  DGIIPALN.AKK..FDF......LISSM...SITDERKG----------A...---.VDFTD..PYY.
gi|77457194|ref|YP_346699.1|  DGLIPSLK.VKK..IDM......ALSSM...TINEDRKK----------S...---.VDFTH..KYY.
gi|77461588|ref|YP_351095.1|  SKPCKLAA.AGE..FPI......GISFE...YPAVQLKR-------QGAP...---.LDIIL..---.
gi|77459463|ref|YP_348970.1|  AQSQQLLA.SGE..ASM......GQFWN...GRIHALQE-------DGAP...---.VGVSW..KQNl
gi|77456603|ref|YP_346108.1|  DGIIPALM.TDK..FDM......IGSGM...TLTQERNL----------R...---.LNFSE..PFI.
gi|77460756|ref|YP_350263.1|  QTRIPLVQ.NGT..VDV......ECGST...TNNVERQQ----------Q...---.VDFSV..GIF.
gi|77458562|ref|YP_348067.1|  VNSNELLV.HGD..VDA......NYFQH...LPYLQSQE-------KALG...-EK.LAVAA..TVH.
gi|77456465|ref|YP_345970.1|  IAPNVSLA.AGD..IDV......NYFQH...IPFLENAK-----AASGFD...---.LVPFA..PGI.
gi|77457097|ref|YP_346602.1|  --------.---..---......-----...-------------------...---.--Q--..---.
gi|77457032|ref|YP_346537.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459005|ref|YP_348511.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461345|ref|YP_350852.1|  AQPPQYLA.SGD..VVM......SSAYN...GRIAAVQK--------ESN...---.LKVVW..N--.
gi|77457437|ref|YP_346942.1|  DGMIPGLK.ANK..FDG......VISSM...TVTEAREK----------V...---.IDFSS..ELF.
gi|77459166|ref|YP_348672.1|  TQAYQFVS.TGN..AEL......GFVAL...SQ-----------------...---.-----..---.
gi|77460297|ref|YP_349804.1|  DEVFREVA.AGA..VNF......GVVPV...ENS----------------...---.-----..---.
gi|77459872|ref|YP_349379.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456456|ref|YP_345961.1|  ASRIPFLQ.SDK..VDL......ILANM...TVTPERKE----------A...---.VEFTN..PNL.
gi|77461510|ref|YP_351017.1|  QTRIPLVQ.NGT..VDL......ECGST...GVTAERQK----------Q...---.VAFSY..GFI.
gi|77459027|ref|YP_348533.1|  WDVIAAGRwNGR..YDI......CVCSM...TPSKARAE----------V...---.FDFPV..EYY.
gi|77459852|ref|YP_349359.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457275|ref|YP_346780.1|  DEMVSLMA.KGG..YDL......VTASG...DASLRLIV-----------...---.-----..---.
gi|77461635|ref|YP_351142.1|  PQLLEGLN.VGS..IDF......GVTGE...TPPVFAQA-------AGAD...---.LLYVA..YEPp
gi|77459314|ref|YP_348821.1|  DARIPNLL.TDK..VDM......SCQFI...TVTASRAQ----------Q...---.VAFTL..PYY.
gi|77461680|ref|YP_351187.1|  TNRIPFLT.TGK..VDL......VISSL...GKNPEREK----------V...---.IDFSR..AYA.
gi|77459080|ref|YP_348586.1|  EQMINALT.TER..VDM......VLSGM...TDTAERQA----------S...---.VTFVD..YFT.
gi|77460591|ref|YP_350098.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460690|ref|YP_350197.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457351|ref|YP_346856.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457411|ref|YP_346916.1|  ANIVQQVA.HYE..IDL......GLIEG...DCSHPDIEVQSWV------...---.-EDEL..VVF.
gi|77460131|ref|YP_349638.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457661|ref|YP_347166.1|  --------.---..---......-----...------------------E...---.-----..---.
gi|77458197|ref|YP_347702.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460696|ref|YP_350203.1|  --RTVNLV.DER..IDL......AIRT-...-------------------...---.-----..---.
gi|77461371|ref|YP_350878.1|  TVVLEQAK.NGT..IDL......LPGIM...S-TPERQS----------Y...---.LSFTR..PYL.
gi|77459516|ref|YP_349023.1|  NRSLEYLN.SGG..VDF......ASSAS...LAAVLSRA-------NGSP...---.IKSVY..VYSr
gi|77460858|ref|YP_350365.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458661|ref|YP_348167.1|  --------.--N..VDL......VAE--...-------------------...---.-----..---.
gi|77459874|ref|YP_349381.1|  ---TKELA.AGR..LDF......AVDAP...LNT----------------...---.-----..---.
gi|77461861|ref|YP_351368.1|  GQVIRRLS.DNR..DDL......VIMSM...VPQDMGLE-----------...---.---FL..PFL.
gi|77458589|ref|YP_348094.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460541|ref|YP_350048.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458304|ref|YP_347809.1|  EQVLEMVR.DRQ..VEL......GVAFE...P------------------...MQNtSLMFT..PLY.
gi|77461122|ref|YP_350629.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460036|ref|YP_349543.1|  KTLMPDMQ.AGK..CDI......GVGGI...SVTLERQK----------K...---.AFFSN..TLD.
gi|77457913|ref|YP_347418.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458663|ref|YP_348169.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456484|ref|YP_345989.1|  ADIIAAIA.SGD..VQI......GYLGS...SPLTAAIT-------RKVP...VE-.TFLIA..TQI.
gi|77459913|ref|YP_349420.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457200|ref|YP_346705.1|  KERFTALQ.SGE..IDI......LSRNT...TMTSSRDA--------GMG...---.LKFPGf.ITY.
gi|77461639|ref|YP_351146.1|  PEVVTAIA.SGD..VQI......GNLGS...SPLAAAAS-------RNLP...---.IVAFI..VSAq
gi|77459501|ref|YP_349008.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459989|ref|YP_349496.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459734|ref|YP_349241.1|  HDVLSAVV.NGE..ADF......GLSFM...GTQE-----------AGVD...---.-----..---.
gi|77459646|ref|YP_349153.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461911|ref|YP_351418.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458595|ref|YP_348100.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456947|ref|YP_346452.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460224|ref|YP_349731.1|  MQIAEMAA.DGT..VDF......AIATE...ALELFG-------------...---.DLVMM..PCY.
gi|77458091|ref|YP_347596.1|  DRQVEQLR.NGE..LDL......LPVMT...PS----RE-------RETQ...---.MLFTR..SYA.
gi|77460407|ref|YP_349914.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458938|ref|YP_348444.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458668|ref|YP_348174.1|  ------FR.KGG..IDA......AIRYG...D--------------GNWP...--G.LRADW..LMA.
gi|77459515|ref|YP_349022.1|  APLAEALQ.TGS..LDL......GFLGD...SGFLFLAA-------KQAP...---.VKLIG..VSRq
gi|77459029|ref|YP_348535.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458115|ref|YP_347620.1|  EVAYEEIL.HGR..AEL......AVITL...AP-------------EPHT...---.LVKAT..PVW.
gi|77458299|ref|YP_347804.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459590|ref|YP_349097.1|  DDIEAGLA.DDS..LDI......AIAFT...PV-------------RN-P...---.DIECI..PAF.
gi|77459139|ref|YP_348645.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461503|ref|YP_351010.1|  KRCLSMLE.TGQ..ADG......ALDIF...H-------------SDERD...ATL.LYPSE..PLS.
gi|77457545|ref|YP_347050.1|  EGMVEGLL.NGD..IDL......A----...-------------------...---.-----..---.
gi|77456896|ref|YP_346401.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457125|ref|YP_346630.1|  RNIEQAVL.SGE..LEL......GG---...-------------------...---.-----..---.
gi|77459733|ref|YP_349240.1|  EAIPNRLA.RGEk.ADV......VIMVG...YALDDLIK-------QGKV...--D.PASRV..ELA.
gi|77456439|ref|YP_345944.1|  PVINEAFA.NGQ..VDL......AYLGD...LAAIIGKS-------NGLD...---.TRLLS..ASAr
gi|77457466|ref|YP_346971.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458675|ref|YP_348181.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457981|ref|YP_347486.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459375|ref|YP_348882.1|  ---APLLR.SDN..YDL......LLASA...L------------------...---.-----..---.
gi|77458585|ref|YP_348090.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461591|ref|YP_351098.1|  QQVLEALE.DYR..VDV......AASSQ...L------------------...LDD.ARLIR..RVLg
gi|77458830|ref|YP_348336.1|  -----TLI.NRR..VDL......ITEGI...DVALRVRE-------HG-D...EEP.MLVTR..RLR.
gi|77458659|ref|YP_348165.1|  PAVVEALA.TDR..LDL......AWLGG...FTFVQARLK------TGNA...---.IPLVQ..REQd
gi|77456943|ref|YP_346448.1|  TRITHALR.QGA..ADL......GIVSD...AI-----------------...---.-----..---.
gi|77459507|ref|YP_349014.1|  YQQHEALR.ARR..IDL......GIVRA...PLLEPGYA-------TECL...---.VREPF..VLAv
gi|77457171|ref|YP_346676.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456255|ref|YP_345760.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459383|ref|YP_348890.1|  APLTNEMV.AGK..LDF......GAMAD...FPGAFNGV---AFETAGKH...---.SLFIS..VLSg
gi|77459504|ref|YP_349011.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457677|ref|YP_347182.1|  GELLEGLL.TGR..LDA......ALVDG...PPQLAGID--------GVP...---.-----..-LC.
gi|77458588|ref|YP_348093.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457164|ref|YP_346669.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456645|ref|YP_346150.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461779|ref|YP_351286.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457277|ref|YP_346782.1|  PYIEHLLV.SGE..IDV......GVLIL...SNLEDR-------------...---.-----..---.
gi|77461152|ref|YP_350659.1|  SMYMAAQA.SGQ..LSG......SASTI...DEVLKYRP--------QFC...---.FKAVA..ALDd
gi|77456556|ref|YP_346061.1|  --------.---..---......-----...------------------L...---.FKWVG..PIG.
gi|77460196|ref|YP_349703.1|  AEMIKQVE.HHQ..ADL......IAALL...PT-AQREE----------T...---.LNFSR..PYL.
gi|77459903|ref|YP_349410.1|  DESLFRLF.NYQ..ADL......ALLGR...DVSDE--------------...---.RLLCV..PLR.
gi|77457685|ref|YP_347190.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461155|ref|YP_350662.1|  QELVQGLT.SGT..FDL......AILY-...-------------------...---.-----..---.
gi|77457148|ref|YP_346653.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457225|ref|YP_346730.1|  DDLFNQVG.KPN..GPV......LAAAG...L---------VSSEQRKKQ...---.VRFSR..SYLe
gi|77456777|ref|YP_346282.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459007|ref|YP_348513.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458947|ref|YP_348453.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459604|ref|YP_349111.1|  --DSTLLR.VGR..VDL......ETG--...-------------------...---.-----..---.
gi|77457540|ref|YP_347045.1|  AGVVQGVL.DGV..ADL......GICSS...DSDIKGLH-----------...---.-----..---.
gi|77458467|ref|YP_347972.1|  MELVNLVD.TGE..IDM......AAIIR...PPFSLQSD-----------...---.-LRWT..TLA.
gi|77460123|ref|YP_349630.1|  SNIISSLL.QKT..ATV......GVGL-...-------------------...---.-----..---.
gi|77457570|ref|YP_347075.1|  VESINQYT.AGQ..FDG......CTMTN...MDALTIPA-------AG-G...VDS.TALIV..SDFs
gi|77456344|ref|YP_345849.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457610|ref|YP_347115.1|  ---PDLLA.AGD..ITV......GISQT...R------------------...---.-----..---.
gi|77458181|ref|YP_347686.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459944|ref|YP_349451.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461472|ref|YP_350979.1|  -RALMGVG.EGR..YDV......LVNAW...Y--------------NDER...TKL.GQFSA..EYL.
gi|77460767|ref|YP_350274.1|  FAPLPALA.RGD..LDL......VVTSD...PLEIAGITYVPLF------...---.-----..---.
gi|77458891|ref|YP_348397.1|  ILMPGLLA.SGE..ISI......GVSYT...TDLPA--------------...---.-----..---.
gi|77460119|ref|YP_349626.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459497|ref|YP_349004.1|  GTMIDGVL.SGR..LAA......AFVDG...PVLHPALEGIPAFEE---E...---.MVIIS..PLH.
gi|77456366|ref|YP_345871.1|  AAVNDALL.SGS..IDI......AGAGV...GPLLTIWD-------RTHG...KQN.VKAVA..SLG.
gi|77459144|ref|YP_348650.1|  RQVIQWLE.ERR..IDI......GFVV-...-------------------...---.-----..---.
gi|77456369|ref|YP_345874.1|  DGDDEALR.EGR..IDL......SVSNT...RPVT---------------...---.-----..---.
gi|77457630|ref|YP_347135.1|  LNLCDQLQ.KGF..LDL......ILQTD...LVRQE-------------S...---.VRSLE..LAS.
gi|77457486|ref|YP_346991.1|  AVQLADVD.AGE..VDL......AIRYG...-------------------...---.-----..---.
gi|77460216|ref|YP_349723.1|  --------.---..---......-----...---------------R---...---.-----..---.
gi|77461386|ref|YP_350893.1|  LEIERRLL.NGS..LDI......GISYL...PPRQPGLHGV---------...---.-----..MLY.
gi|77458645|ref|YP_348151.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459746|ref|YP_349253.1|  AEQLEGLR.QRS..LDI......ALVSE...PPTID--------------...---.-----..---.
gi|77458091|ref|YP_347596.1|  ASAMAALK.AGE..VDL......LGTSN...NFEIADPE-----------...---.LMLSR..AYA.
gi|77461610|ref|YP_351117.1|  ADLLQGVE.SGK..YDV......ALNHI...ALTPELKD----------R...---.FDVSE..PYT.
gi|77456717|ref|YP_346222.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456922|ref|YP_346427.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458189|ref|YP_347694.1|  LLMPGLLA.SGE..ISV......GVSYT...TDLPA--------------...---.-----..---.
gi|77461512|ref|YP_351019.1|  RELMQNLL.MRE..VDV......ALTLQ...LPDHPGL------------...---.-----..---.
gi|77458795|ref|YP_348301.1|  QIVARALM.ERS..IDL......AITAG...GFAE---------------...---.-----..---.
gi|77459527|ref|YP_349034.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460812|ref|YP_350319.1|  EAQLEELA.EGR..LDI......GLLRL...P--VLRQR-------EGVQ...---.---VV..PLY.
gi|77458380|ref|YP_347885.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457256|ref|YP_346761.1|  DHMLERLQ.SGV..ADI......STTLA...M------N-----DERKVF...---.LDFSH..AFG.
gi|77458417|ref|YP_347922.1|  --------.---..---......AIVDP...FTALGARA-------GGLD...---.-----..---.
gi|77461348|ref|YP_350855.1|  AQLEAAAR.DGE..IDI......APGLT...QTP----------------...---.-----..---.
gi|77459904|ref|YP_349411.1|  QETLAALL.SEH..ADV......AVLTE...VEP--------------RK...---.GLHLQ..ALS.
gi|77460196|ref|YP_349703.1|  EAAIRALI.DGH..IDM......LGTAN...G-----------FEAENAD...---.IVLSR..PYA.
gi|77459579|ref|YP_349086.1|  VSIL----.---..---......-----...-------------------...---.-----..---.
gi|77456509|ref|YP_346014.1|  EQVLEQLA.NNR..IDI......GVSYL...D------------------...---.-----..---.
gi|77460531|ref|YP_350038.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458432|ref|YP_347937.1|  TAMNEALL.TGS..LDV......VSAGV...PPMLTVWD-------RTKG...KQN.VKAIA..SLG.
gi|77458685|ref|YP_348191.1|  QQMSQRLF.NGE..ISL......GISPT...LDLP---------------...---.-----..---.
gi|77456796|ref|YP_346301.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456443|ref|YP_345948.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456440|ref|YP_345945.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461514|ref|YP_351021.1|  --------.---..---......-----...-------------------...---.----I..PLF.
gi|77457657|ref|YP_347162.1|  -GVEEVLL.EGV..ADL......AITGL...SIPGYLGA----------E...LSD.VEFVA..VAH.
gi|77460336|ref|YP_349843.1|  SQALDEVR.SGR..MDM......LADAP...LTFNELE------------...--N.LDYIHp.PLL.
gi|77458953|ref|YP_348459.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460693|ref|YP_350200.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457612|ref|YP_347117.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458012|ref|YP_347517.1|  ANLRDNLV.SGE..LDA......AHSLY...GLIYAVHLGIGGV-----A...PTD.MAVLM..GLN.
gi|77461737|ref|YP_351244.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459929|ref|YP_349436.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458950|ref|YP_348456.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458596|ref|YP_348101.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460559|ref|YP_350066.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460164|ref|YP_349671.1|  PRRFGDFK.DGR..TDM......AIFEN...PEWGW----------KDIP...---.HTTVD..MGL.
gi|77460025|ref|YP_349532.1|  LDLRQRLD.SGE..IDI......ALI--...-------------------...---.-----..---.
gi|77458799|ref|YP_348305.1|  GEMERLLL.QQR..LDL......AIGYF...SQVQSAFDYRELF------...---.-----..---.
gi|77459649|ref|YP_349156.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456330|ref|YP_345835.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77456912|ref|YP_346417.1|  NEVEQGVL.DGR..LHV......GVVPQ...ASALSGLEYQP--------...---.-----..---.
gi|77458376|ref|YP_347881.1|  DEIIEGLG.NNQ..LDL......GVCYL...DHVN---------------...---.-----..---.
gi|77460214|ref|YP_349721.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460544|ref|YP_350051.1|  DDLVELVQ.RGR..AHL......AFAEM...Q--------------DNYP...PD-.LATAT..VAE.
gi|77461845|ref|YP_351352.1|  GDAVHALR.EGG..CDL......MLAFY...DPDAAMQM-------DP-E...---.IFPSL..HLG.
gi|77458031|ref|YP_347536.1|  -QVLDKLL.AGR..YRY......AVSNQ...WALDWFNQ-------RLLP...GQQ.LQAVA..VLQ.
gi|77460241|ref|YP_349748.1|  DQLLGALQ.RGE..GDL......VAPGE...LLEL--QP--------GHA...---.VASSE..PIAs
gi|77459350|ref|YP_348857.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77461233|ref|YP_350740.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458508|ref|YP_348013.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460704|ref|YP_350211.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459076|ref|YP_348582.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77459000|ref|YP_348506.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77458730|ref|YP_348236.1|  --------.---..---......-----...-------------------...---.-Q---..---.
gi|77460545|ref|YP_350052.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77457580|ref|YP_347085.1|  AVAYNAVV.AQRp.ADAgtlv..AWSSG...SLLNLAQGKFGRF-----D...ETN.VRWLA..AVG.
gi|77456527|ref|YP_346032.1|  MENLSKLK.NED..FDL......AV---...-------------------...---.-----..---.
gi|77457259|ref|YP_346764.1|  --------.---..---......-----...-------------------...---.-----..---.
gi|77460567|ref|YP_350074.1|  --------.---..---......-----...-------------------...---.-----..---.


                                           100                                      110             
                                             |                                        |             
d1us5a_                         ...PEVVH....VVA.RK...D..............AG..IR.....T......VAD.L.........
gi|77457042|ref|YP_346547.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457043|ref|YP_346548.1|  ...K----....---.--...-..............--..EG.....H......AAD.L.........
gi|77457040|ref|YP_346545.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461759|ref|YP_351266.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458408|ref|YP_347913.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458409|ref|YP_347914.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459295|ref|YP_348802.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459963|ref|YP_349470.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459342|ref|YP_348849.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461625|ref|YP_351132.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458344|ref|YP_347849.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459054|ref|YP_348560.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461852|ref|YP_351359.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461626|ref|YP_351133.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459482|ref|YP_348989.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458902|ref|YP_348408.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458800|ref|YP_348306.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459754|ref|YP_349261.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456422|ref|YP_345927.1|  ...TSTIV....FLV.RK...Gnp............KG..IK.....D......WGD.L.........
gi|77458599|ref|YP_348104.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461708|ref|YP_351215.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457818|ref|YP_347323.1|  ...TSATV....FIV.RK...Gnp............KA..LK.....D......WPD.Llk.......
gi|77456295|ref|YP_345800.1|  ...LEPLG....AYS.--...-..............SK..FK.....K......IEE.Lp........
gi|77458382|ref|YP_347887.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456253|ref|YP_345758.1|  ...GTEFT....LAV.PDyvwD..............AG..VH.....N......FAD.Lnkyadk...
gi|77461459|ref|YP_350966.1|  ...-----....---.--...D..............KG..LH.....D......FAD.Iakfkkel..
gi|77456451|ref|YP_345956.1|  ...VEPFG....GY-.--...S..............SK..YK.....T......LAE.Lp........
gi|77459541|ref|YP_349048.1|  ...-----....---.--...-..............-D..LR.....S......VSD.Lkkykdvfkd
gi|77460565|ref|YP_350072.1|  ...-----....---.--...-..............-E..LK.....S......VAD.Lprykdvfkd
gi|77461651|ref|YP_351158.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458865|ref|YP_348371.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457833|ref|YP_347338.1|  ...DAKIG....LIV.PE...Y..............VK..AK.....T......IED.Lktddsf...
gi|77459367|ref|YP_348874.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456472|ref|YP_345977.1|  ...VSGIQ....ALV.LK...Dkaaa..........LN..IK.....S......AAD.L.........
gi|77461451|ref|YP_350958.1|  ...DARAT....LAV.PTylaD..............KG..LK.....T......FAD.Iakfekel..
gi|77456590|ref|YP_346095.1|  ...GAIEG....WYV.PR...YviegdakrkleakaPD..LK.....N......IAD.Lgkysaifkd
gi|77459062|ref|YP_348568.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456597|ref|YP_346102.1|  ...DAQAT....LAV.PD...Yvaa...........AG..LK.....T......FGD.Iakfkdql..
gi|77456759|ref|YP_346264.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461836|ref|YP_351343.1|  ...VDALA....VFV.HK...D..............NP..IQ.....H......---.-.........
gi|77459394|ref|YP_348901.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458291|ref|YP_347796.1|  ...HTPAR....FVM.KA...G..............SG..VK.....Dp.....LTE.L.........
gi|77460513|ref|YP_350020.1|  ...NTPAR....LVM.KE...G..............TQ..VSe....G......LAE.L.........
gi|77456539|ref|YP_346044.1|  ...SNKLQ....FIA.PK...D..............KE..FK.....T......DKDsL.........
gi|77457194|ref|YP_346699.1|  ...FTSSR....LVM.KE...G..............AS..VDd....Q......YAS.L.........
gi|77461588|ref|YP_351095.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459463|ref|YP_348970.1|  ...VMADI....LVV.PK...G..............SK..NK.....D......---.-.........
gi|77456603|ref|YP_346108.1|  ...VVGQT....LLI.RK...Ele............GT..IK.....S......YKD.Lnt.......
gi|77460756|ref|YP_350263.1|  ...EIGTR....LLS.KA...D..............SK..YK.....D......FDD.L.........
gi|77458562|ref|YP_348067.1|  ...IEPLG....IYS.HR...H..............--..-K.....T......FAQ.V.........
gi|77456465|ref|YP_345970.1|  ...INNVG....LYS.KK...-..............--..YK.....S......FDE.Lp........
gi|77457097|ref|YP_346602.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457032|ref|YP_346537.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459005|ref|YP_348511.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461345|ref|YP_350852.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457437|ref|YP_346942.1|  ...SGPTA....YVS.KK...G..............SG..ITd....D......VAS.L.........
gi|77459166|ref|YP_348672.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460297|ref|YP_349804.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459872|ref|YP_349379.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456456|ref|YP_345961.1|  ...KVAVQ....ALV.PQ...G..............SE..VK.....K......LDD.L.........
gi|77461510|ref|YP_351017.1|  ...YVKGQ....LLT.AR...D..............SG..IQ.....S......FDD.L.........
gi|77459027|ref|YP_348533.1|  ...QSPAV....IVV.NAk..D..............KD..IA.....T......GKD.L.........
gi|77459852|ref|YP_349359.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457275|ref|YP_346780.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461635|ref|YP_351142.1|  ..aPNSEA....ILV.PK...D..............SP..IK.....S......VAD.L.........
gi|77459314|ref|YP_348821.1|  ...REGVG....LLL.PN...N..............SK..YK.....E......IED.Lqagg.....
gi|77461680|ref|YP_351187.1|  ...PFYLA....VFG.PP...D..............AA..VS.....T......LDD.L.........
gi|77459080|ref|YP_348586.1|  ...SGPQF....YTL.QK...N..............AT..TN.....E......IID.L.........
gi|77460591|ref|YP_350098.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460690|ref|YP_350197.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457351|ref|YP_346856.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457411|ref|YP_346916.1|  ...CAPQH....PLA.KR...G..............--..SA.....T......MEE.L.........
gi|77460131|ref|YP_349638.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457661|ref|YP_347166.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458197|ref|YP_347702.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460696|ref|YP_350203.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461371|ref|YP_350878.1|  ...DFPIV....ILA.HV...Gg.............PQ..PH.....K......LED.L.........
gi|77459516|ref|YP_349023.1|  ...AEWTA....LVV.RK...D..............SP..IQ.....S......VAD.L.........
gi|77460858|ref|YP_350365.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458661|ref|YP_348167.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459874|ref|YP_349381.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461861|ref|YP_351368.1|  ...NNPIV....AVA.RP...D..............HP..LAhmgplR......LQD.L.........
gi|77458589|ref|YP_348094.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460541|ref|YP_350048.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458304|ref|YP_347809.1|  ...RDRFV....AVV.PQ...D..............SP..LA.....D......RSD.I.........
gi|77461122|ref|YP_350629.1|  ...----K....---.--...-..............--..--.....-......---.-.........
gi|77460036|ref|YP_349543.1|  ...VDGKIp...LVR.CA...Dq.............SK..YQ.....T......IDQ.I.........
gi|77457913|ref|YP_347418.1|  ...-----....---.--...-..............--..-T.....K......WAD.L.........
gi|77458663|ref|YP_348169.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456484|ref|YP_345989.1|  ...GAAEA....LVA.RD...G..............SG..IK.....T......PQD.L.........
gi|77459913|ref|YP_349420.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457200|ref|YP_346705.1|  ...YDGIG....FLV.NN...K..............LG..VK.....S......AKE.L.........
gi|77461639|ref|YP_351146.1|  ..iNAAEA....LVV.RN...G..............SG..IN.....K......PED.L.........
gi|77459501|ref|YP_349008.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459989|ref|YP_349496.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459734|ref|YP_349241.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459646|ref|YP_349153.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461911|ref|YP_351418.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458595|ref|YP_348100.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456947|ref|YP_346452.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460224|ref|YP_349731.1|  ...RWNRC....VVV.PQ...G..............HP..LTklpklT......LEA.L.........
gi|77458091|ref|YP_347596.1|  ...NSPFV....LIT.ES...Ka.............QA..PR.....S......LEE.M.........
gi|77460407|ref|YP_349914.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458938|ref|YP_348444.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458668|ref|YP_348174.1|  ...DEIFPvcspRLL.TG...D..............KP..LN.....T......PAD.L.........
gi|77459515|ref|YP_349022.1|  ..nPDTIA....LLV.PK...D..............SP..VK.....T......IED.L.........
gi|77459029|ref|YP_348535.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458115|ref|YP_347620.1|  ...DDPLD....FVV.AP...Ehslis.........NG..AV.....T......LAD.I.........
gi|77458299|ref|YP_347804.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459590|ref|YP_349097.1|  ...VETLG....VMV.GR...Ehplyds........SS..VL.....T......PDD.I.........
gi|77459139|ref|YP_348645.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461503|ref|YP_351010.1|  ...DVEFV....LFY.AN...Erp............HP..FR.....S......LQD.L.........
gi|77457545|ref|YP_347050.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456896|ref|YP_346401.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457125|ref|YP_346630.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459733|ref|YP_349240.1|  ...DSRIG....LVV.RE...Gapk...........PD..IS.....N......VDA.Lkktll....
gi|77456439|ref|YP_345944.1|  ...GVKQY....LGV.VP...G..............SG..IK.....T......LQD.L.........
gi|77457466|ref|YP_346971.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458675|ref|YP_348181.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457981|ref|YP_347486.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459375|ref|YP_348882.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458585|ref|YP_348090.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461591|ref|YP_351098.1|  ...SDPLV....LAV.HR...N..............HP..LAahdhvT......LSA.L.........
gi|77458830|ref|YP_348336.1|  ...QAQMV....VVA.SP...Sfvqg..........LE..IN.....H......PQD.L.........
gi|77458659|ref|YP_348165.1|  ...AQFTS....KFI.TA...D..............PN..VK.....S......LAD.L.........
gi|77456943|ref|YP_346448.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459507|ref|YP_349014.1|  ...PSGHR....LAE.AD...-..............--..DV.....S......VKD.L.........
gi|77457171|ref|YP_346676.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456255|ref|YP_345760.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459383|ref|YP_348890.1|  sikGSGNG....IVV.PS...A..............SG..VQ.....S......LSE.L.........
gi|77459504|ref|YP_349011.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457677|ref|YP_347182.1|  ...NERLV....LIS.EA...Dh.............PP..IR.....S......ARD.V.........
gi|77458588|ref|YP_348093.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457164|ref|YP_346669.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456645|ref|YP_346150.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461779|ref|YP_351286.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457277|ref|YP_346782.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461152|ref|YP_350659.1|  ..sHGGDG....VLV.GK...N..............--..VK.....S......LQE.L.........
gi|77456556|ref|YP_346061.1|  ...PDDWV....MLA.KA...D..............SK..ITle...T......LND.A.........
gi|77460196|ref|YP_349703.1|  ...ENSYV....LLT.RK...Aa.............DS..PT.....H......LGQ.L.........
gi|77459903|ref|YP_349410.1|  ...NDPMV....AFV.SR...H..............HP..WA.....Eresic.LED.L.........
gi|77457685|ref|YP_347190.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461155|ref|YP_350662.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457148|ref|YP_346653.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457225|ref|YP_346730.1|  ...VTPQI....IYR.NG...Q..............SR..PT.....D......AGD.L.........
gi|77456777|ref|YP_346282.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459007|ref|YP_348513.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458947|ref|YP_348453.1|  ...-----....---.--...-..............RP..IR.....A......VAD.L.........
gi|77459604|ref|YP_349111.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457540|ref|YP_347045.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458467|ref|YP_347972.1|  ...LEPYR....LIV.PK...D..............--..--.....-......---.-.........
gi|77460123|ref|YP_349630.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457570|ref|YP_347075.1|  ...NGNDG....IVL.KG...E..............--..GK.....K......VAD.L.........
gi|77456344|ref|YP_345849.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457610|ref|YP_347115.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458181|ref|YP_347686.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459944|ref|YP_349451.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461472|ref|YP_350979.1|  ...LNRVR....FLK.RK...D..............AP..IEyn...N......LQE.L.........
gi|77460767|ref|YP_350274.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458891|ref|YP_348397.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460119|ref|YP_349626.1|  ...-----....---.--...-..............-G..--.....-......---.-.........
gi|77459497|ref|YP_349004.1|  ...HGP--....---.--...-..............--..IQ.....R......AAD.V.........
gi|77456366|ref|YP_345871.1|  ...NFPYY....LVS.-N...N..............PK..VK.....T......IAD.F.........
gi|77459144|ref|YP_348650.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456369|ref|YP_345874.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457630|ref|YP_347135.1|  ...HPIGW....IVA.SNsiyN..............RD..YQ.....S......LAD.L.........
gi|77457486|ref|YP_346991.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460216|ref|YP_349723.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461386|ref|YP_350893.1|  ...EDELT....LVI.PA...D..............HP..LR.....-......---.-.........
gi|77458645|ref|YP_348151.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459746|ref|YP_349253.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458091|ref|YP_347596.1|  ...EDQPM....WVT.RL...N..............--..EA.....L......PDD.L.........
gi|77461610|ref|YP_351117.1|  ...QVNAQ....LLA.KK...D..............--..--.....-......---.-.........
gi|77456717|ref|YP_346222.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456922|ref|YP_346427.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458189|ref|YP_347694.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461512|ref|YP_351019.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458795|ref|YP_348301.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459527|ref|YP_349034.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460812|ref|YP_350319.1|  ...NERLL....LAV.PA...D..............HR..LAlmeavD......LAQ.L.........
gi|77458380|ref|YP_347885.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457256|ref|YP_346761.1|  ...GAGWV....FVG.HS...De.............PA..IQ.....S......LAT.L.........
gi|77458417|ref|YP_347922.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461348|ref|YP_350855.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459904|ref|YP_349411.1|  ...ESRIC....ALV.PA...A..............HP..WA.....TragevrLKE.L.........
gi|77460196|ref|YP_349703.1|  ...IDQPV....LVT.RE...G..............ET..RT.....L......TEG.L.........
gi|77459579|ref|YP_349086.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456509|ref|YP_346014.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460531|ref|YP_350038.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458432|ref|YP_347937.1|  ...SMPNY....LLT.NN...P..............-N..VK.....T......LKD.F.........
gi|77458685|ref|YP_348191.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456796|ref|YP_346301.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456443|ref|YP_345948.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456440|ref|YP_345945.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461514|ref|YP_351021.1|  ...SDDIF....LAT.PA...D..............SR..FAqrsevD......LAE.V.........
gi|77457657|ref|YP_347162.1|  ...PD---....---.--...-..............--..--.....-......---.-.........
gi|77460336|ref|YP_349843.1|  ...ENDYL....VWT.RK...G..............STlvYT.....E......ARD.L.........
gi|77458953|ref|YP_348459.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460693|ref|YP_350200.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457612|ref|YP_347117.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458012|ref|YP_347517.1|  ...QNGQS....LNL.SH...Glqg...........LG..VT.....G......PEA.Lhhhvhqtr.
gi|77461737|ref|YP_351244.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459929|ref|YP_349436.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458950|ref|YP_348456.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458596|ref|YP_348101.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460559|ref|YP_350066.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460164|ref|YP_349671.1|  ...EDAEI....FVA.QN...K..............PG..RQqn...Y......FAD.L.........
gi|77460025|ref|YP_349532.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458799|ref|YP_348305.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459649|ref|YP_349156.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456330|ref|YP_345835.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77456912|ref|YP_346417.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458376|ref|YP_347881.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460214|ref|YP_349721.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460544|ref|YP_350051.1|  ...RTEIA....LFV.GR...G..............H-..--.....-......---.-.........
gi|77461845|ref|YP_351352.1|  ...QTEML....PVC.AA...D..............AN..GK.....P......LFD.L.........
gi|77458031|ref|YP_347536.1|  ...EQKVG....CYV.RN...D..............PN..--.....-......---.-.........
gi|77460241|ref|YP_349748.1|  ...NVPLV....LVGiKG...E..............KR..YT.....K......VEQ.L.........
gi|77459350|ref|YP_348857.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77461233|ref|YP_350740.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458508|ref|YP_348013.1|  ...-----....-FV.RP...E..............--..--.....-......-HP.L.........
gi|77460704|ref|YP_350211.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459076|ref|YP_348582.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77459000|ref|YP_348506.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77458730|ref|YP_348236.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460545|ref|YP_350052.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457580|ref|YP_347085.1|  ...TSYGA....IAV.KS...D..............SP..YK.....T......LDD.Lvqalkk...
gi|77456527|ref|YP_346032.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77457259|ref|YP_346764.1|  ...-----....---.--...-..............--..--.....-......---.-.........
gi|77460567|ref|YP_350074.1|  ...-----....ILA.RA...D..............DS..RR.....S......LAA.F.........


                                                 120             130          140                   
                                                   |               |            |                   
d1us5a_                         .....KGK..R......VVV...GDVGSGT...EQNAR.QILEA..YGLTF.D.......DLG.....
gi|77457042|ref|YP_346547.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457043|ref|YP_346548.1|  .....NQK..P......VGT...GPFVFKRyqkDAQIR.YAANK..DYWKP.E.......DVKldnlv
gi|77457040|ref|YP_346545.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461759|ref|YP_351266.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458408|ref|YP_347913.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458409|ref|YP_347914.1|  .....---..-......---...-------...-----.-----..-----.D.......RME.....
gi|77459295|ref|YP_348802.1|  .....---..-......---...-------...-----.RTLKQ..IGINL.D.......---.....
gi|77459963|ref|YP_349470.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459342|ref|YP_348849.1|  .....---..-......---...-------...----K.RNLAQ..IGIGF.D.......---.....
gi|77461625|ref|YP_351132.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458344|ref|YP_347849.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459054|ref|YP_348560.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461852|ref|YP_351359.1|  .....---..-......---...-------...-----.-----..-----.-.......--Akaeal
gi|77461626|ref|YP_351133.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459482|ref|YP_348989.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458902|ref|YP_348408.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458800|ref|YP_348306.1|  .....---..-......---...-------...-----.-----..--LQP.S.......---.....
gi|77459754|ref|YP_349261.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456422|ref|YP_345927.1|  .....IKN..D......VSV...ITPNPKTsggARWNF.LAAWA..YGLKA.N.......GGNeakak
gi|77458599|ref|YP_348104.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461708|ref|YP_351215.1|  .....---..-......---...-------...-----.-----..-----.-.......EIR.....
gi|77457818|ref|YP_347323.1|  .....DGV..Q......VIV...-------...-----.-----..-----.-.......---.....
gi|77456295|ref|YP_345800.1|  .....SGA..N......VVI...-PNDATN...GGRAL.LLLAK..AGV--.-.......---.....
gi|77458382|ref|YP_347887.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456253|ref|YP_345758.1|  .....FEK..K......IYG...IGSGAPA...NISLQ.EIIKK..NDFDL.G.......QWK.....
gi|77461459|ref|YP_350966.1|  .....DGK..I......YGI...-EPGNDG...NRLIQ.SMIDKnaFGLKD.A.......GFK.....
gi|77456451|ref|YP_345956.1|  .....DGA..T......IAI...PNEGSNS...GRALI.-LLQK..AGL--.-.......---.....
gi|77459541|ref|YP_349048.1|  petpsKGR..F......LNS...-PIGWTS...EVVNK.QKLTA..YGLQD.D.......FVN.....
gi|77460565|ref|YP_350072.1|  pedpsRGR..F......LNS...-PTGWTS...EIVNS.QKLKA..YALND.S.......FVN.....
gi|77461651|ref|YP_351158.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458865|ref|YP_348371.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457833|ref|YP_347338.1|  .....KNR..I......VGI...-DAGSGV...MLKTD.QAIKD..YGLDK.Y.......TLK.....
gi|77459367|ref|YP_348874.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456472|ref|YP_345977.1|  .....SGK..K......VGV...-GLGTNY...EQWVR.ANVPG..ADV--.-.......---.....
gi|77461451|ref|YP_350958.1|  .....GGK..I......YGI...-EPGSGA...NTQIK.AMIAK..NQFGL.G.......KFQ.....
gi|77456590|ref|YP_346095.1|  aeepsKGR..F......YNC...-PAGWTC...ELDNS.EMLKS..YGLEN.S.......YTN.....
gi|77459062|ref|YP_348568.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456597|ref|YP_346102.1|  .....GGK..I......YGI...-EPGSGA...NTTIK.TMIET..NHFGL.K.......DFK.....
gi|77456759|ref|YP_346264.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461836|ref|YP_351343.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459394|ref|YP_348901.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458291|ref|YP_347796.1|  .....KGK..K......VGV...-LRASTH...DRYAT.EVLVP..AGIE-.-.......---.....
gi|77460513|ref|YP_350020.1|  .....KGK..N......IGV...-QRGSIH...ERFAR.EVLAP..LGAE-.-.......---.....
gi|77456539|ref|YP_346044.1|  .....KGK..V......IGA...-QRATLA...GTFME.DNMPG..VEV--.-.......---.....
gi|77457194|ref|YP_346699.1|  .....KGK..T......VGV...-QRATTT...DRYAT.EVFEP..KGINV.K.......---.....
gi|77461588|ref|YP_351095.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459463|ref|YP_348970.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456603|ref|YP_346108.1|  .....ADY..R......ITS...-KLGTTG...EMVAK.KLISK..AKY--.-.......---.....
gi|77460756|ref|YP_350263.1|  .....KGK..N......VVT...-TAGTTS...ERILK.AMNAD..KQMGM.N.......---.....
gi|77458562|ref|YP_348067.1|  .....PDRg.T......VAV...-PNNVTN...LSRAL.YLLQD..NGL--.-.......---.....
gi|77456465|ref|YP_345970.1|  .....EGA..S......VAI...-ANDPIN...SGRGL.QLLAK..AGL--.-.......---.....
gi|77457097|ref|YP_346602.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457032|ref|YP_346537.1|  .....---..-......---...-------...-----.-MVKL..YDMNL.T.......RQN.....
gi|77459005|ref|YP_348511.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461345|ref|YP_350852.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457437|ref|YP_346942.1|  .....KGK..T......VGY...-EQGTIQ...EAYAK.AVLDK..AGVKT.Q.......AYQ.....
gi|77459166|ref|YP_348672.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460297|ref|YP_349804.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459872|ref|YP_349379.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456456|ref|YP_345961.1|  .....ATR..T......TIV...-TTGTTA...DIWLT.KNHPD..WK---.-.......---.....
gi|77461510|ref|YP_351017.1|  .....RGK..N......VVT...-TAGTTN...ERYLK.SYNLD..HKLNM.F.......---.....
gi|77459027|ref|YP_348533.1|  .....SGK..K......VGV...-ISASTY...EAYLN.KDLVI..EGAED.KplsypfdNVQ.....
gi|77459852|ref|YP_349359.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457275|ref|YP_346780.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461635|ref|YP_351142.1|  .....KGK..K......VAL...-NKGSNV...HYLLV.RALED..AGLKY.S.......DIQ.....
gi|77459314|ref|YP_348821.1|  .....DGV..T......VAV...-LQNVYA...EELVH.QALPK..AKV--.-.......---.....
gi|77461680|ref|YP_351187.1|  .....KGK..T......ISV...-TRGAIE...DIELT.-----..-KVAP.E.......GVT.....
gi|77459080|ref|YP_348586.1|  .....CGK..K......VGT...SRRTTFP...AEIAA.-WSKE..NCEAA.Gkp.....AIN.....
gi|77460591|ref|YP_350098.1|  .....---..-......---...-------...-----.--VEK..DGFTW.K.......DGA.....
gi|77460690|ref|YP_350197.1|  .....---..-......--A...-------...-----.-----..-----.-.......---.....
gi|77457351|ref|YP_346856.1|  .....---..-......---...-------...-A---.-----..-----.-.......---.....
gi|77457411|ref|YP_346916.1|  .....THE..A......WIL...REQGSGT...RLTFD.QAMRH..HRSAL.N.......---.....
gi|77460131|ref|YP_349638.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457661|ref|YP_347166.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458197|ref|YP_347702.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460696|ref|YP_350203.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461371|ref|YP_350878.1|  .....YGL..K......IAV...-VENYAP...HELLR.THHPD..LNL--.-.......---.....
gi|77459516|ref|YP_349023.1|  .....KGK..K......IAA...-TKGTDP...YLFTL.RTLQQ..AGLKK.D.......DLE.....
gi|77460858|ref|YP_350365.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458661|ref|YP_348167.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459874|ref|YP_349381.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461861|ref|YP_351368.1|  .....EPY..T......LLI...REPGSGT...RLACE.EYFKE..KRVHF.-.......---.....
gi|77458589|ref|YP_348094.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460541|ref|YP_350048.1|  .....---..-......---...-------...E----.-----..-----.-.......---.....
gi|77458304|ref|YP_347809.1|  .....DWQ..TllqepfITL...-QRPSTV...RVMLE.EHLQA..RGMKL.P.......---.....
gi|77461122|ref|YP_350629.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460036|ref|YP_349543.1|  .....NQP..N......VRLv..EPAGGTN...EAFVH.AFLPK..AQLALhD.......NVT.....
gi|77457913|ref|YP_347418.1|  .....KGGkyK......VSI...GDVSTAA...QAANG.VLAAAlaNGGDE.K.......NLQ.....
gi|77458663|ref|YP_348169.1|  .....---..-......---...----STA...TMLVI.PELPK..FFERY.P.......DIQ.....
gi|77456484|ref|YP_345989.1|  .....VGK..K......IAV...-PFVSTG...HYSLL.AALKH..WNIDP.S.......KVT.....
gi|77459913|ref|YP_349420.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457200|ref|YP_346705.1|  .....DGA..T......ICI...-QAGTTT...ELNVS.DYFRG..NGLKY.T.......---.....
gi|77461639|ref|YP_351146.1|  .....IGK..T......IAT...-PFVSTS...HYSLL.GALKH..WALDT.S.......KVK.....
gi|77459501|ref|YP_349008.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459989|ref|YP_349496.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459734|ref|YP_349241.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459646|ref|YP_349153.1|  .....---..-......---...-------...--VLP.KALHL..FRERY.P.......QVTw....
gi|77461911|ref|YP_351418.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458595|ref|YP_348100.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456947|ref|YP_346452.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460224|ref|YP_349731.1|  .....AEY..P......IVT...YVFGFTG...RSKLD.EAFSH..RGLTP.K.......---.....
gi|77458091|ref|YP_347596.1|  .....AGK..R......LAL...-YRGNPL...RDYLL.EHVPQ..INL--.-.......---.....
gi|77460407|ref|YP_349914.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458938|ref|YP_348444.1|  .....---..-......---...------G...RNVLL.RWLDEf.QQLHP.K.......---.....
gi|77458668|ref|YP_348174.1|  .....AHH..P......LLQ...--VSGVT...ANDWN.DWLHA..AGQP-.-.......---.....
gi|77459515|ref|YP_349022.1|  .....KGK..K......VAY...-WPGAWS...QQLTL.RALEQ..GGLPE.N.......YVD.....
gi|77459029|ref|YP_348535.1|  .....---..-......---...-------...-----.-----..-----.-.......D--.....
gi|77458115|ref|YP_347620.1|  .....AGH..P......AVF...PGGNTFT...HHIVQ.RLFEA..QGLTP.N.......---.....
gi|77458299|ref|YP_347804.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459590|ref|YP_349097.1|  .....AQL..D......FAL...LAPDFIT...RLSID.EYFRQ..RGITP.K.......---.....
gi|77459139|ref|YP_348645.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461503|ref|YP_351010.1|  .....KGL..T......VGT...-SPGYLY...SPD--.-----..--FRE.St......LFT.....
gi|77457545|ref|YP_347050.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456896|ref|YP_346401.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457125|ref|YP_346630.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459733|ref|YP_349240.1|  .....DAK..S......VAY...-SDSASG...VYIEQ.QLFKK..LGI--.-.......---.....
gi|77456439|ref|YP_345944.1|  .....KGK..R......VAI...-FRGTAT...QLSFD.AALAS..VGLSE.K.......DVK.....
gi|77457466|ref|YP_346971.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458675|ref|YP_348181.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457981|ref|YP_347486.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459375|ref|YP_348882.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458585|ref|YP_348090.1|  .....---..-......---...-----N-...-----.-----..-----.-.......---.....
gi|77461591|ref|YP_351098.1|  .....AGH..T......LLM...REPGSTT...RRLTE.ELLAS..AGVSF.G.......---.....
gi|77458830|ref|YP_348336.1|  .....KNL..P......VLG...-------...-----.-----..-----.-.......---.....
gi|77458659|ref|YP_348165.1|  .....KGK..T......FAF...GSVSSTS...GSLMPrYFMLK..DGIKP.Es......YFS.....
gi|77456943|ref|YP_346448.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459507|ref|YP_349014.1|  .....DGQ..P......FLM...YSHAAYPpf.NELLT.GMLRS..ARVAP.D.......---.....
gi|77457171|ref|YP_346676.1|  .....---..-......---...-------...-----.---A-..-----.-.......---.....
gi|77456255|ref|YP_345760.1|  .....---..-......---...-------...-----.-----..-----.-.......--Q.....
gi|77459383|ref|YP_348890.1|  .....KGK..T......ISV...-PFASTA...HGMLL.RAVAE..QGWDPlK.......DVN.....
gi|77459504|ref|YP_349011.1|  .....---..-......---...-------...-----.-----..-----.-.......-R-.....
gi|77457677|ref|YP_347182.1|  .....EGR..A......VFT...FRHGCAY...RARLE.AWFAH..YQAAM.G.......---.....
gi|77458588|ref|YP_348093.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457164|ref|YP_346669.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456645|ref|YP_346150.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461779|ref|YP_351286.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457277|ref|YP_346782.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461152|ref|YP_350659.1|  .....KGQ..A......VAV...-NEGSTS...QFWLS.YLLKK..NGMRM.S.......DIT.....
gi|77456556|ref|YP_346061.1|  .....RKY..K......IGA...-YKGDAI...AETLT.----K..QGLKP.-.......---.....
gi|77460196|ref|YP_349703.1|  .....KRK..R......LAI...-AQGNPM...IEYLR.SEFPR..IQL--.-.......---.....
gi|77459903|ref|YP_349410.1|  .....DDT..P......LVL...REHGSVT...RQTLE.EEMAR..AGFRI.R.......---.....
gi|77457685|ref|YP_347190.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461155|ref|YP_350662.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457148|ref|YP_346653.1|  .....---..-......---...-------...-----.-----..-----.-.......-V-.....
gi|77457225|ref|YP_346730.1|  .....VGK..K......IMV...-LKGSTHa..EQLAE.LKQKY..PGIQY.E.......---.....
gi|77456777|ref|YP_346282.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459007|ref|YP_348513.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458947|ref|YP_348453.1|  .....LDC..N......LIL...---SEAT...LIKWP.QLFAQ..HGLSR.-.......---.....
gi|77459604|ref|YP_349111.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457540|ref|YP_347045.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458467|ref|YP_347972.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460123|ref|YP_349630.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457570|ref|YP_347075.1|  .....KGM..D......VNL...-VELSVS...HYLLA.RALDS..VDLTE.K.......DLK.....
gi|77456344|ref|YP_345849.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457610|ref|YP_347115.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458181|ref|YP_347686.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459944|ref|YP_349451.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461472|ref|YP_350979.1|  .....HTY..P......IAV...-VRGYAY...SAPFD.-----..----A.Ds......ALQ.....
gi|77460767|ref|YP_350274.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458891|ref|YP_348397.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460119|ref|YP_349626.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459497|ref|YP_349004.1|  .....NGE..N......IY-...-------...-----.-----..-----.-.......---.....
gi|77456366|ref|YP_345871.1|  .....TEKd.R......IAV...PAVGVSV...QSRFL.QYAAA..KQWGD.K.......EFNrldk.
gi|77459144|ref|YP_348650.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456369|ref|YP_345874.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457630|ref|YP_347135.1|  .....AQE..R......IIT...YSKNSRP...HQDIL.ALMQA..QGV--.-.......---.....
gi|77457486|ref|YP_346991.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460216|ref|YP_349723.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461386|ref|YP_350893.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458645|ref|YP_348151.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459746|ref|YP_349253.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458091|ref|YP_347596.1|  .....AGK..R......IAM...-VDDYLP...ASTIE.EAYPK..ASL--.-.......---.....
gi|77461610|ref|YP_351117.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456717|ref|YP_346222.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456922|ref|YP_346427.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458189|ref|YP_347694.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461512|ref|YP_351019.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458795|ref|YP_348301.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459527|ref|YP_349034.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460812|ref|YP_350319.1|  .....KDE..-......---...-------...-----.-----..-----.-.......---.....
gi|77458380|ref|YP_347885.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457256|ref|YP_346761.1|  .....TKR..V......LVL...-PARHAL...EDS--.-----..IRRDY.P.......SIQ.....
gi|77458417|ref|YP_347922.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461348|ref|YP_350855.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459904|ref|YP_349411.1|  .....DQV..I......MVL...REPSSIT...RRTFD.QACAQ..ASVSP.R.......---.....
gi|77460196|ref|YP_349703.1|  .....AGM..R......LSM...-------...-----.---LY..HYLPL.D.......DVKamypk
gi|77459579|ref|YP_349086.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456509|ref|YP_346014.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460531|ref|YP_350038.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458432|ref|YP_347937.1|  .....SDKd.R......IAV...PAAGVGF...QSRTL.QIETA..KEFGN.D.......HYKkfdd.
gi|77458685|ref|YP_348191.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456796|ref|YP_346301.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456443|ref|YP_345948.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456440|ref|YP_345945.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461514|ref|YP_351021.1|  .....RDE..T......FIT...LTQGFAT...HQDGI.RVFRQ..AGFEP.Kvamqvn.DIF.....
gi|77457657|ref|YP_347162.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460336|ref|YP_349843.1|  .....HGH..T......GGL...SEKSRMT...PAFGT.FAEQQ..LTL--.-.......---.....
gi|77458953|ref|YP_348459.1|  .....---..-......---...------Q...-----.-----..-----.-.......---.....
gi|77460693|ref|YP_350200.1|  .....---..-......---...-----H-...-----.-----..-----.-.......---.....
gi|77457612|ref|YP_347117.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458012|ref|YP_347517.1|  .....AKL..T......FAQ...TFPTGTH...AMWLY.YWLAS..QGIHPlR.......DVD.....
gi|77461737|ref|YP_351244.1|  .....---..-......---...-------...ELGMI.AAARG..YGVSM.G.......DLL.....
gi|77459929|ref|YP_349436.1|  .....---..-......---...----T--...-----.-----..-----.-.......---.....
gi|77458950|ref|YP_348456.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458596|ref|YP_348101.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460559|ref|YP_350066.1|  .....---..-......---...-------...-----.-----..-----.-.......DIE.....
gi|77460164|ref|YP_349671.1|  .....KGK..R......LAL...---YSGY...HYEFA.NFNAD..PKYLA.E.......TYS.....
gi|77460025|ref|YP_349532.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458799|ref|YP_348305.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459649|ref|YP_349156.1|  .....---..-......---...------T...RRSWI.PWLDA..AGMTP.Tep.....PAR.....
gi|77456330|ref|YP_345835.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77456912|ref|YP_346417.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77458376|ref|YP_347881.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460214|ref|YP_349721.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460544|ref|YP_350051.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461845|ref|YP_351352.1|  .....EGE..-......---...-------...-----.-----..-----.-.......---.....
gi|77458031|ref|YP_347536.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460241|ref|YP_349748.1|  .....AGK..T......LAL...-PTGSAA...GEAVS.QLNQK..LAL--.-.......---.....
gi|77459350|ref|YP_348857.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77461233|ref|YP_350740.1|  .....---..-......---...-------...--VLR.KVFEP..AGVTL.D.......---.....
gi|77458508|ref|YP_348013.1|  .....AGR..K......VAM...GEL----...-----.-----..-----.-.......---.....
gi|77460704|ref|YP_350211.1|  .....---..-......---...-------...-----.-----..L----.-.......---.....
gi|77459076|ref|YP_348582.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77459000|ref|YP_348506.1|  .....---..-......---...-------...-----.-----..-----.D.......AVR.....
gi|77458730|ref|YP_348236.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460545|ref|YP_350052.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457580|ref|YP_347085.1|  .....DPS..S......VVIgsgGTVGSQD...WMQTA.LIAKA..AGINP.R.......DLR.....
gi|77456527|ref|YP_346032.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77457259|ref|YP_346764.1|  .....---..-......---...-------...-----.-----..-----.-.......---.....
gi|77460567|ref|YP_350074.1|  .....FDS..R......GVI...NSDDSNS...GMNLLrQRLAP..LHRDG.Q.......FFAt....


                                           150                           160                        
                                             |                             |                        
d1us5a_                         ..........QAIRVS....ASQ............GIQL....MQD......................
gi|77457042|ref|YP_346547.1|  ..........------....---............----....---......................
gi|77457043|ref|YP_346548.1|  ..........FSITPD....AAV............RLQK....LKT......................
gi|77457040|ref|YP_346545.1|  ..........------....---............----....---......................
gi|77461759|ref|YP_351266.1|  ..........------....---............----....---......................
gi|77458408|ref|YP_347913.1|  ..........------....NTV............ALEA....LKA......................
gi|77458409|ref|YP_347914.1|  ..........VEFYRD....SDV............AFEA....FKA......................
gi|77459295|ref|YP_348802.1|  ..........-IRRID....SSQ............YVNR....LMS......................
gi|77459963|ref|YP_349470.1|  ..........------....---............----....---......................
gi|77459342|ref|YP_348849.1|  ..........-IRQVD....TAQ............YTNR....VRS......................
gi|77461625|ref|YP_351132.1|  ..........------....---............----....---......................
gi|77458344|ref|YP_347849.1|  ..........-VAYFH....SSK............YISD....LAN......................
gi|77459054|ref|YP_348560.1|  ..........--TYFH....SSK............YVSD....LAN......................
gi|77461852|ref|YP_351359.1|  ....lmkirpYVTYFH....SSK............YMAD....IAN......................
gi|77461626|ref|YP_351133.1|  ..........-VAYFH....SSK............YISD....LAN......................
gi|77459482|ref|YP_348989.1|  ..........YVTYFN....SAK............YMTD....IAN......................
gi|77458902|ref|YP_348408.1|  ..........---YFH....SSK............YTSD....LAN......................
gi|77458800|ref|YP_348306.1|  ..........-VLYVA....TGR............QIND....LAN......................
gi|77459754|ref|YP_349261.1|  ..........HIAYFN....SSK............FISD....LSN......................
gi|77456422|ref|YP_345927.1|  eyvqtlfkhvPVLDTGa...RGS............TITF....VNN......................
gi|77458599|ref|YP_348104.1|  ..........------....---............----....---......................
gi|77461708|ref|YP_351215.1|  ..........-FLRGN....VNT............RLAK....LDA......................
gi|77457818|ref|YP_347323.1|  ..........------....---............----....---......................
gi|77456295|ref|YP_345800.1|  ..........-ITLKD....PNN............ILST....VKDiaqnpkdlkireleaatiprvl
gi|77458382|ref|YP_347887.1|  ..........-IRYFD....NDL............NISD....LAN......................
gi|77456253|ref|YP_345758.1|  ..........-LIESSeqamLAE............VSRA....VKK......................
gi|77461459|ref|YP_350966.1|  ..........-VVESSeagmLSQ............VDRA....QKR......................
gi|77456451|ref|YP_345956.1|  ..........-IELKD....PKN............ALAT....PKDiaknphnfkfkelesallprvl
gi|77459541|ref|YP_349048.1|  ..........-FRSGSgaalDAE............ISSS....IRR......................
gi|77460565|ref|YP_350072.1|  ..........-FRTGSgaalDAE............VASS....IKR......................
gi|77461651|ref|YP_351158.1|  ..........------....---............----....---......................
gi|77458865|ref|YP_348371.1|  ..........------....---............----....---......................
gi|77457833|ref|YP_347338.1|  ..........ASSGAGm...IAE............LTRA....EKK......................
gi|77459367|ref|YP_348874.1|  ..........--KMYS....SDN............TVDR....MAS......................
gi|77456472|ref|YP_345977.1|  ..........-RTYDD....DPT............KFAD....LNN......................
gi|77461451|ref|YP_350958.1|  ..........-LVESS....EAG............MLAAvdraVRR......................
gi|77456590|ref|YP_346095.1|  ..........-FRPGT....GPA............LDAA....VLSsykr..................
gi|77459062|ref|YP_348568.1|  ..........------....---............----....---......................
gi|77456597|ref|YP_346102.1|  ..........-IIESG....EAG............MLAA....VQRavnr..................
gi|77456759|ref|YP_346264.1|  ..........-KTYSN....NMV............ALKA....VEN......................
gi|77461836|ref|YP_351343.1|  ..........------....---............----....---......................
gi|77459394|ref|YP_348901.1|  ..........------....---............----....---......................
gi|77458291|ref|YP_347796.1|  ..........LVRYGS....QQE............ANLD....MVS......................
gi|77460513|ref|YP_350020.1|  ..........-IKPYGs...QNE............IYLD....VAA......................
gi|77456539|ref|YP_346044.1|  ..........-KLYDT....QEN............AYLD....LIS......................
gi|77457194|ref|YP_346699.1|  ..........--RYGN....NEE............IYMD....LAA......................
gi|77461588|ref|YP_351095.1|  ..........------....---............----....---......................
gi|77459463|ref|YP_348970.1|  ..........------....---............----....---......................
gi|77456603|ref|YP_346108.1|  ..........-HGYDN....EQE............AVLD....VVN......................
gi|77460756|ref|YP_350263.1|  ..........VISAKD....HGE............SFQM....LES......................
gi|77458562|ref|YP_348067.1|  ..........IKLKPG....FND............P---....---......................
gi|77456465|ref|YP_345970.1|  ..........------....---............----....---......................
gi|77457097|ref|YP_346602.1|  ..........------....---............----....---......................
gi|77457032|ref|YP_346537.1|  ..........-IRQMD....AGL............VYTA....LRN......................
gi|77459005|ref|YP_348511.1|  ..........------....---............-AAA....KGD......................
gi|77461345|ref|YP_350852.1|  ..........------....---............----....---......................
gi|77457437|ref|YP_346942.1|  ..........-----N....QDQ............VYSD....LTS......................
gi|77459166|ref|YP_348672.1|  ..........------....---............----....---......................
gi|77460297|ref|YP_349804.1|  ..........------....---............----....---......................
gi|77459872|ref|YP_349379.1|  ..........------....SST............GFTA....LKN......................
gi|77456456|ref|YP_345961.1|  ..........LLKFEK....NSE............SLQA....LAN......................
gi|77461510|ref|YP_351017.1|  ..........VISAKD....HGE............AFQM....LQS......................
gi|77459027|ref|YP_348533.1|  ..........-IAPYDn...ETV............AFQD....LALgtg...................
gi|77459852|ref|YP_349359.1|  ..........-A----....---............----....---......................
gi|77457275|ref|YP_346780.1|  ..........------....---............----....---......................
gi|77461635|ref|YP_351142.1|  ..........-TVFLP....PAD............ARAA....FER......................
gi|77459314|ref|YP_348821.1|  ..........-DQYDS....VDL............MYQA....VNS......................
gi|77461680|ref|YP_351187.1|  ..........IKRFED....NNS............TIAA....YLA......................
gi|77459080|ref|YP_348586.1|  ..........VIGTEG....SAD............ARAQ....LRQ......................
gi|77460591|ref|YP_350098.1|  ..........-VAGGG....GAT............AMTV....LKS......................
gi|77460690|ref|YP_350197.1|  ..........------....---............----....---......................
gi|77457351|ref|YP_346856.1|  ..........------....---............----....---......................
gi|77457411|ref|YP_346916.1|  ..........IRLELE....HTE............AI--....---......................
gi|77460131|ref|YP_349638.1|  ..........------....---............----....---......................
gi|77457661|ref|YP_347166.1|  ..........------....---............----....---......................
gi|77458197|ref|YP_347702.1|  ..........------....---............----....--R......................
gi|77460696|ref|YP_350203.1|  ..........------....---............----....---......................
gi|77461371|ref|YP_350878.1|  ..........-VAMPN....VSS............ALQA....LAT......................
gi|77459516|ref|YP_349023.1|  ..........-LVHLQ....HPD............GRTA....LEK......................
gi|77460858|ref|YP_350365.1|  ..........-I----....---............----....---......................
gi|77458661|ref|YP_348167.1|  ..........------....---............----....---......................
gi|77459874|ref|YP_349381.1|  ..........------....---............----....---......................
gi|77461861|ref|YP_351368.1|  ..........----TQ....TQE............VASA....EAQ......................
gi|77458589|ref|YP_348094.1|  ..........------....---............----....--E......................
gi|77460541|ref|YP_350048.1|  ..........------....---............----....---......................
gi|77458304|ref|YP_347809.1|  ..........-VEFES....---............----....---......................
gi|77461122|ref|YP_350629.1|  ..........------....---............----....---......................
gi|77460036|ref|YP_349543.1|  ..........------....---............IFEQ....LLD......................
gi|77457913|ref|YP_347418.1|  ..........-PALLL....FADiakqgrlsmanpTIAT....MEK......................
gi|77458663|ref|YP_348169.1|  ..........--VDLG....VSD............RPVD....LIS......................
gi|77456484|ref|YP_345989.1|  ..........-VLNLA....PPA............IIAA....WKR......................
gi|77459913|ref|YP_349420.1|  ..........------....---............----....---......................
gi|77457200|ref|YP_346705.1|  ..........PITFDT....SDE............SAKS....LES......................
gi|77461639|ref|YP_351146.1|  ..........-VVNLQ....PAE............IAAA....WKR......................
gi|77459501|ref|YP_349008.1|  ..........------....---............----....---......................
gi|77459989|ref|YP_349496.1|  ..........------....---............----....---......................
gi|77459734|ref|YP_349241.1|  ..........------....---............----....---......................
gi|77459646|ref|YP_349153.1|  ..........RLHEMT....PAA............QVKA....LKE......................
gi|77461911|ref|YP_351418.1|  ..........-V----....---............----....---......................
gi|77458595|ref|YP_348100.1|  ..........------....---............----....---......................
gi|77456947|ref|YP_346452.1|  ..........------....---............----....---......................
gi|77460224|ref|YP_349731.1|  ..........-VVFTA....---............----....---......................
gi|77458091|ref|YP_347596.1|  ..........-IELPS....PAD............GTRA....LFD......................
gi|77460407|ref|YP_349914.1|  ..........-----K....---............----....---......................
gi|77458938|ref|YP_348444.1|  ..........VLLQLR....VSD............QVAD....LVG......................
gi|77458668|ref|YP_348174.1|  ..........------....---............----....---......................
gi|77459515|ref|YP_349022.1|  ..........-FVKLM....PID............AAAA....LPQ......................
gi|77459029|ref|YP_348535.1|  ..........------....---............----....---......................
gi|77458115|ref|YP_347620.1|  ..........IAMSTN....YLE............TIKM....---......................
gi|77458299|ref|YP_347804.1|  ..........-----E....RGE............LVQL....LPD......................
gi|77459590|ref|YP_349097.1|  ..........VQIEVNs...VST............LLEV....-IR......................
gi|77459139|ref|YP_348645.1|  ..........------....---............----....---......................
gi|77461503|ref|YP_351010.1|  ..........-REPAPt...HEA............NFGK....LVR......................
gi|77457545|ref|YP_347050.1|  ..........------....---............----....---......................
gi|77456896|ref|YP_346401.1|  ..........------....---............----....---......................
gi|77457125|ref|YP_346630.1|  ..........------....---............----....---......................
gi|77459733|ref|YP_349240.1|  ..........------....---............----....---......................
gi|77456439|ref|YP_345944.1|  ..........-VINLD....FNA............AVAA....LAA......................
gi|77457466|ref|YP_346971.1|  ..........------....---............----....---......................
gi|77458675|ref|YP_348181.1|  ..........--ISVS....LSD............QVSD....LLS......................
gi|77457981|ref|YP_347486.1|  ..........------....---............----....---......................
gi|77459375|ref|YP_348882.1|  ..........------....---............----....---......................
gi|77458585|ref|YP_348090.1|  ..........------....---............----....---......................
gi|77461591|ref|YP_351098.1|  ..........PLLEIG....SRE............SIR-....---......................
gi|77458830|ref|YP_348336.1|  ..........------....---............----....---......................
gi|77458659|ref|YP_348165.1|  ..........RVGYSGa...HDA............TVAW....VQA......................
gi|77456943|ref|YP_346448.1|  ..........------....---............----....---......................
gi|77459507|ref|YP_349014.1|  ..........YVQWLG....SSL............TILA....LVN......................
gi|77457171|ref|YP_346676.1|  ..........------....---............----....---......................
gi|77456255|ref|YP_345760.1|  ..........-LRFDN....YTL............LIQA....AIG......................
gi|77459383|ref|YP_348890.1|  ..........-IIAQP....PEV............AGSA....LQA......................
gi|77459504|ref|YP_349011.1|  ..........------....---............----....---......................
gi|77457677|ref|YP_347182.1|  ..........RAMEIEs...YQG............MLAC....VIA......................
gi|77458588|ref|YP_348093.1|  ..........------....---............----....---......................
gi|77457164|ref|YP_346669.1|  ..........------....---............----....---......................
gi|77456645|ref|YP_346150.1|  ..........------....---............----....---......................
gi|77461779|ref|YP_351286.1|  ..........------....---............-RDK....LRN......................
gi|77457277|ref|YP_346782.1|  ..........------....---............----....---......................
gi|77461152|ref|YP_350659.1|  ..........-VQNMT....ADD............AATA....FIA......................
gi|77456556|ref|YP_346061.1|  ..........-VVVLR....DQD............NARK....LVS......................
gi|77460196|ref|YP_349703.1|  ..........-IETPD....TFS............AVAL....LDE......................
gi|77459903|ref|YP_349410.1|  ..........PAIQVE....GRE............AAR-....---......................
gi|77457685|ref|YP_347190.1|  ..........------....---............----....---......................
gi|77461155|ref|YP_350662.1|  ..........------....---............----....---......................
gi|77457148|ref|YP_346653.1|  ..........------....---............----....---......................
gi|77457225|ref|YP_346730.1|  ..........ESDAVE....VVD............LLRM....VDE......................
gi|77456777|ref|YP_346282.1|  ..........------....---............----....---......................
gi|77459007|ref|YP_348513.1|  ..........------....---............----....---......................
gi|77458947|ref|YP_348453.1|  ..........------....---............----....---......................
gi|77459604|ref|YP_349111.1|  ..........------....---............----....---......................
gi|77457540|ref|YP_347045.1|  ..........------....---............----....---......................
gi|77458467|ref|YP_347972.1|  ..........------....---............----....---......................
gi|77460123|ref|YP_349630.1|  ..........------....---............----....---......................
gi|77457570|ref|YP_347075.1|  ..........-VVNTS....DAD............ISAA....FNT......................
gi|77456344|ref|YP_345849.1|  ..........---NLT....NRT............RPFL....FAD......................
gi|77457610|ref|YP_347115.1|  ..........------....---............----....---......................
gi|77458181|ref|YP_347686.1|  ..........------....---............----....MTR......................
gi|77459944|ref|YP_349451.1|  ..........------....---............----....---......................
gi|77461472|ref|YP_350979.1|  ..........KVPVHN....FAM............AVRM....LAA......................
gi|77460767|ref|YP_350274.1|  ..........------....---............----....---......................
gi|77458891|ref|YP_348397.1|  ..........------....---............----....---......................
gi|77460119|ref|YP_349626.1|  ..........------....---............----....---......................
gi|77459497|ref|YP_349004.1|  ..........------....---............----....---......................
gi|77456366|ref|YP_345871.1|  ..........YTIAVP....HPD............ATAA....LIA......................
gi|77459144|ref|YP_348650.1|  ..........------....---............----....---......................
gi|77456369|ref|YP_345874.1|  ..........------....---............----....---......................
gi|77457630|ref|YP_347135.1|  ..........LAPRLN....CVN............SVSA....ITR......................
gi|77457486|ref|YP_346991.1|  ..........------....---............----....---......................
gi|77460216|ref|YP_349723.1|  ..........------....---............----....---......................
gi|77461386|ref|YP_350893.1|  ..........------....---............----....---......................
gi|77458645|ref|YP_348151.1|  ..........------....---............----....---......................
gi|77459746|ref|YP_349253.1|  ..........------....---............----....---......................
gi|77458091|ref|YP_347596.1|  ..........-QRYRS....ILD............ALGA....VAF......................
gi|77461610|ref|YP_351117.1|  ..........------....---............----....---......................
gi|77456717|ref|YP_346222.1|  ..........------....---............----....---......................
gi|77456922|ref|YP_346427.1|  ..........------....---............----....---......................
gi|77458189|ref|YP_347694.1|  ..........------....---............----....---......................
gi|77461512|ref|YP_351019.1|  ..........------....---............----....---......................
gi|77458795|ref|YP_348301.1|  ..........------....---............----....---......................
gi|77459527|ref|YP_349034.1|  ..........------....--Q............----....---......................
gi|77460812|ref|YP_350319.1|  ..........------....---............----....---......................
gi|77458380|ref|YP_347885.1|  ..........------....---............----....---......................
gi|77457256|ref|YP_346761.1|  ..........IRSVKT....YAE............ARAL....VES......................
gi|77458417|ref|YP_347922.1|  ..........------....---............----....---......................
gi|77461348|ref|YP_350855.1|  ..........------....---............----....---......................
gi|77459904|ref|YP_349411.1|  ..........VLLELD....SRE............AVT-....---......................
gi|77460196|ref|YP_349703.1|  ........alITSYPS....YQN............AINA....VAF......................
gi|77459579|ref|YP_349086.1|  ..........------....---............----....---......................
gi|77456509|ref|YP_346014.1|  ..........------....---............----....---......................
gi|77460531|ref|YP_350038.1|  ..........------....---............----....---......................
gi|77458432|ref|YP_347937.1|  ..........ISVSLP....HPD............ATAA....LIA......................
gi|77458685|ref|YP_348191.1|  ..........------....---............----....---......................
gi|77456796|ref|YP_346301.1|  ..........------....---............----....---......................
gi|77456443|ref|YP_345948.1|  ..........------....---............----....---......................
gi|77456440|ref|YP_345945.1|  ..........------....---............----....--S......................
gi|77461514|ref|YP_351021.1|  ..........TLLSMV....SSG............VGYA....LLP......................
gi|77457657|ref|YP_347162.1|  ..........------....---............----....---......................
gi|77460336|ref|YP_349843.1|  ..........-TRTAN....LTQ............AFQK....LLL......................
gi|77458953|ref|YP_348459.1|  ..........------....---............----....---......................
gi|77460693|ref|YP_350200.1|  ..........------....---............----....---......................
gi|77457612|ref|YP_347117.1|  ..........------....TDV............PIEE....LRD......................
gi|77458012|ref|YP_347517.1|  ..........-SVVVP....PPQ............MVAH....LQA......................
gi|77461737|ref|YP_351244.1|  ..........-MVAED....---............----....---......................
gi|77459929|ref|YP_349436.1|  ..........------....---............----....---......................
gi|77458950|ref|YP_348456.1|  ..........------....---............----....---......................
gi|77458596|ref|YP_348101.1|  ..........------....---............----....---......................
gi|77460559|ref|YP_350066.1|  ..........-VLTAP....QDD............VLAM....LHS......................
gi|77460164|ref|YP_349671.1|  ..........ATLTYS....HDS............NLLM....VLR......................
gi|77460025|ref|YP_349532.1|  ..........------....---............----....---......................
gi|77458799|ref|YP_348305.1|  ..........------....---............----....---......................
gi|77459649|ref|YP_349156.1|  ..........-VIFDN....AAN............LIAA....AEA......................
gi|77456330|ref|YP_345835.1|  ..........------....---............----....---......................
gi|77456912|ref|YP_346417.1|  ..........------....---............----....---......................
gi|77458376|ref|YP_347881.1|  ..........------....---............----....---......................
gi|77460214|ref|YP_349721.1|  ..........------....---............----....---......................
gi|77460544|ref|YP_350051.1|  ..........------....---............----....---......................
gi|77461845|ref|YP_351352.1|  ..........------....---............----....---......................
gi|77458031|ref|YP_347536.1|  ..........------....---............----....---......................
gi|77460241|ref|YP_349748.1|  ..........------....---............----....---......................
gi|77459350|ref|YP_348857.1|  ..........------....---............----....---......................
gi|77461233|ref|YP_350740.1|  ..........-IRTVP....YTR............SVGL....VQL......................
gi|77458508|ref|YP_348013.1|  ..........------....---............----....---......................
gi|77460704|ref|YP_350211.1|  ..........------....---............----....---......................
gi|77459076|ref|YP_348582.1|  ..........------....---............----....---......................
gi|77459000|ref|YP_348506.1|  ..........-LHSDS....MAV............CEQM....LIH......................
gi|77458730|ref|YP_348236.1|  ..........------....---............----....---......................
gi|77460545|ref|YP_350052.1|  ..........------....-HQ............RLMA....LYG......................
gi|77457580|ref|YP_347085.1|  ..........YVALEG....GGE............IATA....LLG......................
gi|77456527|ref|YP_346032.1|  ..........------....---............----....---......................
gi|77457259|ref|YP_346764.1|  ..........------....---............----....---......................
gi|77460567|ref|YP_350074.1|  ..........VGISGG....HRE............SLRW....LRE......................


                                             170       180         190          200         210     
                                               |         |           |            |           |     
d1us5a_                         K..RADALF......YTVGLGASAIQQLA..LTTPIALV.AVDLNR..IQAIAKKYPF..YVGFNIPG
gi|77457042|ref|YP_346547.1|  -..------......--------------..--------.------..----------..--------
gi|77457043|ref|YP_346548.1|  G..ECQVSG......YPRPADIEVMEK--..-DPNLRVL.KQPGFN..LG--------..--------
gi|77457040|ref|YP_346545.1|  -..------......--------------..--------.------..----------..--------
gi|77461759|ref|YP_351266.1|  -..------......--------------..--------.------..----------..--------
gi|77458408|ref|YP_347913.1|  G..QFDYWL......EMAA----------..--------.------..----------..--------
gi|77458409|ref|YP_347914.1|  G..EFDIYIehqaknWANGYNFPAIRR--..--------.------..----------..--------
gi|77459295|ref|YP_348802.1|  R..DYDMIV......TGYPVTT-------..--------.------..----------..--------
gi|77459963|ref|YP_349470.1|  -..------......--------------..--------.------..----------..--------
gi|77459342|ref|YP_348849.1|  R..DYDMIV......VGYPVSQAPGRE--..--------.------..----------..--------
gi|77461625|ref|YP_351132.1|  -..------......--------------..--------.------..----------..--------
gi|77458344|ref|YP_347849.1|  G..NICVAV......GYSGDVLQAKARAV..ESGNNVVI.DYSIPK..EGAG----SF..YDMVAI--
gi|77459054|ref|YP_348560.1|  G..DICVAF......GYSGDVFRAANRAKe.AKNGVN--.------..----------..--------
gi|77461852|ref|YP_351359.1|  G..DICVAV......GYSGSFSQAANRAK..EAKNGVVV.DMRLPK..EGAP-----I..--------
gi|77461626|ref|YP_351133.1|  G..NICVAV......GYSGDLEQSKTRAK..EAGDKVKL.AYTIPK..EGAG------..--------
gi|77459482|ref|YP_348989.1|  G..DICVAI......GYSGSFYQFGNRAK..EAGNGV--.------..----------..--------
gi|77458902|ref|YP_348408.1|  G..DICVAV......GFSGDILQAENRAK..EAKNGIDI.GYEIPK..EGAA------..--------
gi|77458800|ref|YP_348306.1|  G..SVCLAL......TYNGDASMAADQAR..KANKPFEV.AYRIPK..EGTL------..--------
gi|77459754|ref|YP_349261.1|  G..NICVAV......GWSGAMLEAKSTAE..QAGNGVKI.RYSLPKegAPVW------..--------
gi|77456422|ref|YP_345927.1|  G..QGDVLL......AWENEAFLALKEDG..GKDKFDIV.VPSLSI..LA--------..--------
gi|77458599|ref|YP_348104.1|  -..------......--------------..--------.------..----------..--------
gi|77461708|ref|YP_351215.1|  G..EYDAII......LAAA----------..--------.------..----------..--------
gi|77457818|ref|YP_347323.1|  -..------......--------------..--------.------..----------..--------
gi|77456295|ref|YP_345800.1|  T..QVDLAL......INTNYALEAKLD--..PSKDALVI.EGSDSP..----------..--------
gi|77458382|ref|YP_347887.1|  G..NICVAM......SWNGNVAIAAGQAE..AARKPFKL.NYRIPK..EGTL------..--------
gi|77456253|ref|YP_345758.1|  Q..KFVTFL......GWTPHPMNVQLKMHy.LKGGEKYF.GDTGSV..YTLTRKGYAE..ACP---NV
gi|77461459|ref|YP_350966.1|  D..TAVVFL......GWAPHPMNKRFKIQy.LTGGDDFF.GPDFGA..ATVATNTRKG..YAEE----
gi|77456451|ref|YP_345956.1|  K..EVDLDM......INTNYALEAKLN--..PTKDALVI.-EGADS..P---------..--------
gi|77459541|ref|YP_349048.1|  G..KPVLFY......YWSPTPLLGKFKL-..--IQLEEP.PFDAEA..WKTLTDA---..--------
gi|77460565|ref|YP_350072.1|  G..KPVLFY......YWSPTPLLGRFKL-..--VKLEEP.PFDAEA..WKTLADANNPnpKGTRSMPA
gi|77461651|ref|YP_351158.1|  -..------......--------------..--------.------..----------..--------
gi|77458865|ref|YP_348371.1|  -..------......--------------..--------.------..----------..--------
gi|77457833|ref|YP_347338.1|  N..ESIAVT......GWVPHWMFAK----..--WKLRFL.DDPKGV..YGAA------..--------
gi|77459367|ref|YP_348874.1|  G..EVIMMQ......NWNGSTARATLQ--..-KSTIKYV.-YPKEG..LAMF------..--------
gi|77456472|ref|YP_345977.1|  G..RTDAIL......IDRLAALEYAQK--..-APKTVAA.GEAFSR..Q---------..--------
gi|77461451|ref|YP_350958.1|  K..EAVVFF......GWAPHPMNVNVQMTy.LTGSDDAL.GP----..------NEGM..ATVWTVTA
gi|77456590|ref|YP_346095.1|  G..EPILFY......YWSPTPLMGQID--..--------.------..----------..--------
gi|77459062|ref|YP_348568.1|  -..------......--------------..--------.------..----------..--------
gi|77456597|ref|YP_346102.1|  K..EFVVFV......GWTPHPMNINMKIT..YLTGSEDV.YGPNEG..A---------..--------
gi|77456759|ref|YP_346264.1|  G..EVATVL......VNNYYWFALQRE-K..GKLDSKLH.YFTGGD..VGGLIT----..--------
gi|77461836|ref|YP_351343.1|  -..------......--------------..--------.------..----------..--------
gi|77459394|ref|YP_348901.1|  -..------......--------------..--------.------..----------..--------
gi|77458291|ref|YP_347796.1|  G..RIDAML......ADSVNLSDGFLKTD..AGKGFEFV.GPTYED..AKYF------..--------
gi|77460513|ref|YP_350020.1|  G..RLDGTV......ADATLLNDGFLKTD..AGKGFAFV.GPAFT-..----------..--------
gi|77456539|ref|YP_346044.1|  G..RLDGIL......ADKYVNYEWLKS-D..AGKAYEFK.GDPVEE..SD--------..--------
gi|77457194|ref|YP_346699.1|  G..RLDAIF......ADTIPLTDFLSM-P..RGKGYAFV.G-----..----------..--------
gi|77461588|ref|YP_351095.1|  -..------......--------------..--------.------..----------..--------
gi|77459463|ref|YP_348970.1|  -..------......--------------..--------.------..----------..--------
gi|77456603|ref|YP_346108.1|  G..KADAFI......YDAPYNVVAVNK-V..GAGKLVFL.DKPFTY..EP--------..--------
gi|77460756|ref|YP_350263.1|  G..RAVAFM......MDDALLAGEAAKAK..KASDWAVT.GTPQSY..E---------..--------
gi|77458562|ref|YP_348067.1|  -..------......--------------..--------.------..----------..--------
gi|77456465|ref|YP_345970.1|  -..------......--------------..--------.------..----------..--------
gi|77457097|ref|YP_346602.1|  -..------......--------------..--------.------..----------..--------
gi|77457032|ref|YP_346537.1|  G..QVFAGL......VYTTDG--RLN---..-AFGLKLL.EDDKHY..FPDY------..--------
gi|77459005|ref|YP_348511.1|  G..SVDVLTd.....IWLPNQSAAWAKYV..TGGTRSLV.PNAHPY..AGEQ------..--------
gi|77461345|ref|YP_350852.1|  -..------......--------------..--------.------..----------..--------
gi|77457437|ref|YP_346942.1|  G..RLDAGI......QDMLQAELGFLKSP..QGADYEV-.------..----------..--------
gi|77459166|ref|YP_348672.1|  -..------......--------------..--------.------..----------..--------
gi|77460297|ref|YP_349804.1|  -..------......--------------..--------.------..----------..--------
gi|77459872|ref|YP_349379.1|  A..SADLAA......SSRPIKDSELLNLQ..ARGD----.------..----------..--------
gi|77456456|ref|YP_345961.1|  G..RGDAYA......QDNLVLFSWAKQ--..-NPGYRVL.DEKLGA..EAP-------..--------
gi|77461510|ref|YP_351017.1|  G..RAAAFY......MDDALLYGERAKAR..DPHNWVVV.GEEQSR..E---------..--------
gi|77459027|ref|YP_348533.1|  V..RLDAMV......TNLITARERIAQ--..-DPRFKIA.GDPLYA..E---------..--------
gi|77459852|ref|YP_349359.1|  -..------......--------------..--------.------..----------..--------
gi|77457275|ref|YP_346780.1|  -..------......--------------..--------.------..----------..--------
gi|77461635|ref|YP_351142.1|  G..SVDAWV......IWDPYQAAAEKQ--..--LQAHTL.RDGKGI..VDNH------..--------
gi|77459314|ref|YP_348821.1|  G..RADAAA......TDQSSVKYLMVQ--..--NPGRYR.SPTYAW..SPQT------..--------
gi|77461680|ref|YP_351187.1|  G..QVDLIA......SGNVVMVAISEK--..--------.------..----------..--------
gi|77459080|ref|YP_348586.1|  S..RIDAAM......QGSETLSYLKTQE-..-KDMYKTV.GQP---..----------..--------
gi|77460591|ref|YP_350098.1|  R..AV----......--------------..--------.------..----------..--------
gi|77460690|ref|YP_350197.1|  -..------......--------------..--------.------..----------..--------
gi|77457351|ref|YP_346856.1|  -..------......--------------..--------.------..----------..--------
gi|77457411|ref|YP_346916.1|  -..------......--------------..--------.------..----------..--------
gi|77460131|ref|YP_349638.1|  -..------......--------------..--------.------..----------..-FSEDLKA
gi|77457661|ref|YP_347166.1|  -..------......--------------..--------.------..----------..--------
gi|77458197|ref|YP_347702.1|  -..------......--------------..--------.------..----------..--------
gi|77460696|ref|YP_350203.1|  -..------......--------------..--------.------..----------..--------
gi|77461371|ref|YP_350878.1|  D..EVDAVV......GDLASSVWSLRQ--..--LKLDGL.YVSGET..----------..--------
gi|77459516|ref|YP_349023.1|  G..DVDAWA......GLDPHMAASQVQ--..--AGSRLL.YRNRDF..NS--------..--------
gi|77460858|ref|YP_350365.1|  -..------......--------------..--------.------..----------..--------
gi|77458661|ref|YP_348167.1|  -..------......--------------..--------.------..----------..--------
gi|77459874|ref|YP_349381.1|  -..------......--------------..--------.------..----------..--------
gi|77461861|ref|YP_351368.1|  R..ECVVAG......LGLALLTRHALNLEl.ATGGLVEL.PV----..----------..--------
gi|77458589|ref|YP_348094.1|  E..RYDAAI......RIGELPDSSLVAKT..ITANRHII.CASPDY..LAAH------..--------
gi|77460541|ref|YP_350048.1|  -..------......--------------..--------.------..----------..--------
gi|77458304|ref|YP_347809.1|  -..------......--------------..--------.------..----------..--------
gi|77461122|ref|YP_350629.1|  -..------......--------------..--------.------..----------..--------
gi|77460036|ref|YP_349543.1|  N..KADVMI......TDASEALY------..--------.------..----------..--------
gi|77457913|ref|YP_347418.1|  G..EIEVGV......VWDFNGLSYKAKMA..NPDDYVVLiPSDGSV..IS--------..--------
gi|77458663|ref|YP_348169.1|  E..RVDCVI......RGGPLTEQTLA---..--------.------..----------..--------
gi|77456484|ref|YP_345989.1|  G..DIDATY......VWDPALGVAKEN--..--GKVLIT.SGELAK..FGAP------..--------
gi|77459913|ref|YP_349420.1|  -..------......--------------..--------.A-----..----------..--------
gi|77457200|ref|YP_346705.1|  G..RCDVLT......SDKSQLFAQRSKLA..SPKDYVVL.PETISK..E---------..--------
gi|77461639|ref|YP_351146.1|  G..DIDGAF......VWSPALGEIRKTGK..----TLTD.AAQVGQ..WGAP------..--------
gi|77459501|ref|YP_349008.1|  -..------......--------------..-----R--.------..----------..--------
gi|77459989|ref|YP_349496.1|  -..---A--......--------------..--------.------..----------..--------
gi|77459734|ref|YP_349241.1|  -..------......--------------..--------.------..----------..--------
gi|77459646|ref|YP_349153.1|  K..RIDACV......FRVGYDDPQLRNELl.IHEPIHVV.------..----------..--------
gi|77461911|ref|YP_351418.1|  -..------......--------------..--------.------..----------..--------
gi|77458595|ref|YP_348100.1|  -..------......--------------..--------.------..----------..--------
gi|77456947|ref|YP_346452.1|  -..------......--------------..--------.------..-E--------..--------
gi|77460224|ref|YP_349731.1|  -..------......--------------..--------.------..----------..--------
gi|77458091|ref|YP_347596.1|  G..RADATL......SSLLVARYQIDH-Q..YRERLRIA.------..----------..--------
gi|77460407|ref|YP_349914.1|  -..------......--------------..--------.------..----------..--------
gi|77458938|ref|YP_348444.1|  E..QLDASI......RYGLLADSSLVSLAl.APSNRRTV.CASPDY..LAR-------..--------
gi|77458668|ref|YP_348174.1|  -..------......--------------..--------.------..----------..--------
gi|77459515|ref|YP_349022.1|  G..SIDAFP......VWEPYISQQIVF--..--SGARPI.LTAKNL..MPGL------..--------
gi|77459029|ref|YP_348535.1|  -..------......--------------..--------.------..----------..--------
gi|77458115|ref|YP_347620.1|  -..------......--------------..--------.------..----------..--------
gi|77458299|ref|YP_347804.1|  W..QCDAGA......ISLYYPSRTLLP--..--------.------..----------..--------
gi|77459590|ref|YP_349097.1|  H..APIATM......LPEAI----AT---..EDRALRRL.HVESEA..PQR-------..--------
gi|77459139|ref|YP_348645.1|  G..------......--------------..--------.------..----------..--------
gi|77461503|ref|YP_351010.1|  G..RIDLLI......TDRRVGQHLLDELG..IRDKITEN.PTVISR..Q---------..--------
gi|77457545|ref|YP_347050.1|  -..-----A......GVLP----------..--------.------..----------..--------
gi|77456896|ref|YP_346401.1|  -..------......--------------..--------.------..----------..--------
gi|77457125|ref|YP_346630.1|  -..------......--------------..--------.------..----------..--------
gi|77459733|ref|YP_349240.1|  -..------......--------------..--------.------..----------..--------
gi|77456439|ref|YP_345944.1|  K..QIDASW......GSSGLTALQAKGLAe.LPLNTKDL.GGAGS-..----------..--------
gi|77457466|ref|YP_346971.1|  -..AALAGA......GIARLPSYLLQAEL..ADGRLRWL.LRDFQT..-----RRMPM..YLV-----
gi|77458675|ref|YP_348181.1|  E..QIDVSV......RLG-----------..--------.------..----------..--------
gi|77457981|ref|YP_347486.1|  -..GFDAAI......GGGFELPQGVVARR..LTPAHRVL.VASADY..LDRY------..--------
gi|77459375|ref|YP_348882.1|  -..------......--------------..--------.------..----------..--------
gi|77458585|ref|YP_348090.1|  -..------......--------------..--------.------..----------..--------
gi|77461591|ref|YP_351098.1|  -..--EAVL......RNIGISIIARQEVP..HDPQLRVL.------..----------..--------
gi|77458830|ref|YP_348336.1|  -..------......--------------..--------.------..----------..--------
gi|77458659|ref|YP_348165.1|  G..KVDAGV......LNASVWQKLVDAGKv.DTNKVKVF.ATTPTY..FD--------..--------
gi|77456943|ref|YP_346448.1|  -..------......--------------..--------.------..----------..--------
gi|77459507|ref|YP_349014.1|  A..GMGLAL......VP------------..--------.------..----------..--------
gi|77457171|ref|YP_346676.1|  -..------......--------------..--------.------..----------..--------
gi|77456255|ref|YP_345760.1|  G..QGVAIG......WRHLVDNLLTQ---..--------.------..----------..--------
gi|77459383|ref|YP_348890.1|  G..KIDAHA......DFVPFAELFPSR--..--GFARKI.YDGAQA..NAPT------..--------
gi|77459504|ref|YP_349011.1|  -..------......--------------..--------.------..----------..--------
gi|77457677|ref|YP_347182.1|  G..SGVALM......SESML---------..--------.------..----------..--------
gi|77458588|ref|YP_348093.1|  -..------......--------------..--------.------..----------..--------
gi|77457164|ref|YP_346669.1|  -..------......--------------..--------.------..----------..--------
gi|77456645|ref|YP_346150.1|  G..LVAAGL......GVSVMPASYQRMRI..DGVVYRPL.LDPEAV..----------..--------
gi|77461779|ref|YP_351286.1|  G..ELDAII......IALPFNEADVLTLQ..L-------.------..----------..--------
gi|77457277|ref|YP_346782.1|  -..------......--------------..--------.------..----------..--------
gi|77461152|ref|YP_350659.1|  G..RVPAAV......TWEPHLSMVRDR--..--QQGKVL.IDSSST..PGVI------..--------
gi|77456556|ref|YP_346061.1|  G..QIDLWA......TGDPAGRYLARQ--..--DGVTGL.KTVLRF..NS--------..--------
gi|77460196|ref|YP_349703.1|  G..QVEGAV......NSLVIANYFIASRT..FEHPLQIT.------..----------..--------
gi|77459903|ref|YP_349410.1|  -..--EAVV......VGIGVGVVSAAEFG..--ADSRVC.ALPITD..CTRR------..--------
gi|77457685|ref|YP_347190.1|  -..------......----LPEHYAQAWA..DKGDLRVL.------..----------..--------
gi|77461155|ref|YP_350662.1|  -..------......--------------..--------.------..----------..--------
gi|77457148|ref|YP_346653.1|  -..------......--------------..--------.------..----------..--------
gi|77457225|ref|YP_346730.1|  G..QIDLTL......VDSNEVAMNQVY--..--------.------..----------..--------
gi|77456777|ref|YP_346282.1|  -..------......--------------..-G------.------..----------..--------
gi|77459007|ref|YP_348513.1|  -..------......--------------..------A-.------..----------..--------
gi|77458947|ref|YP_348453.1|  -..------......--------------..--------.------..----------..--------
gi|77459604|ref|YP_349111.1|  -..------......--------------..--------.------..----------..--------
gi|77457540|ref|YP_347045.1|  -..------......--------------..--------.------..----------..--------
gi|77458467|ref|YP_347972.1|  -..------......--------------..--------.------..----------..--------
gi|77460123|ref|YP_349630.1|  -..------......--------------..--------.------..----------..--------
gi|77457570|ref|YP_347075.1|  E..QVNAVT......TWNPMLSDIKAK--..--PGVTEV.FNSSQI..PGEI------..--------
gi|77456344|ref|YP_345849.1|  T..DFDAAI......YF------------..--------.------..----------..--------
gi|77457610|ref|YP_347115.1|  -..------......--------------..--------.------..----------..--------
gi|77458181|ref|YP_347686.1|  G..RIVAGL......SSSLLVRRSIAA--..-GLGVGEI.PVYMGE..RDGLVRLWPE..--------
gi|77459944|ref|YP_349451.1|  -..------......--------------..--------.------..----------..--------
gi|77461472|ref|YP_350979.1|  D..RVKLTL......EDEYVARYYLARESpkVRNAVEFL.PKPLSE..N---------..--------
gi|77460767|ref|YP_350274.1|  -..------......--------------..--------.------..----------..--------
gi|77458891|ref|YP_348397.1|  -..------......--------------..--------.------..----------..--------
gi|77460119|ref|YP_349626.1|  -..------......--------------..--------.------..----------..--------
gi|77459497|ref|YP_349004.1|  -..------......--------------..--------.------..----------..--------
gi|77456366|ref|YP_345871.1|  G..GTELTG......HFSNPPFQ--DQAL..ENPNVHVV.LNSYDV..LGPN------..--------
gi|77459144|ref|YP_348650.1|  -..------......--------------..--------.------..----------..--------
gi|77456369|ref|YP_345874.1|  -..------......--------------..--------.------..----------..--------
gi|77457630|ref|YP_347135.1|  L..LRDGFG......IGALPPVLVAEE-L..TRGELTLL.DIEQR-..----------..--------
gi|77457486|ref|YP_346991.1|  -..------......--------------..--------.------..----------..--------
gi|77460216|ref|YP_349723.1|  -..------......--------------..--------.------..----------..--------
gi|77461386|ref|YP_350893.1|  -..------......--------------..--------.------..----------..--------
gi|77458645|ref|YP_348151.1|  -..------......--------------..--------.------..----------..--T-----
gi|77459746|ref|YP_349253.1|  -..------......--------------..--------.------..----------..--------
gi|77458091|ref|YP_347596.1|  G..RDDLYL......GDFISASYLINT-H..FQNDLQL-.------..----------..--------
gi|77461610|ref|YP_351117.1|  -..------......--------------..--------.------..----------..--------
gi|77456717|ref|YP_346222.1|  -..------......Y-------------..--------.------..----------..--------
gi|77456922|ref|YP_346427.1|  -..------......--------------..--------.------..-------L--..--------
gi|77458189|ref|YP_347694.1|  -..------......--------------..--------.------..----------..--------
gi|77461512|ref|YP_351019.1|  -..------......--------------..--------.------..----------..--------
gi|77458795|ref|YP_348301.1|  -..------......--------------..--------.------..----------..--------
gi|77459527|ref|YP_349034.1|  -..------......--------------..--------.------..----------..--------
gi|77460812|ref|YP_350319.1|  -..------......--------------..--------.------..----------..--------
gi|77458380|ref|YP_347885.1|  -..------......--------------..--------.------..----------..--------
gi|77457256|ref|YP_346761.1|  G..EAYATI......--------------..--------.------..----------..--------
gi|77458417|ref|YP_347922.1|  -..------......--------------..--------.------..----------..--------
gi|77461348|ref|YP_350855.1|  -..------......--------------..--------.------..----------..--------
gi|77459904|ref|YP_349411.1|  -..------......--------------..--------.------..----------..--------
gi|77460196|ref|YP_349703.1|  D..QADVFL......GDTISTHYMISKG-..--------.------..----------..--------
gi|77459579|ref|YP_349086.1|  -..------......--------------..--------.------..----------..--------
gi|77456509|ref|YP_346014.1|  -..------......--------------..--------.------..----------..--------
gi|77460531|ref|YP_350038.1|  -..------......--------------..--------.------..---------R..--------
gi|77458432|ref|YP_347937.1|  GgsEINAHF......SSPPFQYQALQN--..--PNVHKV.LSSYDV..LGGQ------..--------
gi|77458685|ref|YP_348191.1|  -..------......--------------..--------.------..----------..--------
gi|77456796|ref|YP_346301.1|  -..------......--------------..--------.------..----------..--------
gi|77456443|ref|YP_345948.1|  -..--D---......--------------..--------.------..----------..--------
gi|77456440|ref|YP_345945.1|  G..RIDFSP......TIETEHFPALVKVV..LQSNAIGV.GTEEAF..VEDI------..-AQGSLAL
gi|77461514|ref|YP_351021.1|  G..RIAAVY......ENRVKLIPLQEKYR..--------.------..----------..--------
gi|77457657|ref|YP_347162.1|  -..------......--------------..--------.------..----------..--------
gi|77460336|ref|YP_349843.1|  G..EVEYVL......AGRYSGMAAAQALG..MANDLLAF.EQPIDR..----------..--------
gi|77458953|ref|YP_348459.1|  -..------......--------------..--------.------..----------..--------
gi|77460693|ref|YP_350200.1|  -..------......--------------..--------.------..----------..--------
gi|77457612|ref|YP_347117.1|  G..SLDLVI......CFGPNFHRSHAD--..--LKSRML.------..----------..--------
gi|77458012|ref|YP_347517.1|  G..RIDGFC......VGEPWAASAVQQ--..-SLGFTLA.-TSQTI..WPDH------..--------
gi|77461737|ref|YP_351244.1|  -..------......--------------..--------.------..----------..--------
gi|77459929|ref|YP_349436.1|  -..------......--------------..--------.------..----------..--------
gi|77458950|ref|YP_348456.1|  -..------......--------------..--------.------..----------..--------
gi|77458596|ref|YP_348101.1|  -..------......--------------..---DGLLQ.PLVDET..IR--------..--------
gi|77460559|ref|YP_350066.1|  G..RVSVCL......AFAGLSVNVL----..--------.------..----------..--------
gi|77460164|ref|YP_349671.1|  G..RADIAL......VTRSYLFDYLLRNE..KVRDELLV.SQRIDQ..I---------..--------
gi|77460025|ref|YP_349532.1|  -..------......--------------..--------.------..----------..--------
gi|77458799|ref|YP_348305.1|  -..------......--------------..--------.------..----------..--------
gi|77459649|ref|YP_349156.1|  G..VGAGLV......-RGLLAADAL----..--RSGRLV.ALNQAQ..IAAH------..--------
gi|77456330|ref|YP_345835.1|  -..------......--------------..--------.----G-..----------..--------
gi|77456912|ref|YP_346417.1|  -..------......--------------..--------.------..----------..--------
gi|77458376|ref|YP_347881.1|  -..------......--------------..--------.------..----------..--------
gi|77460214|ref|YP_349721.1|  -..----AV......VSAGLAITAQLESL..ITPDMRIL.GD----..----------..--------
gi|77460544|ref|YP_350051.1|  -..------......--------------..--------.------..----------..--------
gi|77461845|ref|YP_351352.1|  -..------......--------------..--------.------..----------..--------
gi|77458031|ref|YP_347536.1|  -..------......--------------..--------.------..----------..--------
gi|77460241|ref|YP_349748.1|  -..------......--------------..--------.------..----------..--------
gi|77459350|ref|YP_348857.1|  -..------......--------------..--------.------..----------..--------
gi|77461233|ref|YP_350740.1|  K..EADALV......GSYRGEAEQVLY--..--------.------..----------..--------
gi|77458508|ref|YP_348013.1|  -..------......--------------..--------.------..----------..--------
gi|77460704|ref|YP_350211.1|  -..------......--------------..--------.------..----------..--------
gi|77459076|ref|YP_348582.1|  -..------......--------------..--------.------..--------QH..YAAALVAA
gi|77459000|ref|YP_348506.1|  G..QVQ---......--------------..--------.------..----------..--------
gi|77458730|ref|YP_348236.1|  -..------......--------------..--------.------..----------..--------
gi|77460545|ref|YP_350052.1|  R..SPEAVA......GHAGSLQQALHMVA..AGVGVAML.P-----..----------..--------
gi|77457580|ref|YP_347085.1|  G..HIQVGS......TDISDSMPHIQS--..--GDMRLL.AVF---..----------..--------
gi|77456527|ref|YP_346032.1|  -..------......--------------..--------.------..----------..--------
gi|77457259|ref|YP_346764.1|  -..------......--------------..--------.------..----------..--------
gi|77460567|ref|YP_350074.1|  D..RADLAA......IDSVTFAYLAQYAAa.EVSGLRVV.ARSAFS..----------..--------


                                   220       230       240           250       260         270      
                                     |         |         |             |         |           |      
d1us5a_                         GTY.KGVDVTTPTVAVQAMLIASERL....SEETVYKFMKAVFGNLEAFK..KIHPNLERFFGLEKAV
gi|77457042|ref|YP_346547.1|  ---.----------------------....--------------------..----------------
gi|77457043|ref|YP_346548.1|  ---.---------------FLAYNT-....--------------------..----------------
gi|77457040|ref|YP_346545.1|  ---.----------------------....--------------------..----------------
gi|77461759|ref|YP_351266.1|  ---.----------------------....--------------------..---------A------
gi|77458408|ref|YP_347913.1|  ---.----------------------....--------------------..----------------
gi|77458409|ref|YP_347914.1|  ---.----------------------....--------------------..----------------
gi|77459295|ref|YP_348802.1|  ---.----------------------....--------------------..----------------
gi|77459963|ref|YP_349470.1|  ---.----------------------....--------------------..----------------
gi|77459342|ref|YP_348849.1|  ---.----------------------....--------------------..----------------
gi|77461625|ref|YP_351132.1|  ---.----------------------....--------------------..----------------
gi|77458344|ref|YP_347849.1|  ---.------------------PRDAa...NVENAYLFMDFLMR------..----------------
gi|77459054|ref|YP_348560.1|  ---.----------------------....--------------------..----------------
gi|77461852|ref|YP_351359.1|  ---.-----------WFDMLAIPKGAk...NPQDAYTFINYLLQ------..----------------
gi|77461626|ref|YP_351133.1|  ---.----------TFYDMVAIPKDAe...NVEAAYKFMNYLLE------..----------------
gi|77459482|ref|YP_348989.1|  ---.----------------------....--------------------..----------------
gi|77458902|ref|YP_348408.1|  ---.-----------IWFDMVAMPADap..DEKAGYAFMNYLLQ------..----------------
gi|77458800|ref|YP_348306.1|  ---.----------VWQDNLAIPKDAp...HPEAARTFIEFMLR------..----------------
gi|77459754|ref|YP_349261.1|  ---.------------FDTLVLLKDAp...HPAQGLAFIDYLLR------..----------------
gi|77456422|ref|YP_345927.1|  ---.-----------EPPVAVVDKNAekkgNEQIAEAYLKHLYS------..----------------
gi|77458599|ref|YP_348104.1|  ---.----------------------....--------------------..----------------
gi|77461708|ref|YP_351215.1|  ---.----------------------....--------------------..----------------
gi|77457818|ref|YP_347323.1|  ---.----------------------....--------------------..----------------
gi|77456295|ref|YP_345800.1|  ---.-----------YVNILVSRADNk...DSDAMKKLAAALHS------..----------------
gi|77458382|ref|YP_347887.1|  ---.----------IWFDAMVIPKDAp...HPEAGLALMDYLMT------..----------------
gi|77456253|ref|YP_345758.1|  GKLlTNLAFTQEMENSIMAEVVNKKVs...NAEAVK----------AWIK..A---------------
gi|77461459|ref|YP_350966.1|  ---.----------------------....--------------------..----------------
gi|77456451|ref|YP_345956.1|  ---.-----------YVNFLVAREDNk...NSDAIKKLAAALTS------..----------------
gi|77459541|ref|YP_349048.1|  --D.NPNPKPTRSLASKLSIGVSTPFqkq.HPEIAEFFSKVDFP------..----------------
gi|77460565|ref|YP_350072.1|  SLA.IGVSAPFKAQYPELVTFFE---....--------------------..----------------
gi|77461651|ref|YP_351158.1|  ---.----------------------....--------------------..----------------
gi|77458865|ref|YP_348371.1|  ---.----------------------....--------------------..----------------
gi|77457833|ref|YP_347338.1|  ---.----------------------....--------------------..----------------
gi|77459367|ref|YP_348874.1|  ---.------------QDNFAVPKSAp...HPGNARIFIDWMMK------..----------------
gi|77456472|ref|YP_345977.1|  ---.------------EAGIALRKG-....EPELLAAVNKALDE------..----------------
gi|77461451|ref|YP_350958.1|  PKY.AEQCPNVSRLLSNLTFTAEDESr...MMQPLLDHKDAFESAKQWLK..DHPQ------------
gi|77456590|ref|YP_346095.1|  ---.----------------------....--------------------..----------------
gi|77459062|ref|YP_348568.1|  ---.----------------------....--------------------..----------------
gi|77456597|ref|YP_346102.1|  ---.----------------------....--------------------..----------------
gi|77456759|ref|YP_346264.1|  ---.-----------VSSAAVLKSSK....HPKEAQQFLAYMA-------..----------------
gi|77461836|ref|YP_351343.1|  ---.----------------------....--------------------..----------------
gi|77459394|ref|YP_348901.1|  ---.----------------------....--------------------..----------------
gi|77458291|ref|YP_347796.1|  ---.----------GGGAGIAVRKG-....DTELAEKFNTAINE------..----------------
gi|77460513|ref|YP_350020.1|  ---.-----DVKYFGDGVGIAVRKGDa...LKDKINTAIAAIRENGKY--..----------------
gi|77456539|ref|YP_346044.1|  ---.------------KIGIAVRKGD....--------------------..----------------
gi|77457194|ref|YP_346699.1|  ---.----------------------....--------------------..----------------
gi|77461588|ref|YP_351095.1|  ---.----------------------....--------------------..----------------
gi|77459463|ref|YP_348970.1|  ---.----------------------....--------------------..----------------
gi|77456603|ref|YP_346108.1|  ---.------------LAFGLKKGDYd...SLNFINNFLHQIHEDGTY--..----------------
gi|77460756|ref|YP_350263.1|  ---.------------IYGCMMRKGDep..FKKAVDDAIKATYASGEINK..IYEKWFMQP-------
gi|77458562|ref|YP_348067.1|  ---.----------------------....--------------------..----------------
gi|77456465|ref|YP_345970.1|  ---.----------------------....--------------------..----------------
gi|77457097|ref|YP_346602.1|  ---.----------------------....--------------------..----------------
gi|77457032|ref|YP_346537.1|  ---.------------TAAPVVRQAYlda.HPQLAEQL------------..----------------
gi|77459005|ref|YP_348511.1|  ---.----------------------....--------------------..----------------
gi|77461345|ref|YP_350852.1|  ---.----------------------....--------------------..----------------
gi|77457437|ref|YP_346942.1|  ---.----------------------....--------------------..----------------
gi|77459166|ref|YP_348672.1|  ---.----------------------....--------------------..----------------
gi|77460297|ref|YP_349804.1|  ---.----------------------....--------------------..----------------
gi|77459872|ref|YP_349379.1|  ---.----------------------....--------------------..----------------
gi|77456456|ref|YP_345961.1|  ---.----------------------....--------------------..----------------
gi|77461510|ref|YP_351017.1|  ---.------------IYSCMVRKDDpq..FLALVNGVLADLYSSGE---..----------------
gi|77459027|ref|YP_348533.1|  ---.------------PNVVAVE---....--------------------..----------------
gi|77459852|ref|YP_349359.1|  ---.----------------------....--------------------..----------------
gi|77457275|ref|YP_346780.1|  ---.----------------------....--------------------..----------------
gi|77461635|ref|YP_351142.1|  ---.------------QFYLATKPYAqk..NPEVIKTLVEEVRAVGEWSK..ANPEDVTQQV------
gi|77459314|ref|YP_348821.1|  ---.------------YACAVKRG--....DQD-----------------..----------------
gi|77461680|ref|YP_351187.1|  ---.----------------------....--------------------..----------------
gi|77459080|ref|YP_348586.1|  ---.----------------------....--------------------..----------------
gi|77460591|ref|YP_350098.1|  ---.----------------------....--------------------..----------------
gi|77460690|ref|YP_350197.1|  ---.----------------------....--------------------..----------------
gi|77457351|ref|YP_346856.1|  ---.----------------------....--------------------..----------------
gi|77457411|ref|YP_346916.1|  ---.----------------------....--------------------..----------------
gi|77460131|ref|YP_349638.1|  GRV.IALLQDYQTRSLPIHAVSPANRr...QSARVNAFVDFMTQAL----..----------------
gi|77457661|ref|YP_347166.1|  ---.----------------------....--------------------..----------------
gi|77458197|ref|YP_347702.1|  ---.----------------------....--------------------..----------------
gi|77460696|ref|YP_350203.1|  ---.------------------S---....--------------------..----------------
gi|77461371|ref|YP_350878.1|  ---.----------------------....--------------------..----------------
gi|77459516|ref|YP_349023.1|  ---.------------YGVVSVTEQYakq.HPQTIDTVIKAYEQAREWSV..KNPEELAKLLAS----
gi|77460858|ref|YP_350365.1|  ---.----------------------....--------------------..----------------
gi|77458661|ref|YP_348167.1|  ---.----------------------....--------------------..----------------
gi|77459874|ref|YP_349381.1|  ---.----------------------....--------------------..----------------
gi|77461861|ref|YP_351368.1|  ---.----------------------....--------------------..----------------
gi|77458589|ref|YP_348094.1|  ---.----------------------....--------------------..----------------
gi|77460541|ref|YP_350048.1|  ---.----------------------....--------------------..----------------
gi|77458304|ref|YP_347809.1|  ---.----------------------....--------------------..----------------
gi|77461122|ref|YP_350629.1|  ---.----------------------....--------------------..----------------
gi|77460036|ref|YP_349543.1|  ---.----------------------....--------------------..----------------
gi|77457913|ref|YP_347418.1|  ---.------------GYTTIINKYAk...NPNAAKLTREYIFS------..----------------
gi|77458663|ref|YP_348169.1|  ---.----------------------....--------------------..----------------
gi|77456484|ref|YP_345989.1|  ---.-----------TFDAWIVRKDFaek.HPEIVTAFAKVTLDAYADYR..KDPKAW----------
gi|77459913|ref|YP_349420.1|  ---.----------------------....--------------------..----------------
gi|77457200|ref|YP_346705.1|  ---.------------PLGPVVRNGDde..WLAIVRWV------------..----------------
gi|77461639|ref|YP_351146.1|  ---.-----------TFEVWVARKDFaek.HPEVVAKFAKVTLDSFADYA..AHKDSW----------
gi|77459501|ref|YP_349008.1|  ---.----------------------....--------------------..----------------
gi|77459989|ref|YP_349496.1|  ---.----------------------....--------------------..----------------
gi|77459734|ref|YP_349241.1|  ---.----------------------....--------------------..----------------
gi|77459646|ref|YP_349153.1|  ---.----------------------....--------------------..----------------
gi|77461911|ref|YP_351418.1|  ---.----------------------....--------------------..----------------
gi|77458595|ref|YP_348100.1|  ---.--------------F-------....--------------------..----------------
gi|77456947|ref|YP_346452.1|  ---.----------------------....--------------------..----------------
gi|77460224|ref|YP_349731.1|  ---.----------------------....--------------------..----------------
gi|77458091|ref|YP_347596.1|  ---.----------------------....--------------------..----------------
gi|77460407|ref|YP_349914.1|  ---.----------------------....--------------------..----------------
gi|77458938|ref|YP_348444.1|  ---.----------------------....--------------------..----------------
gi|77458668|ref|YP_348174.1|  ---.----------------------....--------------------..----------------
gi|77459515|ref|YP_349022.1|  ---.------------SAIAASAPSIds..KREAIADFLGRLKQARAWVD..SHTDEYADLWAKKA--
gi|77459029|ref|YP_348535.1|  ---.----------------------....--------------------..----------------
gi|77458115|ref|YP_347620.1|  ---.----------------------....--------------------..----------------
gi|77458299|ref|YP_347804.1|  ---.----------------------....--------------------..----------------
gi|77459590|ref|YP_349097.1|  ---.------------GAALLRRQNNy...HSAAAEAFMKLV--------..----------------
gi|77459139|ref|YP_348645.1|  ---.----------------------....--------------------..----------------
gi|77461503|ref|YP_351010.1|  ---.------------SQFLAVRRNAg...MDLLV---------------..----------------
gi|77457545|ref|YP_347050.1|  ---.----------------------....--------------------..----------------
gi|77456896|ref|YP_346401.1|  ---.----------------------....-------------D------..----------------
gi|77457125|ref|YP_346630.1|  ---.----------------------....--------------------..----------------
gi|77459733|ref|YP_349240.1|  ---.----------------------....--------------------..----------------
gi|77456439|ref|YP_345944.1|  ---.-----------VQSVLVGTGKFvdg.HPEAVAKLLKAQQQAVEWLTqdSNKDAYV---------
gi|77457466|ref|YP_346971.1|  ---.----------------------....--------------------..----------------
gi|77458675|ref|YP_348181.1|  ---.----------------------....--------------------..----------------
gi|77457981|ref|YP_347486.1|  ---.----------------------....--------------------..----------------
gi|77459375|ref|YP_348882.1|  ---.----------------------....--------------------..----------------
gi|77458585|ref|YP_348090.1|  ---.----------------------....--------------------..----------------
gi|77461591|ref|YP_351098.1|  ---.----------------------....--------------------..----------------
gi|77458830|ref|YP_348336.1|  ---.----------------------....--------------------..----------------
gi|77458659|ref|YP_348165.1|  ---.-------------YNWTVRGTL....DP------------------..----------------
gi|77456943|ref|YP_346448.1|  ---.----------------------....--------------------..----------------
gi|77459507|ref|YP_349014.1|  ---.----------------------....--------------------..----------------
gi|77457171|ref|YP_346676.1|  ---.----------------------....--------------------..----------------
gi|77456255|ref|YP_345760.1|  ---.----------------------....--------------------..----------------
gi|77459383|ref|YP_348890.1|  ---.------------FHGALVDQAYark.YPEIVVAYLRASIEANQLLA..AEPEKYSELIAKVTGV
gi|77459504|ref|YP_349011.1|  ---.----------------------....--------------------..----------------
gi|77457677|ref|YP_347182.1|  ---.----------------------....--------------------..----------------
gi|77458588|ref|YP_348093.1|  ---.----------------------....---Q----------------..----------------
gi|77457164|ref|YP_346669.1|  ---.----------------------....--------------------..----------------
gi|77456645|ref|YP_346150.1|  ---.-----------TAVWLVQRKDQ....KSPMAKAFVELLT-------..----------------
gi|77461779|ref|YP_351286.1|  ---.----------------------....--------------------..----------------
gi|77457277|ref|YP_346782.1|  ---.----------------------....--------------------..----------------
gi|77461152|ref|YP_350659.1|  ---.------------VDVVALNCTViek.QPEDVKALVAGLYKAVQFTK..DHPQKA----------
gi|77456556|ref|YP_346061.1|  ---.-----------AELYLALNKDV....PDATVARLQAELDQ------..----------------
gi|77460196|ref|YP_349703.1|  ---.----------------------....--------------------..----------------
gi|77459903|ref|YP_349410.1|  ---.-----------LTETLVCLREQs...SRRVVATFLEMVRE------..----------------
gi|77457685|ref|YP_347190.1|  ---.----------------------....--------------------..----------------
gi|77461155|ref|YP_350662.1|  ---.----------------------....--------------------..----------------
gi|77457148|ref|YP_346653.1|  ---.----------------------....--------------------..----------------
gi|77457225|ref|YP_346730.1|  ---.----------------------....--------------------..----------------
gi|77456777|ref|YP_346282.1|  ---.----------------------....--------------------..----------------
gi|77459007|ref|YP_348513.1|  ---.----------------------....--------------------..----------------
gi|77458947|ref|YP_348453.1|  ---.----------------------....--------------------..----------------
gi|77459604|ref|YP_349111.1|  ---.----------------------....--------------------..----------------
gi|77457540|ref|YP_347045.1|  ---.----------------------....--------------------..----------------
gi|77458467|ref|YP_347972.1|  ---.----------------------....--------------------..----------------
gi|77460123|ref|YP_349630.1|  ---.----------------------....--------------------..----------------
gi|77457570|ref|YP_347075.1|  ---.------------MDMMVVNSATlkd.NPALGKALTGAWFEVVDLMN..AKNAASKAAL------
gi|77456344|ref|YP_345849.1|  ---.----------------------....--------------------..----------------
gi|77457610|ref|YP_347115.1|  ---.----------------------....--------------------..----------------
gi|77458181|ref|YP_347686.1|  ---.-----RTRPLPYEVWLVTHADLr...HTARVRAVIEHIVEA-----..----------------
gi|77459944|ref|YP_349451.1|  ---.----------------------....---------------D----..----------------
gi|77461472|ref|YP_350979.1|  ---.-----------SLHILVSLKNPq...HEQIVAGFDKAIA-------..----------------
gi|77460767|ref|YP_350274.1|  ---.----------------------....--------------------..----------------
gi|77458891|ref|YP_348397.1|  ---.----------------------....--------------------..----------------
gi|77460119|ref|YP_349626.1|  ---.----------------------....--------------------..----------------
gi|77459497|ref|YP_349004.1|  ---.----------------------....--------------------..----------------
gi|77456366|ref|YP_345871.1|  ---.-----------SPTVLFATEKFrne.NPKTYKAFVEALTEAAQFAQ..NDKGAAADTYI-----
gi|77459144|ref|YP_348650.1|  ---.----------------------....--------------------..----------------
gi|77456369|ref|YP_345874.1|  ---.----------------------....--------------------..----------------
gi|77457630|ref|YP_347135.1|  ---.----------------------....--------------------..----------------
gi|77457486|ref|YP_346991.1|  ---.----------------------....--------------------..----------------
gi|77460216|ref|YP_349723.1|  ---.----------------------....--------------------..----------------
gi|77461386|ref|YP_350893.1|  ---.----------------------....--------------------..----------------
gi|77458645|ref|YP_348151.1|  ---.----------------------....--------------------..----------------
gi|77459746|ref|YP_349253.1|  ---.----------------------....--------------------..----------------
gi|77458091|ref|YP_347596.1|  ---.----------------------....--------------------..----------------
gi|77461610|ref|YP_351117.1|  ---.----------------------....--------------------..----------------
gi|77456717|ref|YP_346222.1|  ---.----------------------....--------------------..----------------
gi|77456922|ref|YP_346427.1|  ---.----------------------....--------------------..----------------
gi|77458189|ref|YP_347694.1|  ---.----------------------....--------------------..----------------
gi|77461512|ref|YP_351019.1|  ---.----------------------....--------------------..----------------
gi|77458795|ref|YP_348301.1|  ---.----------------------....--------------------..----------------
gi|77459527|ref|YP_349034.1|  ---.----------------------....--------------------..----------------
gi|77460812|ref|YP_350319.1|  ---.----------------------....--------------------..----------------
gi|77458380|ref|YP_347885.1|  ---.----------------------....--------------------..----------------
gi|77457256|ref|YP_346761.1|  ---.----------------------....--------------------..----------------
gi|77458417|ref|YP_347922.1|  ---.----------------------....--------------------..----------------
gi|77461348|ref|YP_350855.1|  ---.----------------------....--------------------..----------------
gi|77459904|ref|YP_349411.1|  ---.----------------------....--------------------..----------------
gi|77460196|ref|YP_349703.1|  ---.----------------------....--------------------..----------------
gi|77459579|ref|YP_349086.1|  ---.----------------------....--------------------..----------------
gi|77456509|ref|YP_346014.1|  ---.----------------------....--------------------..----------------
gi|77460531|ref|YP_350038.1|  ---.----------------------....--------------------..----------------
gi|77458432|ref|YP_347937.1|  ---.----------ATFNVLYTTEKFhde.NPKTYKAFYDALAEAEKIIK..ADKPAAA---------
gi|77458685|ref|YP_348191.1|  ---.----------------------....--------------------..----------------
gi|77456796|ref|YP_346301.1|  ---.----------------------....--------I-----------..----------------
gi|77456443|ref|YP_345948.1|  ---.----------------------....--------------------..----------------
gi|77456440|ref|YP_345945.1|  LHW.RNLPQNLESMNARCGIVSRTGF....--------------------..----------------
gi|77461514|ref|YP_351021.1|  ---.----------------------....--------------------..----------------
gi|77457657|ref|YP_347162.1|  ---.----------------------....--------------------..----------------
gi|77460336|ref|YP_349843.1|  ---.-----------PGLFLAVSHNSacn.D-------------------..----------------
gi|77458953|ref|YP_348459.1|  ---.----------------------....--------------------..----------------
gi|77460693|ref|YP_350200.1|  ---.----------------------....--------------------..----------------
gi|77457612|ref|YP_347117.1|  ---.----------------------....--------------------..----------------
gi|77458012|ref|YP_347517.1|  ---.-----------PEKVLGCTRAFveq.YPNTARALVMAILEASRFIE..ESP-------------
gi|77461737|ref|YP_351244.1|  ---.----------------------....--------------------..----------------
gi|77459929|ref|YP_349436.1|  ---.----------------------....--------------------..----------------
gi|77458950|ref|YP_348456.1|  ---.----------------------....----------A---------..----------------
gi|77458596|ref|YP_348101.1|  ---.----------GPNWALLTHRDSe...NDPMARSFTEWLLAN-----..----------------
gi|77460559|ref|YP_350066.1|  ---.----------------------....--------------------..----------------
gi|77460164|ref|YP_349671.1|  ---.-----------YHHYAILSPKApi..TGEAFGRLLQGLRDNGQML-..----------------
gi|77460025|ref|YP_349532.1|  ---.----------------------....--------------------..----------------
gi|77458799|ref|YP_348305.1|  ---.----------------------....--------------------..----------------
gi|77459649|ref|YP_349156.1|  ---.----------------------....--------------------..----------------
gi|77456330|ref|YP_345835.1|  ---.----------------------....--------------------..----------------
gi|77456912|ref|YP_346417.1|  ---.----------------------....--------------------..----------------
gi|77458376|ref|YP_347881.1|  ---.----------------------....--------------------..----------------
gi|77460214|ref|YP_349721.1|  ---.----------------------....--------------------..----------------
gi|77460544|ref|YP_350051.1|  ---.----------------------....--------------------..----------------
gi|77461845|ref|YP_351352.1|  ---.----------------------....--------------------..----------------
gi|77458031|ref|YP_347536.1|  ---.----------------------....--------------------..----------------
gi|77460241|ref|YP_349748.1|  ---.----------------------....--------------------..----------------
gi|77459350|ref|YP_348857.1|  ---.-----KAPEFGYPTYLVYSRDR....DSAILQQAFDLLR-------..----------------
gi|77461233|ref|YP_350740.1|  ---.----------------------....--------------------..----------------
gi|77458508|ref|YP_348013.1|  ---.----------------------....--------------------..----------------
gi|77460704|ref|YP_350211.1|  ---.----------------------....--------------------..----------------
gi|77459076|ref|YP_348582.1|  GQF.RAVCPELIHFDTPFNLILRHNTv...RSPLVKAFAQA---------..----------------
gi|77459000|ref|YP_348506.1|  ---.----------------------....--------------------..----------------
gi|77458730|ref|YP_348236.1|  ---.----------------------....--------------------..----------------
gi|77460545|ref|YP_350052.1|  ---.----------------------....--------------------..----------------
gi|77457580|ref|YP_347085.1|  ---.----------------------....--------------------..----------------
gi|77456527|ref|YP_346032.1|  ---.----------------------....--------------------..----------------
gi|77457259|ref|YP_346764.1|  ---.----------------------....--------------------..----------------
gi|77460567|ref|YP_350074.1|  ---.-----------PTLPFITAAST....TDEQIEHLRRAMNSSLQDL-..----------------


                                 280       290                                                      
                                   |         |                                                      
d1us5a_                         KGLPIPLHPGAERFYKEAGVL-k.............................................
gi|77457042|ref|YP_346547.1|  ----------------------gdngdpdnwlgtlyscdaiggnnysmwcdpaydklikqakvvtdrd
gi|77457043|ref|YP_346548.1|  ----------------------thppldqlkvrqaldmaidkpaiikavyqsagqlaqnalppaqwsf
gi|77457040|ref|YP_346545.1|  ----------------------agdngdpdnfltpmlsceaakngenyarwcnekfqalldearakvd
gi|77461759|ref|YP_351266.1|  ----------------------ngpyppntwsyaknlpgyahdvdkakallakaglkdgfqttiwtrp
gi|77458408|ref|YP_347913.1|  ----------------------knwanaynvpavtegrlikeqiansnptgmqgfvfnlrrpvfqdvr
gi|77458409|ref|YP_347914.1|  ----------------------gdvikaqiphqiptqsqglfmntrrpafadikvreamglmfdfewt
gi|77459295|ref|YP_348802.1|  ----------------------spggellnyfgsasandpgannymvlknpavdtlinglirastqpe
gi|77459963|ref|YP_349470.1|  ----------------------fprsgdpivspgrelyslyasqsatqvgssnsmvladpavdrlidg
gi|77459342|ref|YP_348849.1|  ----------------------lfnyfgsdgaddpgsnnymvlrdpavdallegvvqadnresllrha
gi|77461625|ref|YP_351132.1|  ----------------------raeeakkgvniaysipkeggalwfdmlaipkdsanvkeahafinyl
gi|77458344|ref|YP_347849.1|  ----------------------pdiiaeitnsngysnanaaatplvdeairndpgsypsqevmatlya
gi|77459054|ref|YP_348560.1|  ----------------------iaysipkeganlwfdllaipadagntkeahafinylldpqviakvs
gi|77461852|ref|YP_351359.1|  ----------------------pqviapvsdfvgypnpnkdatelvdpairnnpnlyptdaamntlyt
gi|77461626|ref|YP_351133.1|  ----------------------pkvmaeitnavrfpngnkaatalvdkeitsdpsiypsaevkkqlya
gi|77459482|ref|YP_348989.1|  ----------------------vvdwrlpkegapiwfdtfaipksaknveeaheflntlldpkviasi
gi|77458902|ref|YP_348408.1|  ----------------------pdvmagisnyvhyangneqadslidpaikndtkvypspemmgklfa
gi|77458800|ref|YP_348306.1|  ----------------------pesvaaltntlffatanqaatplvdeavrndpdifpkpevrerlya
gi|77459754|ref|YP_349261.1|  ----------------------pdviapvsdhlsypngnraatalvaqttrdnpavypsatamatlyt
gi|77456422|ref|YP_345927.1|  ----------------------pagqeiaaknfyrprdkdvaakyaqqfpklelvtidkdfggwktaq
gi|77458599|ref|YP_348104.1|  ----------------------agsllpldpskitamndiepglqklrshyehsnkatvpytwgtigl
gi|77461708|ref|YP_351215.1|  ----------------------glirlgfedritsaisvddslpaggqgavgiecrsadteihallap
gi|77457818|ref|YP_347323.1|  ----------------------pnpktsgngrytylsawgyvlknggdenkakdfvgklfkqapvldt
gi|77456295|ref|YP_345800.1|  ----------------------pevkkfitekykgavlpaf...........................
gi|77458382|ref|YP_347887.1|  ----------------------peviapitdtihyanaitaadglvdpairndpgtyppeavkaslys
gi|77456253|ref|YP_345758.1|  ----------------------npgvldkwldgvktvd..............................
gi|77461459|ref|YP_350966.1|  ----------------------csnvgqllknleftvdmeselmgnilddkmkpdaaakawlkknpqv
gi|77456451|ref|YP_345956.1|  ----------------------pevkafiekkyngavlpaf...........................
gi|77459541|ref|YP_349048.1|  ----------------------iddlnkalaemsekhtaprdaavafmkahpdvwqawlpkdvaqk..
gi|77460565|ref|YP_350072.1|  ----------------------kvdlpidllnqtlagmsekrqqprqvaeaflrdqpqvwkpwvpgdv
gi|77461651|ref|YP_351158.1|  ----------------------qkpelpvklfwpnqadrgvhvnlsgigltkhaphpeaakalvewmt
gi|77458865|ref|YP_348371.1|  ----------------------gfnenlalfnsgkcaiwvdasvagsfvtdktqskvadhvgftyaph
gi|77457833|ref|YP_347338.1|  ----------------------etvnsigskelatkapevakflknfqwaskdeigevmlaiqdgakp
gi|77459367|ref|YP_348874.1|  ----------------------penaaavsnaiayangiqsdqlldakwkvmdainmpeeyasrlrpe
gi|77456472|ref|YP_345977.1|  ----------------------lradgtleklskkyfnad............................
gi|77461451|ref|YP_350958.1|  ----------------------dkqrwlegvttfd.................................
gi|77456590|ref|YP_346095.1|  ----------------------avkleekpgvdktvtikvglsktfheqapelvavlekvnlpidlln
gi|77459062|ref|YP_348568.1|  ----------------------nskntalhyfkhqdpgafvsisgggvlasskhqedaqkflqyitgk
gi|77456597|ref|YP_346102.1|  ----------------------atvstvtapdyaercpnvhrllenltftaaqesqlmvpimerktpq
gi|77456759|ref|YP_346264.1|  ----------------------seegqrvitqttaeyplhkgmesdrglkpfseleapdvtpadlgna
gi|77461836|ref|YP_351343.1|  ----------------------ltmeqvdaifsstrlcgakadvktwgdlgvtgdlankpvqlfgrns
gi|77459394|ref|YP_348901.1|  ----------------------avvarvngvqpttanvslalgsatlptapsnpaqwvpvvpnpasgy
gi|77458291|ref|YP_347796.1|  ----------------------irangkykqvqdkyfdfdv...........................
gi|77460513|ref|YP_350020.1|  ----------------------kaiqdkyfdfdi..................................
gi|77456539|ref|YP_346044.1|  ----------------------pireklnaalkeivadgtykkindkyfpfsi...............
gi|77457194|ref|YP_346699.1|  ----------------------pelkdpkyvgegagiavrkgntelvsqlntaidgirasgeyqkise
gi|77461588|ref|YP_351095.1|  ----------------------pkeglgweieatavikgtpheeaakkladfsasapamdlykenfav
gi|77459463|ref|YP_348970.1|  ----------------------aamkflasassakgqadfsnltayapvnvdsvarldstlapnlpta
gi|77456603|ref|YP_346108.1|  ----------------------drihdkwfks....................................
gi|77460756|ref|YP_350263.1|  ----------------------i.............................................
gi|77458562|ref|YP_348067.1|  ----------------------aadqatpkdiaenpkqlkileiespqlpralddvdlavingnyale
gi|77456465|ref|YP_345970.1|  ----------------------itlkpgvgykateddivanpkkikilqveavqlvrayddadlvqgy
gi|77457097|ref|YP_346602.1|  ----------------------cklmtagkvgavepkgrlrvatkfvnvakryyaeqgrqvdiiklyg
gi|77457032|ref|YP_346537.1|  ----------------------kplaelfddetmrqlnarvdvdhespskvaadflrqhpl.......
gi|77459005|ref|YP_348511.1|  ----------------------gfyipgylqdkygvksiydlkkpevaklfepvgggkaellvgpagw
gi|77461345|ref|YP_350852.1|  ----------------------ggiydfdawaipkgldakraeaakkfiafsvqpqqqktyseniayg
gi|77457437|ref|YP_346942.1|  ----------------------skpvdnhllpaktavgikkgntelkalldkgikalhddgkyaeiqk
gi|77459166|ref|YP_348672.1|  ----------------------iykdgkvssgsawivpasmhdpikqdavilnkgkdnaaakalvdyl
gi|77460297|ref|YP_349804.1|  ----------------------tegavnhtldsflehdmvicgevelrihhhllvgentktdsisriy
gi|77459872|ref|YP_349379.1|  ----------------------lkspgaeqviaidglaiilhpdnslnqlnteqlarifsgeaktwed
gi|77456456|ref|YP_345961.1|  ----------------------iapavkkgnielrdwvnaelaklgeekyllklydqyvr........
gi|77461510|ref|YP_351017.1|  ----------------------ingiyrkwfeqpi.................................
gi|77459027|ref|YP_348533.1|  ----------------------kgdpqwnakvteviaqlktdgtlskisrkwigsdi...........
gi|77459852|ref|YP_349359.1|  ----------------------agmtfsesgpvpsqgniaqqifwytaftadmtkpglpvvnadgtpk
gi|77457275|ref|YP_346780.1|  ----------------------gkrvqpintalipnwksldprlkdapwyvvnnqtfgtpyqwgpnvl
gi|77461635|ref|YP_351142.1|  ----------------------s.............................................
gi|77459314|ref|YP_348821.1|  ----------------------wlnfvntalheamtgvefptyaasfkqwfgvd..............
gi|77461680|ref|YP_351187.1|  ----------------------npkrvpalkvklkdspvyvgvnknepallgkvneilttakadgale
gi|77459080|ref|YP_348586.1|  ----------------------isvqftglgvskkkpelseavkvalqsmvddgsynailkkw.....
gi|77460591|ref|YP_350098.1|  ----------------------agnppgvaqikgpdiqewastglldtdvlkdvsksekwdslldkkv
gi|77460690|ref|YP_350197.1|  ----------------------klaggdehniepgfkklaelkdrvvtlgenpnqiaelfrtgsldmg
gi|77457351|ref|YP_346856.1|  ----------------------vldaalqgvglcqlpdyyvlehlhsgalvsllethqppntavwaly
gi|77457411|ref|YP_346916.1|  ----------------------kravesglgigcisrlalrdafrrgslvpvetpdldlarqfyfiwh
gi|77460131|ref|YP_349638.1|  ----------------------aaa...........................................
gi|77457661|ref|YP_347166.1|  ----------------------tqrvnvtgplhanngdllaqaaeagmgiallpdfiveealaagrlv
gi|77458197|ref|YP_347702.1|  ----------------------daavagmgitylptfivgaalkdgrlvpvldefrpepltlsavypq
gi|77460696|ref|YP_350203.1|  ----------------------ndldpnliarrltvcrsvvcaapaylqehpqpqrvedlsrhnclth
gi|77461371|ref|YP_350878.1|  ----------------------pyryqlamgvprdnkmlvgildkvladmspeeissiqehwvg....
gi|77459516|ref|YP_349023.1|  ----------------------esg...........................................
gi|77460858|ref|YP_350365.1|  ----------------------vmlpdalveqdlrdgrlvvvmpdyqppnrpmhllyapdryrlpklr
gi|77458661|ref|YP_348167.1|  ----------------------gfdlairlgalpdsgligrkledaglcvvaapdylrragtpqsvdd
gi|77459874|ref|YP_349381.1|  ----------------------dpqvrhvklmedryvcamrkghplatkekftlddylslthihissr
gi|77461861|ref|YP_351368.1|  ----------------------eelplfrswclvqakakrlspvahaflafirse.............
gi|77458589|ref|YP_348094.1|  ----------------------gtpqtpqelsehfamlyvnrephgmwtlpvnnalesfrvrcrmrtn
gi|77460541|ref|YP_350048.1|  ----------------------gfvyeqdgqvhrvpmpgsvtvnstdayesaclggfgliqvprtgmn
gi|77458304|ref|YP_347809.1|  ----------------------hqlatvgrmvasglgvsavpalcagqmrelgahcltlhepvverai
gi|77461122|ref|YP_350629.1|  ----------------------ragtpqtledleqheciqyelpsngrritwlfydeetpreilaegn
gi|77460036|ref|YP_349543.1|  ----------------------qqklkpglcavnpsqfmqygekayllprddiswklyvdqwlhlskv
gi|77457913|ref|YP_347418.1|  ----------------------dagqtnlargnarpiraehlqlpedvkakllpneqykkvtpikdad
gi|77458663|ref|YP_348169.1|  ----------------------vrrlgevswttcatpdylqrhgtpshpldlashqliayrsastgri
gi|77456484|ref|YP_345989.1|  ----------------------..............................................
gi|77459913|ref|YP_349420.1|  ----------------------rplgefhmvlvaspaylrergepltpadlaehaclrhtfhatgkle
gi|77457200|ref|YP_346705.1|  ----------------------gyallntee.....................................
gi|77461639|ref|YP_351146.1|  ----------------------..............................................
gi|77459501|ref|YP_349008.1|  ----------------------svvvgapgfferhpapqkpedlhalpcirhrfpsgsmyrwefergg
gi|77459989|ref|YP_349496.1|  ----------------------ykgatgqqrwffrqdqgewapyavkgpitgnhadtltqaavqglgl
gi|77459734|ref|YP_349241.1|  ----------------------feplvqesyvvacrrdhplagrssvtwdefyrqdyisldktsgnrf
gi|77459646|ref|YP_349153.1|  ----------------------mpqdhplarrevlapadlaqepfvalelkqsrfanflyqcciqagf
gi|77461911|ref|YP_351418.1|  ----------------------vtanqaaitaaslglgltrvlsyqvaskvasgeleivlaefelpal
gi|77458595|ref|YP_348100.1|  ----------------------lwartgkpvpyalhnehedlqikgrhvlavddgnaylsaglaglgv
gi|77456947|ref|YP_346452.1|  ----------------------khgaprevadlsehtllgftqneglnqwplryvhgdrwpitpaisa
gi|77460224|ref|YP_349731.1|  ----------------------adadviktyvrlglgvgivakmavdtkldndlvvldaselfessvt
gi|77458091|ref|YP_347596.1|  ----------------------stlgdqpariamatapdapqlqsilnkallgiapqeidglvarwsr
gi|77460407|ref|YP_349914.1|  ----------------------gtkavtvgvrgryaanhtgvrlgavlqhigigslpyftaryaleqg
gi|77458938|ref|YP_348444.1|  ----------------------hgqpatpeelgnhnclrfvmgeqtyerwsfhsadgvrtvqvtgdrv
gi|77458668|ref|YP_348174.1|  ----------------------pltakgprltfdlammavqaaidgqgvcigrstyvdddlragrlva
gi|77459515|ref|YP_349022.1|  ----------------------nld...........................................
gi|77459029|ref|YP_348535.1|  ----------------------atfvptgpsfsvndmdamavairqgagigllagftaiddfrsgqlv
gi|77458115|ref|YP_347620.1|  ----------------------mvsiglawsvlprtmldeqvariplpgiqlsrqlgyilhtertlsn
gi|77458299|ref|YP_347804.1|  ----------------------aktrvfidfvveafg...............................
gi|77459590|ref|YP_349097.1|  ----------------------let...........................................
gi|77459139|ref|YP_348645.1|  ----------------------rpyntwrfhredetvevevrgdylsddgevarrwalaghgiaykaw
gi|77461503|ref|YP_351010.1|  ----------------------qrfgaelkrfkrepayaelsary.......................
gi|77457545|ref|YP_347050.1|  ----------------------elpgelrstplfeeryvclldrqslpaggvldlptylsrphvllem
gi|77456896|ref|YP_346401.1|  ----------------------hwsfhdgrrevgltvsgdrfsddadvvrlwavagagiaykswldva
gi|77457125|ref|YP_346630.1|  ----------------------sllpkdpqfdfqpfcdepldallpvdhplaakgeigleeladtpfl
gi|77459733|ref|YP_349240.1|  ----------------------edqlkpkakmipkipvgsvvangdyqlgfqqvsellpvpgvsfvak
gi|77456439|ref|YP_345944.1|  ----------------------qlv...........................................
gi|77457466|ref|YP_346971.1|  ----------------------hpyqgglpkrtqvladyligwfk.......................
gi|77458675|ref|YP_348181.1|  ----------------------ssvvsddivskrvggfqrwivaspdylsghavpahprdllehqclr
gi|77457981|ref|YP_347486.1|  ----------------------apisepddlklhdgilirspqtgrvrswqlthrtrqhspltlkarm
gi|77459375|ref|YP_348882.1|  ----------------------agrgllhtplwsaapyiadgrlvrvmadyeidpdsfgphilavyps
gi|77458585|ref|YP_348090.1|  ----------------------nafgiwtlskdgqeetvrvngplssnsgeivlewalsgggillrsm
gi|77461591|ref|YP_351098.1|  ----------------------tlenapqipeylyclkerknarlpaaflglaqem............
gi|77458830|ref|YP_348336.1|  ----------------------aleadrmvhvrlldqhgkscdlalearlgiddfivrkacvlagqgf
gi|77458659|ref|YP_348165.1|  ----------------------ala...........................................
gi|77456943|ref|YP_346448.1|  ----------------------dttdlqtrafrddplmlilpldhplsdatevsfsdalrhdfvglda
gi|77459507|ref|YP_349014.1|  ----------------------rcatsvvfrnvvfreidlgegvqselhliwrenndnpafamllegi
gi|77457171|ref|YP_346676.1|  ----------------------dnsatlrafaltgqgvailpqwliqedldagrlqrllpdyrfaqqg
gi|77456255|ref|YP_345760.1|  ----------------------gllcrpiaettlsrlgyyvvlpqrkrrgaliqtfvdwlmaeqas..
gi|77459383|ref|YP_348890.1|  DAE-------------------vnylfhgplgvqtrdlswkpeyrqavgtaidtlkllkkadrgldln
gi|77459504|ref|YP_349011.1|  ----------------------raadkdiagqlllnvssnaqawsewfshhalphrsmrigpsfemts
gi|77457677|ref|YP_347182.1|  ----------------------aslpgresvavhplaepfasattwlmwrrgmvganlnaw.......
gi|77458588|ref|YP_348093.1|  ----------------------vyswtlfhqdgseftlqhrpqlitkglpmlrcaaidsvgvaqmpms
gi|77457164|ref|YP_346669.1|  ----------------------dgpdgqemvtinsspflvnsadamksaitsgmgvgvlpvyaaiegl
gi|77456645|ref|YP_346150.1|  ----------------------rkv...........................................
gi|77461779|ref|YP_351286.1|  ----------------------ydepfyvlmpaqhpwtqkesidaallndksllllgeghcfrdqvle
gi|77457277|ref|YP_346782.1|  ----------------------halqtevlthsphrlwlpaqhpllehdsinladvarepliqlnvde
gi|77461152|ref|YP_350659.1|  ----------------------y.............................................
gi|77456556|ref|YP_346061.1|  ----------------------mrkdgvvdeimgryl...............................
gi|77460196|ref|YP_349703.1|  ----------------------ttigtrqaafslatardntelssiidkslmsitpeelgiingrwrg
gi|77459903|ref|YP_349410.1|  ----------------------slv...........................................
gi|77457685|ref|YP_347190.1|  ----------------------lpatfgyqapfsmimrrgrsrepliqtfrdllkaqlnq........
gi|77461155|ref|YP_350662.1|  ----------------------khdldatieteplmpaqrpyallpadhrfaqlkqvslrdlclepmi
gi|77457148|ref|YP_346653.1|  ----------------------rrghtfnrnhltieaaiagmgvaiarrtllndelergtlivpfgis
gi|77457225|ref|YP_346730.1|  ----------------------ftnirvafdlgdarsqswavaagednsllneinsyldkvqkngtlq
gi|77456777|ref|YP_346282.1|  ----------------------cgvallprflveeeladgklvipwqhampstdayylaypehaaevp
gi|77459007|ref|YP_348513.1|  ----------------------vpigprrqrfvaaaapcylaergtptqpeelpghdllghrfesgkv
gi|77458947|ref|YP_348453.1|  ----------------------pespytlsfdrsymtleaashglgfalestllaqdylargelvevi
gi|77459604|ref|YP_349111.1|  ----------------------vvddstdptlhsrilfrdqwigvvreghplssgkvsakrfaagqhi
gi|77457540|ref|YP_347045.1|  ----------------------svryrrdklvvvmlpehplavresvafsetldsdyvglhaassinm
gi|77458467|ref|YP_347972.1|  ----------------------vpgedwiellsslpfirydrssfggrqvdrflrqmhftlrevseld
gi|77460123|ref|YP_349630.1|  ----------------------crlpqprleqrvlfreryayfcgqrhrlfgqqnltleqlaaenfvs
gi|77457570|ref|YP_347075.1|  ----------------------ehmakasgtd....................................
gi|77456344|ref|YP_345849.1|  ----------------------gdadwsgteshrlmgenpmpvcspallgnkthltpdeiadlpllqq
gi|77457610|ref|YP_347115.1|  ----------------------glpanakrkllrhiqpsilradksdtpltldeycarphvlvshtan
gi|77458181|ref|YP_347686.1|  ----------------------f.............................................
gi|77459944|ref|YP_349451.1|  ----------------------ewpewfhaaglathaappqsivfdsslammeaalqgggvalapplm
gi|77461472|ref|YP_350979.1|  ----------------------smkadgsydkllrqhg..............................
gi|77460767|ref|YP_350274.1|  ----------------------tyeamlavanqhvlaskpyivpedlltetlitypverdrldiftrf
gi|77458891|ref|YP_348397.1|  ----------------------nakrkvlrrsapkllradtvpgplslddycarphalvsfagdlsgf
gi|77460119|ref|YP_349626.1|  ----------------------egdlqrenfvsftsdqiggmlspltifrdqqgfsgrivasspslee
gi|77459497|ref|YP_349004.1|  ----------------------afrsncsyrhhfekwfstdaavpgkifemesyhgmlacvsagagla
gi|77456366|ref|YP_345871.1|  ----------------------rvtkakidraallk................................
gi|77459144|ref|YP_348650.1|  ----------------------lpeerfdtfaliedqmvallplghplaahesvtlkdlcndpfvlte
gi|77456369|ref|YP_345874.1|  ----------------------pevkvqnlfsthfvglvredhplldgeitaeryagfshismsrrgi
gi|77457630|ref|YP_347135.1|  ----------------------ppnlqvvvswrvgvewveeivtlcqqvle.................
gi|77457486|ref|YP_346991.1|  ----------------------kggwpkvqarrfmgetlmpvcspafkargvsngpllmakshqpfew
gi|77460216|ref|YP_349723.1|  ----------------------gvpsepaqlsehdgldwdglappfawrfeqdgqmqlhrparvrmsa
gi|77461386|ref|YP_350893.1|  ----------------------efkkvsmsqaaelpmlllgeefqirqiwqaqlaslgrrpqvqaeln
gi|77458645|ref|YP_348151.1|  ----------------------isipvspfhintadgmtiairkgmgigiqpiasavdglragtlvrv
gi|77459746|ref|YP_349253.1|  ----------------------dpdllgfqvlddpmllalpehhplnqlplltpadladqewigvqpr
gi|77458091|ref|YP_347596.1|  ----------------------agpsgldanpfgfalarsnirlkrlvdkallaipmeq.........
gi|77461610|ref|YP_351117.1|  ----------------------eqprpmvlvqtlteekpkigppvelaipfqkgnpafhaslenalqr
gi|77456717|ref|YP_346222.1|  ----------------------vtcqqlaqhrqllmstqtsiypgnepaspqvwradsfyvmaewlvr
gi|77456922|ref|YP_346427.1|  ----------------------afssellylanvlpgasahlrstsviaqfvaaqqgrslailpcfla
gi|77458189|ref|YP_347694.1|  ----------------------nakrkklrdipckvlrgdnrpgpltldeycerphamvsfsgdlsgn
gi|77461512|ref|YP_351019.1|  ----------------------kaqalasgvlvalaprgywpeedagqplplmalagapliglssadp
gi|77458795|ref|YP_348301.1|  ----------------------rllsrqvlgeggyaclvdpaslasgqqqidleefvtrehllvssgg
gi|77459527|ref|YP_349034.1|  ----------------------mmrlfslgrtdfvvsdtwskaalareqgmepgrlqyqiplmkqnty
gi|77460812|ref|YP_350319.1|  ----------------------afisiphpqrgglsylcadlcmrhgffpqaarvmsrkttqlqliqa
gi|77458380|ref|YP_347885.1|  ----------------------lyfahaglaleaaaqgqgvamgdnltaqedlqngrlvrpftssmta
gi|77457256|ref|YP_346761.1|  ----------------------eneigaqlfpsgllkvgglvegkweadhlavrkgmpellsilnkal
gi|77458417|ref|YP_347922.1|  ----------------------vcplspavpislyaltfkhatpsaaiqtllgivteqaeam......
gi|77461348|ref|YP_350855.1|  ----------------------gglrlwqfsdpymrvpqlvvsdqkssatvelekldsqtrvavrmpg
gi|77459904|ref|YP_349411.1|  ----------------------eavaaelgvgvvssvevshdprvvaipiageglvnrhmigcverrr
gi|77460196|ref|YP_349703.1|  ----------------------ylnnirmanfgkheahgfsfavhrnnpqllaiidtvlkavpgsere
gi|77459579|ref|YP_349086.1|  ----------------------nreaeisihlerpaadmlvtrkltdyrlalyasrayldnapplrsr
gi|77456509|ref|YP_346014.1|  ----------------------rldgerfeslafsetqmgllydqrffsfgqaplsweslielplgml
gi|77460531|ref|YP_350038.1|  ----------------------ylqkveaadlaaltwiapddflpdhptvawrrqqlpgvtpnyrcns
gi|77458432|ref|YP_347937.1|  ----------------------..............................................
gi|77458685|ref|YP_348191.1|  ----------------------anarrkslrsirpmllrsdtrpgllaldefcerphaivssmgkard
gi|77456796|ref|YP_346301.1|  ----------------------svhwhnsklyahgweawcaqsgenwlnqhpavreydeehyalqaai
gi|77456443|ref|YP_345948.1|  ----------------------aigivgaysdalhqargelvclkvegladdleelytrygivsragy
gi|77456440|ref|YP_345945.1|  ----------------------rlspaaramietlva...............................
gi|77461514|ref|YP_351021.1|  ----------------------lqqhigvvflkakerdpnllallae.....................
gi|77457657|ref|YP_347162.1|  ----------------------halhrlnrelsfqdletqmqvvirdsgrqqprdvgwlgaeqrwtvg
gi|77460336|ref|YP_349843.1|  ----------------------pwlrgqlakkmtelpasglteaalqrn...................
gi|77458953|ref|YP_348459.1|  ----------------------lwqaesylallemvraglgwatlprqlvqrelakgelvelqlsayp
gi|77460693|ref|YP_350200.1|  ----------------------tdddwtlwlkaaelhlsniasgqhfetldqamsmashgtgvaigdw
gi|77457612|ref|YP_347117.1|  ----------------------leddlvcvfdkratpleprlslqafterrhvfptpwtsttnmvdgw
gi|77458012|ref|YP_347517.1|  ----------------------en............................................
gi|77461737|ref|YP_351244.1|  ----------------------vaqgrlslpwptavasglnyylvwpktrpggerlrrlsdflqnevr
gi|77459929|ref|YP_349436.1|  ----------------------vvrsrlqrwfaeqqiqprivgefddsalmqafgqsgsgifigpsvi
gi|77458950|ref|YP_348456.1|  ----------------------hypdvqwlqqryplartvftsssrtvqaqmcakglgvavlprvlgd
gi|77458596|ref|YP_348101.1|  ----------------------lsd...........................................
gi|77460559|ref|YP_350066.1|  ----------------------erfqfvgsermiatlaadspllqgqdlfledlvhvrqivvgsrdlp
gi|77460164|ref|YP_349671.1|  ----------------------kifdpy........................................
gi|77460025|ref|YP_349532.1|  ----------------------krepdsgpawatwperlvwvkgtefdssigvlplalfpqgclyrqr
gi|77458799|ref|YP_348305.1|  ----------------------setqhlycapghplfadeepddaalqacdrvdhpyrflrsdepfqg
gi|77459649|ref|YP_349156.1|  ----------------------ynlyavwphgqae.................................
gi|77456330|ref|YP_345835.1|  ----------------------fehlyylleaavaglgvaiapeplvtedlkagrlvapwgfsetsaq
gi|77456912|ref|YP_346417.1|  ----------------------lysersllycavghplfyvddkqldderlnsqdaiaptfrlpaeiq
gi|77458376|ref|YP_347881.1|  ----------------------pnyfeffeigetrvgllydtrhfhfegpemswedaaelplgmittg
gi|77460214|ref|YP_349721.1|  ----------------------aenlpllpeasimlirnlnnpspiteclaehivegf..........
gi|77460544|ref|YP_350051.1|  ----------------------platqesidqtvleqhrelrlativnpydsrgkgrvwsapsylmll
gi|77461845|ref|YP_351352.1|  ----------------------gsvpllaysagaflgrsvngllrqrqlrfttiyetamadslksmal
gi|77458031|ref|YP_347536.1|  ----------------------vpvqrilrtllrmkmsgeiddiirlytgk.................
gi|77460241|ref|YP_349748.1|  ----------------------hklapiriewvdptlavedvlemvqggifhltiveqpiaerwgkil
gi|77459350|ref|YP_348857.1|  ----------------------evik..........................................
gi|77461233|ref|YP_350740.1|  ----------------------pkwnfdsdhiyalglasnpsptqatlgkyrlawvrgyryetylpnv
gi|77458508|ref|YP_348013.1|  ----------------------egygiattrlpevvkletgrtlgistrqvlpivlecddvallktva
gi|77460704|ref|YP_350211.1|  ----------------------gvdggfehhlcpssegfirlteaglgwglvpelqvreqlergvlre
gi|77459076|ref|YP_348582.1|  ----------------------l.............................................
gi|77459000|ref|YP_348506.1|  ----------------------fllchrhpdvppllapdqftgkkvgedvliplasasatlgtspetl
gi|77458730|ref|YP_348236.1|  ----------------------rlaqleyqphiakrysrvtarpespddladfmlvqwqhdrqidsfr
gi|77460545|ref|YP_350052.1|  ----------------------qslvsghehivvralhlpaptrrvglcyaaqalelptmrglha...
gi|77457580|ref|YP_347085.1|  ----------------------aek...........................................
gi|77456527|ref|YP_346032.1|  ----------------------ligpqrpglpsivlpevqvqvvgahcgqendpltllgnkfqvrpae
gi|77457259|ref|YP_346764.1|  ----------------------evdlsaflangerkvgvvaersygeyidtllhqapsgaltphygnd
gi|77460567|ref|YP_350074.1|  ----------------------pdvarilgl.....................................


                                                                                                    
                                                                                                    
d1us5a_                         ....................................................................
gi|77457042|ref|YP_346547.1|  qrtvlykqaqqllkqqvpitpvahstvnqplsakvegfkvspfgrnvfsgvsi...............
gi|77457043|ref|YP_346548.1|  dpnikdaphdpvkakallkearvapgttinlwamtvqrasnpnarmsaqmiqqdwekigikanivsye
gi|77457040|ref|YP_346545.1|  paeraklyeeaqvifnqdqpwismahtrmftamrnnvegyhisplttnnfatt...............
gi|77461759|ref|YP_351266.1|  sgsllnpnpslgaqllqsdlaeigiqaeirviewgelirrakagehdllfmgwagdngdpdnfltpqf
gi|77458408|ref|YP_347913.1|  vrqalgllfdfewtnkqlfngayartrsyfensemaatglpdaeqvaildpfrsqlpaqvfseafenp
gi|77458409|ref|YP_347914.1|  nralfsdaykrttsyypnsefsavglpvghewlmlkpykdqlparlftepftlpqtdgrgipreamrk
gi|77459295|ref|YP_348802.1|  mlryahaldrvlqwnyywipnyyppgtstvwwnrfgiptvqasndeaieswwe...............
gi|77459963|ref|YP_349470.1|  lvqantrdamvryaraldrvlqwgdymipnyyskgtptvfqnrfgrppvqpiysegldtwwe......
gi|77459342|ref|YP_348849.1|  haldrvlqwgyywipnyyppgistvwwnrfgrpaiaplydagldtwwe....................
gi|77461625|ref|YP_351132.1|  lkpeviaqvsdyvgyanpnpgsdklmeqsirtdesvyppqavldktyvsielppniqrlmtrswtkvk
gi|77458344|ref|YP_347849.1|  vpdqpiatqrimtrgwtrvklg..............................................
gi|77459054|ref|YP_348560.1|  asvgyanpnpaakqymdpelvnnpevypsqevldklyisstppqsimrlmtrswskvks.........
gi|77461852|ref|YP_351359.1|  lqplprdaerartrawtkiksg..............................................
gi|77461626|ref|YP_351133.1|  isdldaatlrlitrswtkiksg..............................................
gi|77459482|ref|YP_348989.1|  sdflgypnankdslplinkeitgnpnltptsealkklyvvqplpqklervrtrvwtsik.........
gi|77458902|ref|YP_348408.1|  leamplnidrirtrvwnkirtg..............................................
gi|77458800|ref|YP_348306.1|  drsmslkdmrqrtrlwttf.................................................
gi|77459754|ref|YP_349261.1|  leplpkatervrtrvwskvkng..............................................
gi|77456422|ref|YP_345927.1|  pkffndggvfdqiyq.....................................................
gi|77458599|ref|YP_348104.1|  tynaeqiqqrmadapvnsldmlfkpelaakfadcgismidspdevlavvlnylgrdprsakpadlaaa
gi|77461708|ref|YP_351215.1|  l...................................................................
gi|77457818|ref|YP_347323.1|  ggraatttfmtnqigdvlvtfeneaemiarefgrdqfeviypsvsaeaeppvsvvdkvvekkgsraaa
gi|77456295|ref|YP_345800.1|  ....................................................................
gi|77458382|ref|YP_347887.1|  kndngkafnralirafsrlksg..............................................
gi|77456253|ref|YP_345758.1|  ....................................................................
gi|77461459|ref|YP_350966.1|  ldtwlagvttid........................................................
gi|77456451|ref|YP_345956.1|  ....................................................................
gi|77459541|ref|YP_349048.1|  ....................................................................
gi|77460565|ref|YP_350072.1|  ank.................................................................
gi|77461651|ref|YP_351158.1|  tpeaqkifadvnqefpanpavkpseevaawgqfvadtlpvevagkrqaeairmmdr............
gi|77458865|ref|YP_348371.1|  qvtdkgsawlyswalaiptsskakdaakqfsawatskeygelvaktdgianvppgtrastysdaymsa
gi|77457833|ref|YP_347338.1|  daaakdwvakhpervadwtk................................................
gi|77459367|ref|YP_348874.1|  kecsnkarelqdriwsklk.................................................
gi|77456472|ref|YP_345977.1|  ....................................................................
gi|77461451|ref|YP_350958.1|  ....................................................................
gi|77456590|ref|YP_346095.1|  qnlgrmakeriespklakiflkehpevwhawvsedaakk.............................
gi|77459062|ref|YP_348568.1|  qgqevlrtgnsfeyavgkdsasnpklvplkdldapkvdaskldskkave...................
gi|77456597|ref|YP_346102.1|  evaktwlrehpedlqrwlagvssfd...........................................
gi|77456759|ref|YP_346264.1|  ....................................................................
gi|77461836|ref|YP_351343.1|  vsgtygyfkeealckgdykpnvneqpgsasvvqsissslngigysgigyktasvktvalskkgstdfi
gi|77459394|ref|YP_348901.1|  pivaytnfifgqcykdatvaadvksfltthysnpgnnaatiahsftpvptnwkaavtanfitntsgnn
gi|77458291|ref|YP_347796.1|  ....................................................................
gi|77460513|ref|YP_350020.1|  ....................................................................
gi|77456539|ref|YP_346044.1|  ....................................................................
gi|77457194|ref|YP_346699.1|  kyfksdi.............................................................
gi|77461588|ref|YP_351095.1|  laqpgiakpqtelpadyeqrlikndfawasknrdeilsewrk..........................
gi|77459463|ref|YP_348970.1|  yakdqitldfaywakngpaiatrwnewl........................................
gi|77456603|ref|YP_346108.1|  ....................................................................
gi|77460756|ref|YP_350263.1|  ....................................................................
gi|77458562|ref|YP_348067.1|  aglvpardalglekaehnpyanilvttpklendpriqqlakdltspqvakyiaenfkgsvipvada..
gi|77456465|ref|YP_345970.1|  payirlaktfdagsallfdgldhkeyviqfviqpksktdprlikfvdiyqhspavraaldkahgklyq
gi|77457097|ref|YP_346602.1|  smelapligladkiidvvdtgntlranglepqeliatissrlvvnkasmkmqhariqalidtlrkav.
gi|77457032|ref|YP_346537.1|  ....................................................................
gi|77459005|ref|YP_348511.1|  estyigqikakdygfadkfesvsteasvtyaklasaykaqrgvvfyaytpdwifsaydlrrleepafd
gi|77461345|ref|YP_350852.1|  pansqavplldkailkdmpttpenianqvqidvsfwadngeqleqrfnsw..................
gi|77457437|ref|YP_346942.1|  khfgd...............................................................
gi|77459166|ref|YP_348672.1|  kgpkaaaviksygy......................................................
gi|77460297|ref|YP_349804.1|  shaqslaqcrkwldahypnvervavssnaeaakrvkgewnsaaiagdmaaglygltrlaekiedrpdn
gi|77459872|ref|YP_349379.1|  vggkggtihlyarddqsgtydtfkelvlsrrgkslsnaakrfesseqlsdavsadpqaigfiglpyvr
gi|77456456|ref|YP_345961.1|  ....................................................................
gi|77461510|ref|YP_351017.1|  ....................................................................
gi|77459027|ref|YP_348533.1|  ....................................................................
gi|77459852|ref|YP_349359.1|  wrmapsprgpyweegmklgyqdvgswtfmkstpekqklaawlyaqfvtsktvslkktivgltpiresd
gi|77457275|ref|YP_346780.1|  myntnvfktaptswnvvfdaqnlpdgkpnkgrvqaydgpiyiadaalylkstkpelgikdpyqltedq
gi|77461635|ref|YP_351142.1|  ....................................................................
gi|77459314|ref|YP_348821.1|  ....................................................................
gi|77461680|ref|YP_351187.1|  knaqtwlkep..........................................................
gi|77459080|ref|YP_348586.1|  ....................................................................
gi|77460591|ref|YP_350098.1|  sdtvkfegdyvavpvnihrvnwlwinpevfkkagiekapttleefyaagdklkaagfiplahggqpwq
gi|77460690|ref|YP_350197.1|  glyapaffpkqirdpnyglgatfgmkegfytdlmlsvmpknrpgdtdlayafidhsldplvqgkmaed
gi|77457351|ref|YP_346856.1|  pqqrhlspkvrklvdflkeglaer............................................
gi|77457411|ref|YP_346916.1|  kqkyqtsamrefldlcraftagv.............................................
gi|77460131|ref|YP_349638.1|  ....................................................................
gi|77457661|ref|YP_347166.1|  pvlcewqapaitinavyssarrvpqktrafiaflveqlapt...........................
gi|77458197|ref|YP_347702.1|  hrqasrpvqalieflrerldqn..............................................
gi|77460696|ref|YP_350203.1|  syfgkslwhfeedgepvsvpvqgnisaneastllratlagagvamlptylagahihsgelvrllphae
gi|77461371|ref|YP_350878.1|  ....................................................................
gi|77459516|ref|YP_349023.1|  ....................................................................
gi|77460858|ref|YP_350365.1|  rfvefalqmwgr........................................................
gi|77458661|ref|YP_348167.1|  lqrhaclpfvmpstgrvgpwlfreqgedrewlpsaniqvsddvlgivslaeqglgicqtydfivreri
gi|77459874|ref|YP_349381.1|  rsglghvdlalgkmgiqrkialrsqhylmasqvlqqtdmvmtvperfarrhdlhafnlpvndvppvet
gi|77461861|ref|YP_351368.1|  ....................................................................
gi|77458589|ref|YP_348094.1|  nghqlmeaakagmglailptflaaqaivdgelqevlapyaprggnisavyrrsqraspklqaltdflc
gi|77460541|ref|YP_350048.1|  tyldsgeivtvlpqytapamgisllyarqrhlplrvrvfmdwlgelirs...................
gi|77458304|ref|YP_347809.1|  gvltdpgnelsaaaqalfdilkae............................................
gi|77461122|ref|YP_350629.1|  fccsddvlggvtlarhgaglfqtyrfivekeladgslievlkpysgrsrpftllypqnrhmplrvraf
gi|77460036|ref|YP_349543.1|  tgkyqkvlsewi........................................................
gi|77457913|ref|YP_347418.1|  awektskalpqkwne.....................................................
gi|77458663|ref|YP_348169.1|  lpsnfqrngerhqiegkglisvnesnahlaaglaglgiihtfsytvrtaiergelvpiledwrppayp
gi|77456484|ref|YP_345989.1|  ....................................................................
gi|77459913|ref|YP_349420.1|  swpfnreegapeptlptrlvstsieavrhaalagmgiaclpdfmifeaqqqgrlqrvldehlehvgqf
gi|77457200|ref|YP_346705.1|  ....................................................................
gi|77461639|ref|YP_351146.1|  ....................................................................
gi|77459501|ref|YP_349008.1|  ieqeieingpltlgdvslmigpalqglglayvfenmarehlasgrlvqvladwcpyypglhlyypsrr
gi|77459989|ref|YP_349496.1|  vmfpswligeavregtlvpvlgeyqvsnsvepqqiavlwpgsrrlsvkvrtvidffiecfgevp....
gi|77459734|ref|YP_349241.1|  lldqalakvvpqrpsicetrhvttmiglveaglgvaavplmampaadhpiltrvpltdpqvmrsvgii
gi|77459646|ref|YP_349153.1|  tpqirqqvievqtllslvragfgvallpasieqlapaglvfrrltpalpqvplyatyraddaspvlkl
gi|77461911|ref|YP_351418.1|  pihvvyqggrkaparvrsfvdfmvnalrehp.....................................
gi|77458595|ref|YP_348100.1|  lwlpkymskaheasgnlvplfedwrldpmplyvayppnrhisrklrvfidwiaevmarh.........
gi|77456947|ref|YP_346452.1|  ssgetvrhlalegqgiaclshfmtiddiragrlkvllaefnsgyrqpinavyyrnsqlalriqcfldf
gi|77460224|ref|YP_349731.1|  kigfrrgtflrgfmcdfiekfaphltrevmakaiqchnkqeleelfegvelp................
gi|77458091|ref|YP_347596.1|  n...................................................................
gi|77460407|ref|YP_349914.1|  livqvlpewtflasyhgglwllhsptrylppklrvfidylvecleke.....................
gi|77458938|ref|YP_348444.1|  sddadivrrwavagfgivyrskidvlddlrsgrlvelfpadvgqpaplqlvcphrtsltpavqalrtf
gi|77458668|ref|YP_348174.1|  pfdlrlksasgfylvtphdqaeskkivafrgwlsqvlakp............................
gi|77459515|ref|YP_349022.1|  ....................................................................
gi|77459029|ref|YP_348535.1|  rvlpdyhtyernvyavytsrqfvdakitrfidslkdrvgsq...........................
gi|77458115|ref|YP_347620.1|  aarafmalldaqi.......................................................
gi|77458299|ref|YP_347804.1|  ....................................................................
gi|77459590|ref|YP_349097.1|  ....................................................................
gi|77459139|ref|YP_348645.1|  ldvaedvragrlltlfddwlgesvpfnllcphrvqvservkvlqaflrerceal..............
gi|77461503|ref|YP_351010.1|  ....................................................................
gi|77457545|ref|YP_347050.1|  rgsgtpeiertltalrerrrvaislphwsvaprfisgtdliltvasralnevddqslivlpppfeiap
gi|77456896|ref|YP_346401.1|  gdvlagrlkvllpellceraplnllcahraqlskpvnllremlasrcaels.................
gi|77457125|ref|YP_346630.1|  lyqrsfvlndrllqacqqmgftpkeggrsgqadflaalvaagqgvvllpsvvarglvrpgvvrltlna
gi|77459733|ref|YP_349240.1|  ipesvqsvtrfaagipvgaqhpqeakallaylaapaaqpdvqatg.......................
gi|77456439|ref|YP_345944.1|  ....................................................................
gi|77457466|ref|YP_346971.1|  ....................................................................
gi|77458675|ref|YP_348181.1|  fdyagshqhwtfqgdeetiqlnvhgrlqsnnadilreaavagrgvalladwlvradveagrltrlleg
gi|77457981|ref|YP_347486.1|  tmsdseaacataaqglgialvsmpfavgylevgtlqrvlpdwyvddgnisiyyaehkllpgktrafvd
gi|77459375|ref|YP_348882.1|  hrratakvvafidyiagflaer..............................................
gi|77458585|ref|YP_348090.1|  wdvkpmleqgrlvqvldgytqsanvwavyptrlsesaklrvcvefleeyfrdls..............
gi|77461591|ref|YP_351098.1|  ....................................................................
gi|77458830|ref|YP_348336.1|  tllpmmycetelnngtlvqllpdwslpggwlqavyphrrgvmpavrawidhlvesfna..........
gi|77458659|ref|YP_348165.1|  ....................................................................
gi|77456943|ref|YP_346448.1|  dsalavyleeqalhsgsrmqiriradgfngvmrmvargaglgivplaavqraapqafktlpmnegwar
gi|77459507|ref|YP_349014.1|  rravkd..............................................................
gi|77457171|ref|YP_346676.1|  vyalypdtrhlplkvrafidfmkgr...........................................
gi|77456255|ref|YP_345760.1|  ....................................................................
gi|77459383|ref|YP_348890.1|  tfi.................................................................
gi|77459504|ref|YP_349011.1|  hliqavranigiglvprilvedelhngellqlgepissrrsyylvyparneslaslkafrdwlmrt..
gi|77457677|ref|YP_347182.1|  ....................................................................
gi|77458588|ref|YP_348093.1|  lvhdfiergqlavvlpdwaprtemiyavfasrqgmlpslrmlidfmaeqfe.................
gi|77457164|ref|YP_346669.1|  rngslvrvmpnyrsqelnlyaiypsrqyldakiktwveylrgslpeil....................
gi|77456645|ref|YP_346150.1|  ....................................................................
gi|77461779|ref|YP_351286.1|  acptltkgndgakhttvesssletirhmvasglgisilplsavdshhyapgvievrplsapvpfrtva
gi|77457277|ref|YP_346782.1|  mdrnaqrlwrgaglqpkitlrtasteavrslvaaglgvsiqpdmtyrpwslegdiiearpiadlnqtl
gi|77461152|ref|YP_350659.1|  ....................................................................
gi|77456556|ref|YP_346061.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ys..................................................................
gi|77459903|ref|YP_349410.1|  ....................................................................
gi|77457685|ref|YP_347190.1|  ....................................................................
gi|77461155|ref|YP_350662.1|  lldvqpsrtyfvslfeelglspriefsspsiemvrgmvgqgfgfsilvtrphsectydgkkvvcvdiv
gi|77457148|ref|YP_346653.1|  vpnhkryvllyapgalshpgvravhdwlveeag...................................
gi|77457225|ref|YP_346730.1|  rlkdryygh...........................................................
gi|77456777|ref|YP_346282.1|  kvrdfvkwmleqids.....................................................
gi|77459007|ref|YP_348513.1|  gvfefhrdgrvvrippqgqlltsshdlkiqsainglgivytfedflreplsdgrlvpiledwwqafdg
gi|77458947|ref|YP_348453.1|  pglsapitahhlvfpkahagfprvrrflewmqrelgh...............................
gi|77459604|ref|YP_349111.1|  lvsrrgrssgpvdeallafgltrdivtsfggfsaaltlvresdliatvperhtsklrtglhsfalplr
gi|77457540|ref|YP_347045.1|  rthaaarqagkvlririhvpgfdavcrmvqanmgigilpqrayelfgralglqavpltdgwsdrdllv
gi|77458467|ref|YP_347972.1|  eleaiirlvengvgvalvpqtathqqwpsgvraldlgqhtfhrdiglvhrprrsftepvrtlaelile
gi|77460123|ref|YP_349630.1|  ftsdqlggnlspltlfrdqqgftgkivasstsfeeiyrlicagfgigclpihlvrrdveqgllwrlpp
gi|77457570|ref|YP_347075.1|  ....................................................................
gi|77456344|ref|YP_345849.1|  ttrpyawrqwfnsqhlniprdmtgpryelfsmlaqaamhdmgialippfliqrelaekrlvianpnal
gi|77457610|ref|YP_347115.1|  vsgyadewladigrtrqvvlsvpqysslpallagtdliaslpdytadamaasgllfkepfpfktptld
gi|77458181|ref|YP_347686.1|  ....................................................................
gi|77459944|ref|YP_349451.1|  farqlaadlirqpfaieittgsywltrlqsrpetsamaafrhwllevaq...................
gi|77461472|ref|YP_350979.1|  ....................................................................
gi|77460767|ref|YP_350274.1|  lepadiepaqvrtseltvmmmqlvasgrgvcgmphwalheyssrgyvkgkrlgekglfatlyaairad
gi|77458891|ref|YP_348397.1|  vdeeleklgrkrhvvlavpqfnglgtllagtdivatvpdytadaltaagglraedpplptrtfelhma
gi|77460119|ref|YP_349626.1|  vrrlviagfgigclpehvvaadveagllwrlpphegiadvdihllwnreqrmsraetlfierlqacla
gi|77459497|ref|YP_349004.1|  lmprsmlqsmpgcatvsvwplasdfrylttwlvwrrgtvsrslsmfvrlleer...............
gi|77456366|ref|YP_345871.1|  ....................................................................
gi|77459144|ref|YP_348650.1|  agsselvsrlfntarlnpniryrcsqllstldtvgrgdamtvvaegslpfdsdpryvkrtlsppvkrq
gi|77456369|ref|YP_345874.1|  argpidtalnalglerrvaviapsfhaamfalpdsdlilpvpkeallsvrrlglklrsfdlpiplptl
gi|77457630|ref|YP_347135.1|  ....................................................................
gi|77457486|ref|YP_346991.1|  idwqqhsgidlthvpsvmlhdynivveaavagqgiamgrermidrrikegalvpafdtppmlgeigyw
gi|77460216|ref|YP_349723.1|  nnaealvcgalaglgiahlptwlaseyllrgellplfcenglpkpestgiyalrleqqassrsrllle
gi|77461386|ref|YP_350893.1|  nmvgildslphtrlatvlpgrsqkeyddqdllwkplseprvplkvglvcrdvqrqqaplallrtllee
gi|77458645|ref|YP_348151.1|  lpeyrleelnlfaiypsrkfvdakiktwveflkqsipqll............................
gi|77459746|ref|YP_349253.1|  qgaddefvsaciragftpdvrmqatepftalglvasglgiamiqkglshnappgvvlrevpwlafttp
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77461610|ref|YP_351117.1|  iradgrlealskkwl.....................................................
gi|77456717|ref|YP_346222.1|  dlgwawlprhvvqysayqglmveldsewtppalvvelvwrrdeplgpaarwlaerf............
gi|77456922|ref|YP_346427.1|  aqdprllpvlpeeiditrqfwmycredlrklkritllwdyirevter.....................
gi|77458189|ref|YP_347694.1|  idmdlakvgrsrrvvlgvpqfsglrallagtemiatvpdyaacalvegcalraedppfpidaaqlsma
gi|77461512|ref|YP_351019.1|  laarldsyleaveppprvriavqtyslaramvesgagvavidpftalgassattsirplapplpitly
gi|77458795|ref|YP_348301.1|  figitdeglaalgrtrrvcastthfaalphllkgsdavatipthaaqaiasmsglallpcplalpryp
gi|77459527|ref|YP_349034.1|  iafspqtdpkqvarwqqaldtlradgrleqlrqrwlsnnl............................
gi|77460812|ref|YP_350319.1|  gfgiallpesmqdiapagvrflpltgdcqstvalasrqnptplvqhflqtftge..............
gi|77458380|ref|YP_347885.1|  lgqyslvcervrlerpavaqmlewfndqla......................................
gi|77457256|ref|YP_346761.1|  gafsgaelramrlkwlg...................................................
gi|77458417|ref|YP_347922.1|  ....................................................................
gi|77461348|ref|YP_350855.1|  vtadylrgnyphlnlqgvpmerqalqlllsqqasyavvdeaqlgrlsaepefaglvvvgdiglpqllr
gi|77459904|ref|YP_349411.1|  elrliqaffg..........................................................
gi|77460196|ref|YP_349703.1|  niakrw..............................................................
gi|77459579|ref|YP_349086.1|  edlgrhawigyvddllfsqelmflnsfcrnprvvfhstsviaqqqaarsglgiavlpcymaasdpdlv
gi|77456509|ref|YP_346014.1|  tsgmhfrqsidhnfhsrgltpqpllqtdavhqllqavhgglccavmpldgglenltdnlrlqpienaq
gi|77460531|ref|YP_350038.1|  mlsvtelvraglgvaalpdflinegllalseplhgydtalwlltrpdcralrsvvtlfdelgral...
gi|77458432|ref|YP_347937.1|  ....................................................................
gi|77458685|ref|YP_348191.1|  dtdhaldllgrrrkvvlavpqfsalprllaqsdmlvivpdyvaramasvngiraepaplllpsrelsm
gi|77456796|ref|YP_346301.1|  agqglvlasnilvsqsvasgllvpykgevqvdgagysalcvpgrerhppvkaffawlreeaq......
gi|77456443|ref|YP_345948.1|  rlsplaeamieqika.....................................................
gi|77456440|ref|YP_345945.1|  ....................................................................
gi|77461514|ref|YP_351021.1|  ....................................................................
gi|77457657|ref|YP_347162.1|  slataatfvssglgfawlprhmierelkdgslkllpldrggnrnssfylysnkdkplgpatqiliell
gi|77460336|ref|YP_349843.1|  ....................................................................
gi|77458953|ref|YP_348459.1|  htdwqigvdllwarqrplgkaerwlkeklqg.....................................
gi|77460693|ref|YP_350200.1|  sligddlnagrlvmpfdlkvktglgyyivapasepsaklqelmgwlveqah.................
gi|77457612|ref|YP_347117.1|  larqaqkrqivarsnsysaalkmitgtdfiltlprriqrlltndavfnhceapnglpgftldmqwshn
gi|77458012|ref|YP_347517.1|  ....................................................................
gi|77461737|ref|YP_351244.1|  am..................................................................
gi|77459929|ref|YP_349436.1|  adevkrqygveligqtdavsesfyaisverkvkhpgikaitega........................
gi|77458950|ref|YP_348456.1|  svsglrlldedepppgrdiwmgyhqdmrqmdrlraladlassmig.......................
gi|77458596|ref|YP_348101.1|  ....................................................................
gi|77460559|ref|YP_350066.1|  isetrplvaeshwrtdnletalemvetglgwgnfplsvvqpwldsgrlkrlnfrnienglvlpvhavw
gi|77460164|ref|YP_349671.1|  ....................................................................
gi|77460025|ref|YP_349532.1|  airlldvaqrpwrvafgshsltgiqaavasglgvsvlpasavlpehrvctdlpplpptelalvsregv
gi|77458799|ref|YP_348305.1|  kvcsarseqvegtlafilsgkhigylpnhyarqwqdkgllrpvregelsfdvafhlarhraqvpgdaq
gi|77459649|ref|YP_349156.1|  ....................................................................
gi|77456330|ref|YP_345835.1|  lalwlpkraadgrarqlaqwlrnelrqa........................................
gi|77456912|ref|YP_346417.1|  ahyqalnctasasdregmafliltgryigylpdhyaslwvqqgrlralkastrfydlslasvtrkgrr
gi|77458376|ref|YP_347881.1|  mhyrksidlsfrsrglnpqpilesdstyqllqaihqgfccsimpldsgleepiehlafinlpdasvla
gi|77460214|ref|YP_349721.1|  ....................................................................
gi|77460544|ref|YP_350051.1|  emaekgfgwaplprwlverfgndllvelkvrgwpkpvfvdalwsrlyppgpagswllskml.......
gi|77461845|ref|YP_351352.1|  eglgiawvpqlsvraelargelvvcggsqwhvpleirlyrca..........................
gi|77458031|ref|YP_347536.1|  ....................................................................
gi|77460241|ref|YP_349748.1|  pklrfdrqvmisepgeeywfvrrdasmlrasidrfltgykk...........................
gi|77459350|ref|YP_348857.1|  ....................................................................
gi|77461233|ref|YP_350740.1|  krfnqierrtgilsmlkqgradyyidalteieavvrnaadpsqyryshlaelplylgfadtpqgralm
gi|77458508|ref|YP_348013.1|  gstdtilgvihgavaedirvgrlielhvvdrpgfhseigvvsllgrslsptalcvieavv........
gi|77460704|ref|YP_350211.1|  llpdkpidvplywhhwrnggqllgllteqlvrs...................................
gi|77459076|ref|YP_348582.1|  ....................................................................
gi|77459000|ref|YP_348506.1|  pylaytqesglgrivahrlhgkedylhlkplfsshlaavlmsmaleskgvawlpkslteqemadgrlv
gi|77458730|ref|YP_348236.1|  pwnelvaqrlagvvqmqsyelmlemircsacigllpmymsrfdrglvalpglfdeamrlqawlavnse
gi|77460545|ref|YP_350052.1|  ....................................................................
gi|77457580|ref|YP_347085.1|  ....................................................................
gi|77456527|ref|YP_346032.1|  dcpyshsflrfldaglgnhensqrtiyscsetltlslitqmdavgmvsreaaqkngltifpgfe....
gi|77457259|ref|YP_346764.1|  alisllsmqrlgrlqvvlgywpeiryqarqakiaedellffpirgtgkylsghvgctdttagrqaite
gi|77460567|ref|YP_350074.1|  ....................................................................


                                                                                                    
                                                                                                    
d1us5a_                         ....................................................................
gi|77457042|ref|YP_346547.1|  ....................................................................
gi|77457043|ref|YP_346548.1|  wgeyikrakngehdamiygwtgdngdpdnwlgvlyscaavkgsnyakwcdpaydklvqqakvstdksq
gi|77457040|ref|YP_346545.1|  ....................................................................
gi|77461759|ref|YP_351266.1|  scaavksgtnfarycnadldklisagkttseqgvrtklyeqaqaqiqqqalwlplahptayaltrkdv
gi|77458408|ref|YP_347913.1|  ktdasgmiraqqreayqllqeagwkivddkmvdatgkpvviefllaqtefervllpfkrnlsdlgidl
gi|77458409|ref|YP_347914.1|  alallaeagwklngqrlqdaagqplrfelllvnpnlerilqpyienlnsigidarlrtvdraqykqrl
gi|77459295|ref|YP_348802.1|  ....................................................................
gi|77459963|ref|YP_349470.1|  ....................................................................
gi|77459342|ref|YP_348849.1|  ....................................................................
gi|77461625|ref|YP_351132.1|  sg..................................................................
gi|77458344|ref|YP_347849.1|  ....................................................................
gi|77459054|ref|YP_348560.1|  ....................................................................
gi|77461852|ref|YP_351359.1|  ....................................................................
gi|77461626|ref|YP_351133.1|  ....................................................................
gi|77459482|ref|YP_348989.1|  ....................................................................
gi|77458902|ref|YP_348408.1|  ....................................................................
gi|77458800|ref|YP_348306.1|  ....................................................................
gi|77459754|ref|YP_349261.1|  ....................................................................
gi|77456422|ref|YP_345927.1|  ....................................................................
gi|77458599|ref|YP_348104.1|  sdllmklrpyirkfqsqpvtdlvngnlclslgysgdmtqaqrtsdsagkqtrfqyrvpregttvwmdt
gi|77461708|ref|YP_351215.1|  ....................................................................
gi|77457818|ref|YP_347323.1|  eeylkflwspegqeiaaanylrprdpavlakytdrfpkvdflsvektfgdwrtvqkthfndggifdqi
gi|77456295|ref|YP_345800.1|  ....................................................................
gi|77458382|ref|YP_347887.1|  ....................................................................
gi|77456253|ref|YP_345758.1|  ....................................................................
gi|77461459|ref|YP_350966.1|  ....................................................................
gi|77456451|ref|YP_345956.1|  ....................................................................
gi|77459541|ref|YP_349048.1|  ....................................................................
gi|77460565|ref|YP_350072.1|  ....................................................................
gi|77461651|ref|YP_351158.1|  ....................................................................
gi|77458865|ref|YP_348371.1|  apfakvtleslkaadpskptfkpvpyigiqlvtipefqgigtqvgklfsaal................
gi|77457833|ref|YP_347338.1|  ....................................................................
gi|77459367|ref|YP_348874.1|  ....................................................................
gi|77456472|ref|YP_345977.1|  ....................................................................
gi|77461451|ref|YP_350958.1|  ....................................................................
gi|77456590|ref|YP_346095.1|  ....................................................................
gi|77459062|ref|YP_348568.1|  ....................................................................
gi|77456597|ref|YP_346102.1|  ....................................................................
gi|77456759|ref|YP_346264.1|  ....................................................................
gi|77461836|ref|YP_351343.1|  edteenalngkyplsrflyvyvnkapnkplapleaefvklvlskqgqevvvkdgyiplpakvaakala
gi|77459394|ref|YP_348901.1|  ldinnasvcnavgr......................................................
gi|77458291|ref|YP_347796.1|  ....................................................................
gi|77460513|ref|YP_350020.1|  ....................................................................
gi|77456539|ref|YP_346044.1|  ....................................................................
gi|77457194|ref|YP_346699.1|  ....................................................................
gi|77461588|ref|YP_351095.1|  ....................................................................
gi|77459463|ref|YP_348970.1|  ....................................................................
gi|77456603|ref|YP_346108.1|  ....................................................................
gi|77460756|ref|YP_350263.1|  ....................................................................
gi|77458562|ref|YP_348067.1|  ....................................................................
gi|77456465|ref|YP_345970.1|  agw.................................................................
gi|77457097|ref|YP_346602.1|  ....................................................................
gi|77457032|ref|YP_346537.1|  ....................................................................
gi|77459005|ref|YP_348511.1|  gyaqdnkkedplykadgcwkfisptvdpdwlnkshitcafpdakvyvlastalqkrapkiaeflhnfs
gi|77461345|ref|YP_350852.1|  ....................................................................
gi|77457437|ref|YP_346942.1|  ....................................................................
gi|77459166|ref|YP_348672.1|  ....................................................................
gi|77460297|ref|YP_349804.1|  strflmignqevpptgdd..................................................
gi|77459872|ref|YP_349379.1|  qakavaivdgqsqamlplasliatedyplsrrlffylppdsnnpwaralvefaqsrqgqaivaangfi
gi|77456456|ref|YP_345961.1|  ....................................................................
gi|77461510|ref|YP_351017.1|  ....................................................................
gi|77459027|ref|YP_348533.1|  ....................................................................
gi|77459852|ref|YP_349359.1|  insqamtdlapklgglvefyrsparvqwtptgtnvpdyprlaqlwwshiaeaasgektpqqaldglak
gi|77457275|ref|YP_346780.1|  ykavlellraqqklihrywhdttvqmsdfknegvvassawpyqvnglinekqpiastvpkegatgwad
gi|77461635|ref|YP_351142.1|  ....................................................................
gi|77459314|ref|YP_348821.1|  ....................................................................
gi|77461680|ref|YP_351187.1|  ....................................................................
gi|77459080|ref|YP_348586.1|  ....................................................................
gi|77460591|ref|YP_350098.1|  dstvfeavvlsvmgvdgykkalvdldnaaltgpemvkaltelkkvatymdqdgkgqdwnleaakving
gi|77460690|ref|YP_350197.1|  ifngpvnakaiisaearkspfiltpeqiaekaimhdnaflatvhdqwirryt................
gi|77457351|ref|YP_346856.1|  ....................................................................
gi|77457411|ref|YP_346916.1|  ....................................................................
gi|77460131|ref|YP_349638.1|  ....................................................................
gi|77457661|ref|YP_347166.1|  ....................................................................
gi|77458197|ref|YP_347702.1|  ....................................................................
gi|77460696|ref|YP_350203.1|  prqmsiyavyasrkhmpaalrcmldflvqrfpen..................................
gi|77461371|ref|YP_350878.1|  ....................................................................
gi|77459516|ref|YP_349023.1|  ....................................................................
gi|77460858|ref|YP_350365.1|  ....................................................................
gi|77458661|ref|YP_348167.1|  eggrlvrlleqsggrsrpfsviypphrqlsasaralidcltrevsq......................
gi|77459874|ref|YP_349381.1|  hlywhestdqdpanrwmreqmiel............................................
gi|77461861|ref|YP_351368.1|  ....................................................................
gi|77458589|ref|YP_348094.1|  eqignpp.............................................................
gi|77460541|ref|YP_350048.1|  ....................................................................
gi|77458304|ref|YP_347809.1|  ....................................................................
gi|77461122|ref|YP_350629.1|  idflveqlp...........................................................
gi|77460036|ref|YP_349543.1|  ....................................................................
gi|77457913|ref|YP_347418.1|  ....................................................................
gi|77458663|ref|YP_348169.1|  fhvlyppnrhlsnrvrvfidwlverfaq........................................
gi|77456484|ref|YP_345989.1|  ....................................................................
gi|77459913|ref|YP_349420.1|  wvlwpssrhataklrvfidhlsarl...........................................
gi|77457200|ref|YP_346705.1|  ....................................................................
gi|77461639|ref|YP_351146.1|  ....................................................................
gi|77459501|ref|YP_349008.1|  hvpaplkafidfarnas...................................................
gi|77459989|ref|YP_349496.1|  ....................................................................
gi|77459734|ref|YP_349241.1|  krrgrtltpaalelerlvvem...............................................
gi|77459646|ref|YP_349153.1|  fldtlrelvd..........................................................
gi|77461911|ref|YP_351418.1|  ....................................................................
gi|77458595|ref|YP_348100.1|  ....................................................................
gi|77456947|ref|YP_346452.1|  iqsklaay............................................................
gi|77460224|ref|YP_349731.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77460407|ref|YP_349914.1|  ....................................................................
gi|77458938|ref|YP_348444.1|  laqrferyv...........................................................
gi|77458668|ref|YP_348174.1|  ....................................................................
gi|77459515|ref|YP_349022.1|  ....................................................................
gi|77459029|ref|YP_348535.1|  ....................................................................
gi|77458115|ref|YP_347620.1|  ....................................................................
gi|77458299|ref|YP_347804.1|  ....................................................................
gi|77459590|ref|YP_349097.1|  ....................................................................
gi|77459139|ref|YP_348645.1|  ....................................................................
gi|77461503|ref|YP_351010.1|  ....................................................................
gi|77457545|ref|YP_347050.1|  ftfvsawhkrrggdqalnwlnrri............................................
gi|77456896|ref|YP_346401.1|  ....................................................................
gi|77457125|ref|YP_346630.1|  pdylrwdiafiwrrgaylskaaqawlallrer....................................
gi|77459733|ref|YP_349240.1|  ....................................................................
gi|77456439|ref|YP_345944.1|  ....................................................................
gi|77457466|ref|YP_346971.1|  ....................................................................
gi|77458675|ref|YP_348181.1|  yevnpgnasccinalylpnhrgssrinvfidfledilaae............................
gi|77457981|ref|YP_347486.1|  fvieqfstl...........................................................
gi|77459375|ref|YP_348882.1|  ....................................................................
gi|77458585|ref|YP_348090.1|  ....................................................................
gi|77461591|ref|YP_351098.1|  ....................................................................
gi|77458830|ref|YP_348336.1|  ....................................................................
gi|77458659|ref|YP_348165.1|  ....................................................................
gi|77456943|ref|YP_346448.1|  rklllcardfaalpayaralldal............................................
gi|77459507|ref|YP_349014.1|  ....................................................................
gi|77457171|ref|YP_346676.1|  ....................................................................
gi|77456255|ref|YP_345760.1|  ....................................................................
gi|77459383|ref|YP_348890.1|  ....................................................................
gi|77459504|ref|YP_349011.1|  ....................................................................
gi|77457677|ref|YP_347182.1|  ....................................................................
gi|77458588|ref|YP_348093.1|  ....................................................................
gi|77457164|ref|YP_346669.1|  ....................................................................
gi|77456645|ref|YP_346150.1|  ....................................................................
gi|77461779|ref|YP_351286.1|  iawrasfprpkaieiladsir...............................................
gi|77457277|ref|YP_346782.1|  dvglawrrgtarpalvdpfltvareq..........................................
gi|77461152|ref|YP_350659.1|  ....................................................................
gi|77456556|ref|YP_346061.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459903|ref|YP_349410.1|  ....................................................................
gi|77457685|ref|YP_347190.1|  ....................................................................
gi|77461155|ref|YP_350662.1|  edvtgsglvaawlkrgqltkpaqlfadycreqlt..................................
gi|77457148|ref|YP_346653.1|  ....................................................................
gi|77457225|ref|YP_346730.1|  ....................................................................
gi|77456777|ref|YP_346282.1|  ....................................................................
gi|77459007|ref|YP_348513.1|  pflyyhgrrhmpsplrafvdflraer..........................................
gi|77458947|ref|YP_348453.1|  ....................................................................
gi|77459604|ref|YP_349111.1|  mpdisvsmlwhprmdadpahrwlrncvrev......................................
gi|77457540|ref|YP_347045.1|  vvrdeaglspvsrilfehlraa..............................................
gi|77458467|ref|YP_347972.1|  qfk.................................................................
gi|77460123|ref|YP_349630.1|  edgvvdfdiqllwnreqkmtqaetvfldsfqhml..................................
gi|77457570|ref|YP_347075.1|  ....................................................................
gi|77456344|ref|YP_345849.1|  ssikayylmiperkvesaslkafrdwlvsqahsy..................................
gi|77457610|ref|YP_347115.1|  lsmvwlshvdsdpgerwlrsrleq............................................
gi|77458181|ref|YP_347686.1|  ....................................................................
gi|77459944|ref|YP_349451.1|  ....................................................................
gi|77461472|ref|YP_350979.1|  ....................................................................
gi|77460767|ref|YP_350274.1|  mldapymrdfl.........................................................
gi|77458891|ref|YP_348397.1|  wrgsqdndpgerwlrsriq.................................................
gi|77460119|ref|YP_349626.1|  d...................................................................
gi|77459497|ref|YP_349004.1|  ....................................................................
gi|77456366|ref|YP_345871.1|  ....................................................................
gi|77459144|ref|YP_348650.1|  vglavldqrqaspatlafiqlatr............................................
gi|77456369|ref|YP_345874.1|  mltqawhprfdkdpahrwlretlkt...........................................
gi|77457630|ref|YP_347135.1|  ....................................................................
gi|77457486|ref|YP_346991.1|  lvtpqrpataaaqsfcqwleetan............................................
gi|77460216|ref|YP_349723.1|  ylktrfspvp..........................................................
gi|77461386|ref|YP_350893.1|  vi..................................................................
gi|77458645|ref|YP_348151.1|  ....................................................................
gi|77459746|ref|YP_349253.1|  lwaawhrvnlrplvetfrkvlt..............................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77461610|ref|YP_351117.1|  ....................................................................
gi|77456717|ref|YP_346222.1|  ....................................................................
gi|77456922|ref|YP_346427.1|  ....................................................................
gi|77458189|ref|YP_347694.1|  wsgvhdndpaekwlrsrisq................................................
gi|77461512|ref|YP_351019.1|  avtrateplphtlndllqifsqrar...........................................
gi|77458795|ref|YP_348301.1|  ielgwrtstqidpvvltvreai..............................................
gi|77459527|ref|YP_349034.1|  ....................................................................
gi|77460812|ref|YP_350319.1|  ....................................................................
gi|77458380|ref|YP_347885.1|  ....................................................................
gi|77457256|ref|YP_346761.1|  ....................................................................
gi|77458417|ref|YP_347922.1|  ....................................................................
gi|77461348|ref|YP_350855.1|  igtrrdwpelagivesalraipakdlerlhaqwlqpk...............................
gi|77459904|ref|YP_349411.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459579|ref|YP_349086.1|  allpdesiersywistrrelhksvrlrvvwdyvvglceg.............................
gi|77456509|ref|YP_346014.1|  tlarlglimrrgaprsalaeacfal...........................................
gi|77460531|ref|YP_350038.1|  ....................................................................
gi|77458432|ref|YP_347937.1|  ....................................................................
gi|77458685|ref|YP_348191.1|  vwraaahndcaqrwlrsr..................................................
gi|77456796|ref|YP_346301.1|  ....................................................................
gi|77456443|ref|YP_345948.1|  ....................................................................
gi|77456440|ref|YP_345945.1|  ....................................................................
gi|77461514|ref|YP_351021.1|  ....................................................................
gi|77457657|ref|YP_347162.1|  rt..................................................................
gi|77460336|ref|YP_349843.1|  ....................................................................
gi|77458953|ref|YP_348459.1|  ....................................................................
gi|77460693|ref|YP_350200.1|  ....................................................................
gi|77457612|ref|YP_347117.1|  vdqdsanlwlreqvik....................................................
gi|77458012|ref|YP_347517.1|  ....................................................................
gi|77461737|ref|YP_351244.1|  ....................................................................
gi|77459929|ref|YP_349436.1|  ....................................................................
gi|77458950|ref|YP_348456.1|  ....................................................................
gi|77458596|ref|YP_348101.1|  ....................................................................
gi|77460559|ref|YP_350066.1|  lksqplqkgalalvell...................................................
gi|77460164|ref|YP_349671.1|  ....................................................................
gi|77460025|ref|YP_349532.1|  lsglqrglveflrgelg...................................................
gi|77458799|ref|YP_348305.1|  kafeedllsafq........................................................
gi|77459649|ref|YP_349156.1|  ....................................................................
gi|77456330|ref|YP_345835.1|  ....................................................................
gi|77456912|ref|YP_346417.1|  phlvlesfleslaa......................................................
gi|77458376|ref|YP_347881.1|  plglvmrkteprsaiaekcfaearkmfg........................................
gi|77460214|ref|YP_349721.1|  ....................................................................
gi|77460544|ref|YP_350051.1|  ....................................................................
gi|77461845|ref|YP_351352.1|  ....................................................................
gi|77458031|ref|YP_347536.1|  ....................................................................
gi|77460241|ref|YP_349748.1|  ....................................................................
gi|77459350|ref|YP_348857.1|  ....................................................................
gi|77461233|ref|YP_350740.1|  siydqrmeqlvksgelkpiferwk............................................
gi|77458508|ref|YP_348013.1|  ....................................................................
gi|77460704|ref|YP_350211.1|  ....................................................................
gi|77459076|ref|YP_348582.1|  ....................................................................
gi|77459000|ref|YP_348506.1|  rtldeswdipleihltrpkapislsaeefwarl...................................
gi|77458730|ref|YP_348236.1|  sqeagevrtlveliqrtfner...............................................
gi|77460545|ref|YP_350052.1|  ....................................................................
gi|77457580|ref|YP_347085.1|  ....................................................................
gi|77456527|ref|YP_346032.1|  ....................................................................
gi|77457259|ref|YP_346764.1|  inqllrtlphehlnqlyadwldpe............................................
gi|77460567|ref|YP_350074.1|  ....................................................................


                                                                                                    
                                                                                                    
d1us5a_                         ....................................................................
gi|77457042|ref|YP_346547.1|  ....................................................................
gi|77457043|ref|YP_346548.1|  rvklyqqaqlilkqqvpitpianstvfqplrkevtdfkispfgltpfygv..................
gi|77457040|ref|YP_346545.1|  ....................................................................
gi|77461759|ref|YP_351266.1|  qgysvspfgrqdyskvtl..................................................
gi|77458408|ref|YP_347913.1|  virrvdvsqyvnrvrsrdfdmivgsfpqsnspgneqrefwmsaaadksssrnsmglkdpvvdhlvenl
gi|77458409|ref|YP_347914.1|  dqfdfdmilmtlnqtlspgleqwqyfhssqvgvkgsknyagianpvvdhlleqllaartrdeqvaagk
gi|77459295|ref|YP_348802.1|  ....................................................................
gi|77459963|ref|YP_349470.1|  ....................................................................
gi|77459342|ref|YP_348849.1|  ....................................................................
gi|77461625|ref|YP_351132.1|  ....................................................................
gi|77458344|ref|YP_347849.1|  ....................................................................
gi|77459054|ref|YP_348560.1|  ....................................................................
gi|77461852|ref|YP_351359.1|  ....................................................................
gi|77461626|ref|YP_351133.1|  ....................................................................
gi|77459482|ref|YP_348989.1|  ....................................................................
gi|77458902|ref|YP_348408.1|  ....................................................................
gi|77458800|ref|YP_348306.1|  ....................................................................
gi|77459754|ref|YP_349261.1|  ....................................................................
gi|77456422|ref|YP_345927.1|  ....................................................................
gi|77458599|ref|YP_348104.1|  maipvdakhpeyayefinfvmrpenmaaisnftgyptsnakarpnvdeamrnnpdiyldeatyarlip
gi|77461708|ref|YP_351215.1|  ....................................................................
gi|77457818|ref|YP_347323.1|  y...................................................................
gi|77456295|ref|YP_345800.1|  ....................................................................
gi|77458382|ref|YP_347887.1|  ....................................................................
gi|77456253|ref|YP_345758.1|  ....................................................................
gi|77461459|ref|YP_350966.1|  ....................................................................
gi|77456451|ref|YP_345956.1|  ....................................................................
gi|77459541|ref|YP_349048.1|  ....................................................................
gi|77460565|ref|YP_350072.1|  ....................................................................
gi|77461651|ref|YP_351158.1|  ....................................................................
gi|77458865|ref|YP_348371.1|  ....................................................................
gi|77457833|ref|YP_347338.1|  ....................................................................
gi|77459367|ref|YP_348874.1|  ....................................................................
gi|77456472|ref|YP_345977.1|  ....................................................................
gi|77461451|ref|YP_350958.1|  ....................................................................
gi|77456590|ref|YP_346095.1|  ....................................................................
gi|77459062|ref|YP_348568.1|  ....................................................................
gi|77456597|ref|YP_346102.1|  ....................................................................
gi|77456759|ref|YP_346264.1|  ....................................................................
gi|77461836|ref|YP_351343.1|  dl..................................................................
gi|77459394|ref|YP_348901.1|  ....................................................................
gi|77458291|ref|YP_347796.1|  ....................................................................
gi|77460513|ref|YP_350020.1|  ....................................................................
gi|77456539|ref|YP_346044.1|  ....................................................................
gi|77457194|ref|YP_346699.1|  ....................................................................
gi|77461588|ref|YP_351095.1|  ....................................................................
gi|77459463|ref|YP_348970.1|  ....................................................................
gi|77456603|ref|YP_346108.1|  ....................................................................
gi|77460756|ref|YP_350263.1|  ....................................................................
gi|77458562|ref|YP_348067.1|  ....................................................................
gi|77456465|ref|YP_345970.1|  ....................................................................
gi|77457097|ref|YP_346602.1|  ....................................................................
gi|77457032|ref|YP_346537.1|  ....................................................................
gi|77459005|ref|YP_348511.1|  idpaqlngliqkiekekqpadvaakawvqanpstvdqwfagq..........................
gi|77461345|ref|YP_350852.1|  ....................................................................
gi|77457437|ref|YP_346942.1|  ....................................................................
gi|77459166|ref|YP_348672.1|  ....................................................................
gi|77460297|ref|YP_349804.1|  ....................................................................
gi|77459872|ref|YP_349379.1|  aqtvqaiavtpnalmpegyqslsrhaqrltvnfrfeegsasldnka......................
gi|77456456|ref|YP_345961.1|  ....................................................................
gi|77461510|ref|YP_351017.1|  ....................................................................
gi|77459027|ref|YP_348533.1|  ....................................................................
gi|77459852|ref|YP_349359.1|  dqdaim..............................................................
gi|77457275|ref|YP_346780.1|  ttmlhaeakhpncaykwmdwslqpkvqgdvaawfgslpavpaacqgsellgaegcktngfdqfdkiaf
gi|77461635|ref|YP_351142.1|  ....................................................................
gi|77459314|ref|YP_348821.1|  ....................................................................
gi|77461680|ref|YP_351187.1|  ....................................................................
gi|77459080|ref|YP_348586.1|  ....................................................................
gi|77460591|ref|YP_350098.1|  kagmqimgdwaksewtaakkvagkdyecvafpgtdkaftynidslavfkqkdagtaagqqdiakvvlg
gi|77460690|ref|YP_350197.1|  ....................................................................
gi|77457351|ref|YP_346856.1|  ....................................................................
gi|77457411|ref|YP_346916.1|  ....................................................................
gi|77460131|ref|YP_349638.1|  ....................................................................
gi|77457661|ref|YP_347166.1|  ....................................................................
gi|77458197|ref|YP_347702.1|  ....................................................................
gi|77460696|ref|YP_350203.1|  ....................................................................
gi|77461371|ref|YP_350878.1|  ....................................................................
gi|77459516|ref|YP_349023.1|  ....................................................................
gi|77460858|ref|YP_350365.1|  ....................................................................
gi|77458661|ref|YP_348167.1|  ....................................................................
gi|77459874|ref|YP_349381.1|  ....................................................................
gi|77461861|ref|YP_351368.1|  ....................................................................
gi|77458589|ref|YP_348094.1|  ....................................................................
gi|77460541|ref|YP_350048.1|  ....................................................................
gi|77458304|ref|YP_347809.1|  ....................................................................
gi|77461122|ref|YP_350629.1|  ....................................................................
gi|77460036|ref|YP_349543.1|  ....................................................................
gi|77457913|ref|YP_347418.1|  ....................................................................
gi|77458663|ref|YP_348169.1|  ....................................................................
gi|77456484|ref|YP_345989.1|  ....................................................................
gi|77459913|ref|YP_349420.1|  ....................................................................
gi|77457200|ref|YP_346705.1|  ....................................................................
gi|77461639|ref|YP_351146.1|  ....................................................................
gi|77459501|ref|YP_349008.1|  ....................................................................
gi|77459989|ref|YP_349496.1|  ....................................................................
gi|77459734|ref|YP_349241.1|  ....................................................................
gi|77459646|ref|YP_349153.1|  ....................................................................
gi|77461911|ref|YP_351418.1|  ....................................................................
gi|77458595|ref|YP_348100.1|  ....................................................................
gi|77456947|ref|YP_346452.1|  ....................................................................
gi|77460224|ref|YP_349731.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77460407|ref|YP_349914.1|  ....................................................................
gi|77458938|ref|YP_348444.1|  ....................................................................
gi|77458668|ref|YP_348174.1|  ....................................................................
gi|77459515|ref|YP_349022.1|  ....................................................................
gi|77459029|ref|YP_348535.1|  ....................................................................
gi|77458115|ref|YP_347620.1|  ....................................................................
gi|77458299|ref|YP_347804.1|  ....................................................................
gi|77459590|ref|YP_349097.1|  ....................................................................
gi|77459139|ref|YP_348645.1|  ....................................................................
gi|77461503|ref|YP_351010.1|  ....................................................................
gi|77457545|ref|YP_347050.1|  ....................................................................
gi|77456896|ref|YP_346401.1|  ....................................................................
gi|77457125|ref|YP_346630.1|  ....................................................................
gi|77459733|ref|YP_349240.1|  ....................................................................
gi|77456439|ref|YP_345944.1|  ....................................................................
gi|77457466|ref|YP_346971.1|  ....................................................................
gi|77458675|ref|YP_348181.1|  ....................................................................
gi|77457981|ref|YP_347486.1|  ....................................................................
gi|77459375|ref|YP_348882.1|  ....................................................................
gi|77458585|ref|YP_348090.1|  ....................................................................
gi|77461591|ref|YP_351098.1|  ....................................................................
gi|77458830|ref|YP_348336.1|  ....................................................................
gi|77458659|ref|YP_348165.1|  ....................................................................
gi|77456943|ref|YP_346448.1|  ....................................................................
gi|77459507|ref|YP_349014.1|  ....................................................................
gi|77457171|ref|YP_346676.1|  ....................................................................
gi|77456255|ref|YP_345760.1|  ....................................................................
gi|77459383|ref|YP_348890.1|  ....................................................................
gi|77459504|ref|YP_349011.1|  ....................................................................
gi|77457677|ref|YP_347182.1|  ....................................................................
gi|77458588|ref|YP_348093.1|  ....................................................................
gi|77457164|ref|YP_346669.1|  ....................................................................
gi|77456645|ref|YP_346150.1|  ....................................................................
gi|77461779|ref|YP_351286.1|  ....................................................................
gi|77457277|ref|YP_346782.1|  ....................................................................
gi|77461152|ref|YP_350659.1|  ....................................................................
gi|77456556|ref|YP_346061.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459903|ref|YP_349410.1|  ....................................................................
gi|77457685|ref|YP_347190.1|  ....................................................................
gi|77461155|ref|YP_350662.1|  ....................................................................
gi|77457148|ref|YP_346653.1|  ....................................................................
gi|77457225|ref|YP_346730.1|  ....................................................................
gi|77456777|ref|YP_346282.1|  ....................................................................
gi|77459007|ref|YP_348513.1|  ....................................................................
gi|77458947|ref|YP_348453.1|  ....................................................................
gi|77459604|ref|YP_349111.1|  ....................................................................
gi|77457540|ref|YP_347045.1|  ....................................................................
gi|77458467|ref|YP_347972.1|  ....................................................................
gi|77460123|ref|YP_349630.1|  ....................................................................
gi|77457570|ref|YP_347075.1|  ....................................................................
gi|77456344|ref|YP_345849.1|  ....................................................................
gi|77457610|ref|YP_347115.1|  ....................................................................
gi|77458181|ref|YP_347686.1|  ....................................................................
gi|77459944|ref|YP_349451.1|  ....................................................................
gi|77461472|ref|YP_350979.1|  ....................................................................
gi|77460767|ref|YP_350274.1|  ....................................................................
gi|77458891|ref|YP_348397.1|  ....................................................................
gi|77460119|ref|YP_349626.1|  ....................................................................
gi|77459497|ref|YP_349004.1|  ....................................................................
gi|77456366|ref|YP_345871.1|  ....................................................................
gi|77459144|ref|YP_348650.1|  ....................................................................
gi|77456369|ref|YP_345874.1|  ....................................................................
gi|77457630|ref|YP_347135.1|  ....................................................................
gi|77457486|ref|YP_346991.1|  ....................................................................
gi|77460216|ref|YP_349723.1|  ....................................................................
gi|77461386|ref|YP_350893.1|  ....................................................................
gi|77458645|ref|YP_348151.1|  ....................................................................
gi|77459746|ref|YP_349253.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77461610|ref|YP_351117.1|  ....................................................................
gi|77456717|ref|YP_346222.1|  ....................................................................
gi|77456922|ref|YP_346427.1|  ....................................................................
gi|77458189|ref|YP_347694.1|  ....................................................................
gi|77461512|ref|YP_351019.1|  ....................................................................
gi|77458795|ref|YP_348301.1|  ....................................................................
gi|77459527|ref|YP_349034.1|  ....................................................................
gi|77460812|ref|YP_350319.1|  ....................................................................
gi|77458380|ref|YP_347885.1|  ....................................................................
gi|77457256|ref|YP_346761.1|  ....................................................................
gi|77458417|ref|YP_347922.1|  ....................................................................
gi|77461348|ref|YP_350855.1|  ....................................................................
gi|77459904|ref|YP_349411.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459579|ref|YP_349086.1|  ....................................................................
gi|77456509|ref|YP_346014.1|  ....................................................................
gi|77460531|ref|YP_350038.1|  ....................................................................
gi|77458432|ref|YP_347937.1|  ....................................................................
gi|77458685|ref|YP_348191.1|  ....................................................................
gi|77456796|ref|YP_346301.1|  ....................................................................
gi|77456443|ref|YP_345948.1|  ....................................................................
gi|77456440|ref|YP_345945.1|  ....................................................................
gi|77461514|ref|YP_351021.1|  ....................................................................
gi|77457657|ref|YP_347162.1|  ....................................................................
gi|77460336|ref|YP_349843.1|  ....................................................................
gi|77458953|ref|YP_348459.1|  ....................................................................
gi|77460693|ref|YP_350200.1|  ....................................................................
gi|77457612|ref|YP_347117.1|  ....................................................................
gi|77458012|ref|YP_347517.1|  ....................................................................
gi|77461737|ref|YP_351244.1|  ....................................................................
gi|77459929|ref|YP_349436.1|  ....................................................................
gi|77458950|ref|YP_348456.1|  ....................................................................
gi|77458596|ref|YP_348101.1|  ....................................................................
gi|77460559|ref|YP_350066.1|  ....................................................................
gi|77460164|ref|YP_349671.1|  ....................................................................
gi|77460025|ref|YP_349532.1|  ....................................................................
gi|77458799|ref|YP_348305.1|  ....................................................................
gi|77459649|ref|YP_349156.1|  ....................................................................
gi|77456330|ref|YP_345835.1|  ....................................................................
gi|77456912|ref|YP_346417.1|  ....................................................................
gi|77458376|ref|YP_347881.1|  ....................................................................
gi|77460214|ref|YP_349721.1|  ....................................................................
gi|77460544|ref|YP_350051.1|  ....................................................................
gi|77461845|ref|YP_351352.1|  ....................................................................
gi|77458031|ref|YP_347536.1|  ....................................................................
gi|77460241|ref|YP_349748.1|  ....................................................................
gi|77459350|ref|YP_348857.1|  ....................................................................
gi|77461233|ref|YP_350740.1|  ....................................................................
gi|77458508|ref|YP_348013.1|  ....................................................................
gi|77460704|ref|YP_350211.1|  ....................................................................
gi|77459076|ref|YP_348582.1|  ....................................................................
gi|77459000|ref|YP_348506.1|  ....................................................................
gi|77458730|ref|YP_348236.1|  ....................................................................
gi|77460545|ref|YP_350052.1|  ....................................................................
gi|77457580|ref|YP_347085.1|  ....................................................................
gi|77456527|ref|YP_346032.1|  ....................................................................
gi|77457259|ref|YP_346764.1|  ....................................................................
gi|77460567|ref|YP_350074.1|  ....................................................................


                                                                                                    
                                                                                                    
d1us5a_                         ....................................................................
gi|77457042|ref|YP_346547.1|  ....................................................................
gi|77457043|ref|YP_346548.1|  ....................................................................
gi|77457040|ref|YP_346545.1|  ....................................................................
gi|77461759|ref|YP_351266.1|  ....................................................................
gi|77458408|ref|YP_347913.1|  inadsrkslvaharaldrvlqwgyyvipnwhiktwrvaywnhighpkvspkydigintwwvkp.....
gi|77458409|ref|YP_347914.1|  aldrvllwqhysipnwylnyhrlayrnrfafvttppytlglsawwlk.....................
gi|77459295|ref|YP_348802.1|  ....................................................................
gi|77459963|ref|YP_349470.1|  ....................................................................
gi|77459342|ref|YP_348849.1|  ....................................................................
gi|77461625|ref|YP_351132.1|  ....................................................................
gi|77458344|ref|YP_347849.1|  ....................................................................
gi|77459054|ref|YP_348560.1|  ....................................................................
gi|77461852|ref|YP_351359.1|  ....................................................................
gi|77461626|ref|YP_351133.1|  ....................................................................
gi|77459482|ref|YP_348989.1|  ....................................................................
gi|77458902|ref|YP_348408.1|  ....................................................................
gi|77458800|ref|YP_348306.1|  ....................................................................
gi|77459754|ref|YP_349261.1|  ....................................................................
gi|77456422|ref|YP_345927.1|  ....................................................................
gi|77458599|ref|YP_348104.1|  gkdipqadmrarmrtwtkfk................................................
gi|77461708|ref|YP_351215.1|  ....................................................................
gi|77457818|ref|YP_347323.1|  ....................................................................
gi|77456295|ref|YP_345800.1|  ....................................................................
gi|77458382|ref|YP_347887.1|  ....................................................................
gi|77456253|ref|YP_345758.1|  ....................................................................
gi|77461459|ref|YP_350966.1|  ....................................................................
gi|77456451|ref|YP_345956.1|  ....................................................................
gi|77459541|ref|YP_349048.1|  ....................................................................
gi|77460565|ref|YP_350072.1|  ....................................................................
gi|77461651|ref|YP_351158.1|  ....................................................................
gi|77458865|ref|YP_348371.1|  ....................................................................
gi|77457833|ref|YP_347338.1|  ....................................................................
gi|77459367|ref|YP_348874.1|  ....................................................................
gi|77456472|ref|YP_345977.1|  ....................................................................
gi|77461451|ref|YP_350958.1|  ....................................................................
gi|77456590|ref|YP_346095.1|  ....................................................................
gi|77459062|ref|YP_348568.1|  ....................................................................
gi|77456597|ref|YP_346102.1|  ....................................................................
gi|77456759|ref|YP_346264.1|  ....................................................................
gi|77461836|ref|YP_351343.1|  ....................................................................
gi|77459394|ref|YP_348901.1|  ....................................................................
gi|77458291|ref|YP_347796.1|  ....................................................................
gi|77460513|ref|YP_350020.1|  ....................................................................
gi|77456539|ref|YP_346044.1|  ....................................................................
gi|77457194|ref|YP_346699.1|  ....................................................................
gi|77461588|ref|YP_351095.1|  ....................................................................
gi|77459463|ref|YP_348970.1|  ....................................................................
gi|77456603|ref|YP_346108.1|  ....................................................................
gi|77460756|ref|YP_350263.1|  ....................................................................
gi|77458562|ref|YP_348067.1|  ....................................................................
gi|77456465|ref|YP_345970.1|  ....................................................................
gi|77457097|ref|YP_346602.1|  ....................................................................
gi|77457032|ref|YP_346537.1|  ....................................................................
gi|77459005|ref|YP_348511.1|  ....................................................................
gi|77461345|ref|YP_350852.1|  ....................................................................
gi|77457437|ref|YP_346942.1|  ....................................................................
gi|77459166|ref|YP_348672.1|  ....................................................................
gi|77460297|ref|YP_349804.1|  ....................................................................
gi|77459872|ref|YP_349379.1|  ....................................................................
gi|77456456|ref|YP_345961.1|  ....................................................................
gi|77461510|ref|YP_351017.1|  ....................................................................
gi|77459027|ref|YP_348533.1|  ....................................................................
gi|77459852|ref|YP_349359.1|  ....................................................................
gi|77457275|ref|YP_346780.1|  wktp................................................................
gi|77461635|ref|YP_351142.1|  ....................................................................
gi|77459314|ref|YP_348821.1|  ....................................................................
gi|77461680|ref|YP_351187.1|  ....................................................................
gi|77459080|ref|YP_348586.1|  ....................................................................
gi|77460591|ref|YP_350098.1|  enfqkvfsinkgsipvrndmladmgkygfdscaqtaakdfladakngglqpsmahnmattlavqgaff
gi|77460690|ref|YP_350197.1|  ....................................................................
gi|77457351|ref|YP_346856.1|  ....................................................................
gi|77457411|ref|YP_346916.1|  ....................................................................
gi|77460131|ref|YP_349638.1|  ....................................................................
gi|77457661|ref|YP_347166.1|  ....................................................................
gi|77458197|ref|YP_347702.1|  ....................................................................
gi|77460696|ref|YP_350203.1|  ....................................................................
gi|77461371|ref|YP_350878.1|  ....................................................................
gi|77459516|ref|YP_349023.1|  ....................................................................
gi|77460858|ref|YP_350365.1|  ....................................................................
gi|77458661|ref|YP_348167.1|  ....................................................................
gi|77459874|ref|YP_349381.1|  ....................................................................
gi|77461861|ref|YP_351368.1|  ....................................................................
gi|77458589|ref|YP_348094.1|  ....................................................................
gi|77460541|ref|YP_350048.1|  ....................................................................
gi|77458304|ref|YP_347809.1|  ....................................................................
gi|77461122|ref|YP_350629.1|  ....................................................................
gi|77460036|ref|YP_349543.1|  ....................................................................
gi|77457913|ref|YP_347418.1|  ....................................................................
gi|77458663|ref|YP_348169.1|  ....................................................................
gi|77456484|ref|YP_345989.1|  ....................................................................
gi|77459913|ref|YP_349420.1|  ....................................................................
gi|77457200|ref|YP_346705.1|  ....................................................................
gi|77461639|ref|YP_351146.1|  ....................................................................
gi|77459501|ref|YP_349008.1|  ....................................................................
gi|77459989|ref|YP_349496.1|  ....................................................................
gi|77459734|ref|YP_349241.1|  ....................................................................
gi|77459646|ref|YP_349153.1|  ....................................................................
gi|77461911|ref|YP_351418.1|  ....................................................................
gi|77458595|ref|YP_348100.1|  ....................................................................
gi|77456947|ref|YP_346452.1|  ....................................................................
gi|77460224|ref|YP_349731.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77460407|ref|YP_349914.1|  ....................................................................
gi|77458938|ref|YP_348444.1|  ....................................................................
gi|77458668|ref|YP_348174.1|  ....................................................................
gi|77459515|ref|YP_349022.1|  ....................................................................
gi|77459029|ref|YP_348535.1|  ....................................................................
gi|77458115|ref|YP_347620.1|  ....................................................................
gi|77458299|ref|YP_347804.1|  ....................................................................
gi|77459590|ref|YP_349097.1|  ....................................................................
gi|77459139|ref|YP_348645.1|  ....................................................................
gi|77461503|ref|YP_351010.1|  ....................................................................
gi|77457545|ref|YP_347050.1|  ....................................................................
gi|77456896|ref|YP_346401.1|  ....................................................................
gi|77457125|ref|YP_346630.1|  ....................................................................
gi|77459733|ref|YP_349240.1|  ....................................................................
gi|77456439|ref|YP_345944.1|  ....................................................................
gi|77457466|ref|YP_346971.1|  ....................................................................
gi|77458675|ref|YP_348181.1|  ....................................................................
gi|77457981|ref|YP_347486.1|  ....................................................................
gi|77459375|ref|YP_348882.1|  ....................................................................
gi|77458585|ref|YP_348090.1|  ....................................................................
gi|77461591|ref|YP_351098.1|  ....................................................................
gi|77458830|ref|YP_348336.1|  ....................................................................
gi|77458659|ref|YP_348165.1|  ....................................................................
gi|77456943|ref|YP_346448.1|  ....................................................................
gi|77459507|ref|YP_349014.1|  ....................................................................
gi|77457171|ref|YP_346676.1|  ....................................................................
gi|77456255|ref|YP_345760.1|  ....................................................................
gi|77459383|ref|YP_348890.1|  ....................................................................
gi|77459504|ref|YP_349011.1|  ....................................................................
gi|77457677|ref|YP_347182.1|  ....................................................................
gi|77458588|ref|YP_348093.1|  ....................................................................
gi|77457164|ref|YP_346669.1|  ....................................................................
gi|77456645|ref|YP_346150.1|  ....................................................................
gi|77461779|ref|YP_351286.1|  ....................................................................
gi|77457277|ref|YP_346782.1|  ....................................................................
gi|77461152|ref|YP_350659.1|  ....................................................................
gi|77456556|ref|YP_346061.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459903|ref|YP_349410.1|  ....................................................................
gi|77457685|ref|YP_347190.1|  ....................................................................
gi|77461155|ref|YP_350662.1|  ....................................................................
gi|77457148|ref|YP_346653.1|  ....................................................................
gi|77457225|ref|YP_346730.1|  ....................................................................
gi|77456777|ref|YP_346282.1|  ....................................................................
gi|77459007|ref|YP_348513.1|  ....................................................................
gi|77458947|ref|YP_348453.1|  ....................................................................
gi|77459604|ref|YP_349111.1|  ....................................................................
gi|77457540|ref|YP_347045.1|  ....................................................................
gi|77458467|ref|YP_347972.1|  ....................................................................
gi|77460123|ref|YP_349630.1|  ....................................................................
gi|77457570|ref|YP_347075.1|  ....................................................................
gi|77456344|ref|YP_345849.1|  ....................................................................
gi|77457610|ref|YP_347115.1|  ....................................................................
gi|77458181|ref|YP_347686.1|  ....................................................................
gi|77459944|ref|YP_349451.1|  ....................................................................
gi|77461472|ref|YP_350979.1|  ....................................................................
gi|77460767|ref|YP_350274.1|  ....................................................................
gi|77458891|ref|YP_348397.1|  ....................................................................
gi|77460119|ref|YP_349626.1|  ....................................................................
gi|77459497|ref|YP_349004.1|  ....................................................................
gi|77456366|ref|YP_345871.1|  ....................................................................
gi|77459144|ref|YP_348650.1|  ....................................................................
gi|77456369|ref|YP_345874.1|  ....................................................................
gi|77457630|ref|YP_347135.1|  ....................................................................
gi|77457486|ref|YP_346991.1|  ....................................................................
gi|77460216|ref|YP_349723.1|  ....................................................................
gi|77461386|ref|YP_350893.1|  ....................................................................
gi|77458645|ref|YP_348151.1|  ....................................................................
gi|77459746|ref|YP_349253.1|  ....................................................................
gi|77458091|ref|YP_347596.1|  ....................................................................
gi|77461610|ref|YP_351117.1|  ....................................................................
gi|77456717|ref|YP_346222.1|  ....................................................................
gi|77456922|ref|YP_346427.1|  ....................................................................
gi|77458189|ref|YP_347694.1|  ....................................................................
gi|77461512|ref|YP_351019.1|  ....................................................................
gi|77458795|ref|YP_348301.1|  ....................................................................
gi|77459527|ref|YP_349034.1|  ....................................................................
gi|77460812|ref|YP_350319.1|  ....................................................................
gi|77458380|ref|YP_347885.1|  ....................................................................
gi|77457256|ref|YP_346761.1|  ....................................................................
gi|77458417|ref|YP_347922.1|  ....................................................................
gi|77461348|ref|YP_350855.1|  ....................................................................
gi|77459904|ref|YP_349411.1|  ....................................................................
gi|77460196|ref|YP_349703.1|  ....................................................................
gi|77459579|ref|YP_349086.1|  ....................................................................
gi|77456509|ref|YP_346014.1|  ....................................................................
gi|77460531|ref|YP_350038.1|  ....................................................................
gi|77458432|ref|YP_347937.1|  ....................................................................
gi|77458685|ref|YP_348191.1|  ....................................................................
gi|77456796|ref|YP_346301.1|  ....................................................................
gi|77456443|ref|YP_345948.1|  ....................................................................
gi|77456440|ref|YP_345945.1|  ....................................................................
gi|77461514|ref|YP_351021.1|  ....................................................................
gi|77457657|ref|YP_347162.1|  ....................................................................
gi|77460336|ref|YP_349843.1|  ....................................................................
gi|77458953|ref|YP_348459.1|  ....................................................................
gi|77460693|ref|YP_350200.1|  ....................................................................
gi|77457612|ref|YP_347117.1|  ....................................................................
gi|77458012|ref|YP_347517.1|  ....................................................................
gi|77461737|ref|YP_351244.1|  ....................................................................
gi|77459929|ref|YP_349436.1|  ....................................................................
gi|77458950|ref|YP_348456.1|  ....................................................................
gi|77458596|ref|YP_348101.1|  ....................................................................
gi|77460559|ref|YP_350066.1|  ....................................................................
gi|77460164|ref|YP_349671.1|  ....................................................................
gi|77460025|ref|YP_349532.1|  ....................................................................
gi|77458799|ref|YP_348305.1|  ....................................................................
gi|77459649|ref|YP_349156.1|  ....................................................................
gi|77456330|ref|YP_345835.1|  ....................................................................
gi|77456912|ref|YP_346417.1|  ....................................................................
gi|77458376|ref|YP_347881.1|  ....................................................................
gi|77460214|ref|YP_349721.1|  ....................................................................
gi|77460544|ref|YP_350051.1|  ....................................................................
gi|77461845|ref|YP_351352.1|  ....................................................................
gi|77458031|ref|YP_347536.1|  ....................................................................
gi|77460241|ref|YP_349748.1|  ....................................................................
gi|77459350|ref|YP_348857.1|  ....................................................................
gi|77461233|ref|YP_350740.1|  ....................................................................
gi|77458508|ref|YP_348013.1|  ....................................................................
gi|77460704|ref|YP_350211.1|  ....................................................................
gi|77459076|ref|YP_348582.1|  ....................................................................
gi|77459000|ref|YP_348506.1|  ....................................................................
gi|77458730|ref|YP_348236.1|  ....................................................................
gi|77460545|ref|YP_350052.1|  ....................................................................
gi|77457580|ref|YP_347085.1|  ....................................................................
gi|77456527|ref|YP_346032.1|  ....................................................................
gi|77457259|ref|YP_346764.1|  ....................................................................
gi|77460567|ref|YP_350074.1|  ....................................................................


                                                           
                                                           
d1us5a_                         ...........................
gi|77457042|ref|YP_346547.1|  ...........................
gi|77457043|ref|YP_346548.1|  ...........................
gi|77457040|ref|YP_346545.1|  ...........................
gi|77461759|ref|YP_351266.1|  ...........................
gi|77458408|ref|YP_347913.1|  ...........................
gi|77458409|ref|YP_347914.1|  ...........................
gi|77459295|ref|YP_348802.1|  ...........................
gi|77459963|ref|YP_349470.1|  ...........................
gi|77459342|ref|YP_348849.1|  ...........................
gi|77461625|ref|YP_351132.1|  ...........................
gi|77458344|ref|YP_347849.1|  ...........................
gi|77459054|ref|YP_348560.1|  ...........................
gi|77461852|ref|YP_351359.1|  ...........................
gi|77461626|ref|YP_351133.1|  ...........................
gi|77459482|ref|YP_348989.1|  ...........................
gi|77458902|ref|YP_348408.1|  ...........................
gi|77458800|ref|YP_348306.1|  ...........................
gi|77459754|ref|YP_349261.1|  ...........................
gi|77456422|ref|YP_345927.1|  ...........................
gi|77458599|ref|YP_348104.1|  ...........................
gi|77461708|ref|YP_351215.1|  ...........................
gi|77457818|ref|YP_347323.1|  ...........................
gi|77456295|ref|YP_345800.1|  ...........................
gi|77458382|ref|YP_347887.1|  ...........................
gi|77456253|ref|YP_345758.1|  ...........................
gi|77461459|ref|YP_350966.1|  ...........................
gi|77456451|ref|YP_345956.1|  ...........................
gi|77459541|ref|YP_349048.1|  ...........................
gi|77460565|ref|YP_350072.1|  ...........................
gi|77461651|ref|YP_351158.1|  ...........................
gi|77458865|ref|YP_348371.1|  ...........................
gi|77457833|ref|YP_347338.1|  ...........................
gi|77459367|ref|YP_348874.1|  ...........................
gi|77456472|ref|YP_345977.1|  ...........................
gi|77461451|ref|YP_350958.1|  ...........................
gi|77456590|ref|YP_346095.1|  ...........................
gi|77459062|ref|YP_348568.1|  ...........................
gi|77456597|ref|YP_346102.1|  ...........................
gi|77456759|ref|YP_346264.1|  ...........................
gi|77461836|ref|YP_351343.1|  ...........................
gi|77459394|ref|YP_348901.1|  ...........................
gi|77458291|ref|YP_347796.1|  ...........................
gi|77460513|ref|YP_350020.1|  ...........................
gi|77456539|ref|YP_346044.1|  ...........................
gi|77457194|ref|YP_346699.1|  ...........................
gi|77461588|ref|YP_351095.1|  ...........................
gi|77459463|ref|YP_348970.1|  ...........................
gi|77456603|ref|YP_346108.1|  ...........................
gi|77460756|ref|YP_350263.1|  ...........................
gi|77458562|ref|YP_348067.1|  ...........................
gi|77456465|ref|YP_345970.1|  ...........................
gi|77457097|ref|YP_346602.1|  ...........................
gi|77457032|ref|YP_346537.1|  ...........................
gi|77459005|ref|YP_348511.1|  ...........................
gi|77461345|ref|YP_350852.1|  ...........................
gi|77457437|ref|YP_346942.1|  ...........................
gi|77459166|ref|YP_348672.1|  ...........................
gi|77460297|ref|YP_349804.1|  ...........................
gi|77459872|ref|YP_349379.1|  ...........................
gi|77456456|ref|YP_345961.1|  ...........................
gi|77461510|ref|YP_351017.1|  ...........................
gi|77459027|ref|YP_348533.1|  ...........................
gi|77459852|ref|YP_349359.1|  ...........................
gi|77457275|ref|YP_346780.1|  ...........................
gi|77461635|ref|YP_351142.1|  ...........................
gi|77459314|ref|YP_348821.1|  ...........................
gi|77461680|ref|YP_351187.1|  ...........................
gi|77459080|ref|YP_348586.1|  ...........................
gi|77460591|ref|YP_350098.1|  dvvtnyindpkadpadaakklgtaika
gi|77460690|ref|YP_350197.1|  ...........................
gi|77457351|ref|YP_346856.1|  ...........................
gi|77457411|ref|YP_346916.1|  ...........................
gi|77460131|ref|YP_349638.1|  ...........................
gi|77457661|ref|YP_347166.1|  ...........................
gi|77458197|ref|YP_347702.1|  ...........................
gi|77460696|ref|YP_350203.1|  ...........................
gi|77461371|ref|YP_350878.1|  ...........................
gi|77459516|ref|YP_349023.1|  ...........................
gi|77460858|ref|YP_350365.1|  ...........................
gi|77458661|ref|YP_348167.1|  ...........................
gi|77459874|ref|YP_349381.1|  ...........................
gi|77461861|ref|YP_351368.1|  ...........................
gi|77458589|ref|YP_348094.1|  ...........................
gi|77460541|ref|YP_350048.1|  ...........................
gi|77458304|ref|YP_347809.1|  ...........................
gi|77461122|ref|YP_350629.1|  ...........................
gi|77460036|ref|YP_349543.1|  ...........................
gi|77457913|ref|YP_347418.1|  ...........................
gi|77458663|ref|YP_348169.1|  ...........................
gi|77456484|ref|YP_345989.1|  ...........................
gi|77459913|ref|YP_349420.1|  ...........................
gi|77457200|ref|YP_346705.1|  ...........................
gi|77461639|ref|YP_351146.1|  ...........................
gi|77459501|ref|YP_349008.1|  ...........................
gi|77459989|ref|YP_349496.1|  ...........................
gi|77459734|ref|YP_349241.1|  ...........................
gi|77459646|ref|YP_349153.1|  ...........................
gi|77461911|ref|YP_351418.1|  ...........................
gi|77458595|ref|YP_348100.1|  ...........................
gi|77456947|ref|YP_346452.1|  ...........................
gi|77460224|ref|YP_349731.1|  ...........................
gi|77458091|ref|YP_347596.1|  ...........................
gi|77460407|ref|YP_349914.1|  ...........................
gi|77458938|ref|YP_348444.1|  ...........................
gi|77458668|ref|YP_348174.1|  ...........................
gi|77459515|ref|YP_349022.1|  ...........................
gi|77459029|ref|YP_348535.1|  ...........................
gi|77458115|ref|YP_347620.1|  ...........................
gi|77458299|ref|YP_347804.1|  ...........................
gi|77459590|ref|YP_349097.1|  ...........................
gi|77459139|ref|YP_348645.1|  ...........................
gi|77461503|ref|YP_351010.1|  ...........................
gi|77457545|ref|YP_347050.1|  ...........................
gi|77456896|ref|YP_346401.1|  ...........................
gi|77457125|ref|YP_346630.1|  ...........................
gi|77459733|ref|YP_349240.1|  ...........................
gi|77456439|ref|YP_345944.1|  ...........................
gi|77457466|ref|YP_346971.1|  ...........................
gi|77458675|ref|YP_348181.1|  ...........................
gi|77457981|ref|YP_347486.1|  ...........................
gi|77459375|ref|YP_348882.1|  ...........................
gi|77458585|ref|YP_348090.1|  ...........................
gi|77461591|ref|YP_351098.1|  ...........................
gi|77458830|ref|YP_348336.1|  ...........................
gi|77458659|ref|YP_348165.1|  ...........................
gi|77456943|ref|YP_346448.1|  ...........................
gi|77459507|ref|YP_349014.1|  ...........................
gi|77457171|ref|YP_346676.1|  ...........................
gi|77456255|ref|YP_345760.1|  ...........................
gi|77459383|ref|YP_348890.1|  ...........................
gi|77459504|ref|YP_349011.1|  ...........................
gi|77457677|ref|YP_347182.1|  ...........................
gi|77458588|ref|YP_348093.1|  ...........................
gi|77457164|ref|YP_346669.1|  ...........................
gi|77456645|ref|YP_346150.1|  ...........................
gi|77461779|ref|YP_351286.1|  ...........................
gi|77457277|ref|YP_346782.1|  ...........................
gi|77461152|ref|YP_350659.1|  ...........................
gi|77456556|ref|YP_346061.1|  ...........................
gi|77460196|ref|YP_349703.1|  ...........................
gi|77459903|ref|YP_349410.1|  ...........................
gi|77457685|ref|YP_347190.1|  ...........................
gi|77461155|ref|YP_350662.1|  ...........................
gi|77457148|ref|YP_346653.1|  ...........................
gi|77457225|ref|YP_346730.1|  ...........................
gi|77456777|ref|YP_346282.1|  ...........................
gi|77459007|ref|YP_348513.1|  ...........................
gi|77458947|ref|YP_348453.1|  ...........................
gi|77459604|ref|YP_349111.1|  ...........................
gi|77457540|ref|YP_347045.1|  ...........................
gi|77458467|ref|YP_347972.1|  ...........................
gi|77460123|ref|YP_349630.1|  ...........................
gi|77457570|ref|YP_347075.1|  ...........................
gi|77456344|ref|YP_345849.1|  ...........................
gi|77457610|ref|YP_347115.1|  ...........................
gi|77458181|ref|YP_347686.1|  ...........................
gi|77459944|ref|YP_349451.1|  ...........................
gi|77461472|ref|YP_350979.1|  ...........................
gi|77460767|ref|YP_350274.1|  ...........................
gi|77458891|ref|YP_348397.1|  ...........................
gi|77460119|ref|YP_349626.1|  ...........................
gi|77459497|ref|YP_349004.1|  ...........................
gi|77456366|ref|YP_345871.1|  ...........................
gi|77459144|ref|YP_348650.1|  ...........................
gi|77456369|ref|YP_345874.1|  ...........................
gi|77457630|ref|YP_347135.1|  ...........................
gi|77457486|ref|YP_346991.1|  ...........................
gi|77460216|ref|YP_349723.1|  ...........................
gi|77461386|ref|YP_350893.1|  ...........................
gi|77458645|ref|YP_348151.1|  ...........................
gi|77459746|ref|YP_349253.1|  ...........................
gi|77458091|ref|YP_347596.1|  ...........................
gi|77461610|ref|YP_351117.1|  ...........................
gi|77456717|ref|YP_346222.1|  ...........................
gi|77456922|ref|YP_346427.1|  ...........................
gi|77458189|ref|YP_347694.1|  ...........................
gi|77461512|ref|YP_351019.1|  ...........................
gi|77458795|ref|YP_348301.1|  ...........................
gi|77459527|ref|YP_349034.1|  ...........................
gi|77460812|ref|YP_350319.1|  ...........................
gi|77458380|ref|YP_347885.1|  ...........................
gi|77457256|ref|YP_346761.1|  ...........................
gi|77458417|ref|YP_347922.1|  ...........................
gi|77461348|ref|YP_350855.1|  ...........................
gi|77459904|ref|YP_349411.1|  ...........................
gi|77460196|ref|YP_349703.1|  ...........................
gi|77459579|ref|YP_349086.1|  ...........................
gi|77456509|ref|YP_346014.1|  ...........................
gi|77460531|ref|YP_350038.1|  ...........................
gi|77458432|ref|YP_347937.1|  ...........................
gi|77458685|ref|YP_348191.1|  ...........................
gi|77456796|ref|YP_346301.1|  ...........................
gi|77456443|ref|YP_345948.1|  ...........................
gi|77456440|ref|YP_345945.1|  ...........................
gi|77461514|ref|YP_351021.1|  ...........................
gi|77457657|ref|YP_347162.1|  ...........................
gi|77460336|ref|YP_349843.1|  ...........................
gi|77458953|ref|YP_348459.1|  ...........................
gi|77460693|ref|YP_350200.1|  ...........................
gi|77457612|ref|YP_347117.1|  ...........................
gi|77458012|ref|YP_347517.1|  ...........................
gi|77461737|ref|YP_351244.1|  ...........................
gi|77459929|ref|YP_349436.1|  ...........................
gi|77458950|ref|YP_348456.1|  ...........................
gi|77458596|ref|YP_348101.1|  ...........................
gi|77460559|ref|YP_350066.1|  ...........................
gi|77460164|ref|YP_349671.1|  ...........................
gi|77460025|ref|YP_349532.1|  ...........................
gi|77458799|ref|YP_348305.1|  ...........................
gi|77459649|ref|YP_349156.1|  ...........................
gi|77456330|ref|YP_345835.1|  ...........................
gi|77456912|ref|YP_346417.1|  ...........................
gi|77458376|ref|YP_347881.1|  ...........................
gi|77460214|ref|YP_349721.1|  ...........................
gi|77460544|ref|YP_350051.1|  ...........................
gi|77461845|ref|YP_351352.1|  ...........................
gi|77458031|ref|YP_347536.1|  ...........................
gi|77460241|ref|YP_349748.1|  ...........................
gi|77459350|ref|YP_348857.1|  ...........................
gi|77461233|ref|YP_350740.1|  ...........................
gi|77458508|ref|YP_348013.1|  ...........................
gi|77460704|ref|YP_350211.1|  ...........................
gi|77459076|ref|YP_348582.1|  ...........................
gi|77459000|ref|YP_348506.1|  ...........................
gi|77458730|ref|YP_348236.1|  ...........................
gi|77460545|ref|YP_350052.1|  ...........................
gi|77457580|ref|YP_347085.1|  ...........................
gi|77456527|ref|YP_346032.1|  ...........................
gi|77457259|ref|YP_346764.1|  ...........................
gi|77460567|ref|YP_350074.1|  ...........................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0049987 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes