SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Tubby C-terminal domain-like alignments

These alignments are sequences aligned to the 0035881 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1c8za_ gsvd........................................................................................
d2q4ma1 ggvvvdpkycapypidmaivrkmmsltdgnfvitdvngnllfkvkepvfglhdkrvlldgsgtpvvtlrekmvsmhdrwqvfrggstdqrdl


                 10        20        30        40        50        60        70        80        90 
                  |         |         |         |         |         |         |         |         | 
d1c8za_ .----IEVQDLEEFALRPAPQGITIKCRITRDKKGMDRGMFPTYFLHLDREDGKKVFLLAGRKRKKSKTSNYLISVDPTDLSRGGDSYIGKL
d2q4ma1 l-------------------------------------------------------------------------------------------


              100       110       120       130       140       150       160       170       180   
                |         |         |         |         |         |         |         |         |   
d1c8za_ RSNLMGTKFTVYDNGVNPQKASSSTLESGTLRQELAAVCYETNVLGFKGPRKMSVIVPGMNMVHERVCIRPRNEHETLLARWQNKNTESIIE
d2q4ma1 ---------------------------Y----------------------------------------------------------------


            190       200       210       220       230       240       250       260               
              |         |         |         |         |         |         |         |               
d1c8za_ LQNKTPVWNDDTQSYVLNFHGRVTQASVKNFQIIHGNDPDYIVMQFGRVAEDVFTMDYNYPLCALQAFAIALSSFDSKLACE..........
d2q4ma1 ----------------------------------------------------------------------------------tvkrssmlql


                                                                                             
                                                                                             
d1c8za_ .....................................................................................
d2q4ma1 ktkldvflghnkdekrcdfrvkgswlerscvvyagesdaivaqmhrkhtvqsvflgkdnfsvtvypnvdyafiaslvvilddvnr


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0035881 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Sporisorium reilianum 22
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Microbotryum violaceum 22
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Laccaria bicolor S238N-H82
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Neurospora discreta FGSC 8579
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Candida guilliermondii ATCC 6260
NoYes   Wickerhamomyces anomalus
NoYes   Yarrowia lipolytica CLIB122
NoYes   Saccharomyces paradoxus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba invadens 1.2
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechococcus sp. PCC 7502
NoYes   Microcoleus sp. PCC 7113
NoYes   Anabaena variabilis ATCC 29413
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Nakamurella multipartita DSM 44233
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Propionibacterium propionicum F0230a
NoYes   Microlunatus phosphovorus NM-1
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium glutamicum R
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Arthrobacter arilaitensis Re117
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Micrococcus luteus NCTC 2665
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Ruminococcus sp.
NoYes   butyrate-producing bacterium SS3/4
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium sticklandii DSM 519
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   [Ruminococcus] obeum
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia intestinalis
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Carnobacterium sp. 17-4
NoYes   Carnobacterium sp. WN1359
NoYes   Aerococcus urinae ACS-120-V-Col10a
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Weissella koreensis KACC 15510
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc sp. C2
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc mesenteroides subsp. mesenteroides ATCC 8293
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus casei ATCC 334
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus helveticus DPC 4571
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus intermedius JTH08
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pseudopneumoniae IS7493
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus dysgalactiae subsp. equisimilis GGS_124
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus mitis B6
NoYes   Streptococcus parasanguinis ATCC 15912
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus sanguinis SK36
NoYes   Streptococcus oralis Uo5
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Paenibacillus sp. JDR-2
NoYes   Solibacillus silvestris StLB046
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Saprospira grandis str. Lewin
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Flexibacter litoralis DSM 6794
NoYes   Solitalea canadensis DSM 3403
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium johnsoniae UW101
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Pirellula staleyi DSM 6068
NoYes   Candidatus Saccharibacteria bacterium RAAC3_TM7_1
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Methylotenera versatilis 301
NoYes   Psychromonas sp. CNPT3
NoYes   Marinomonas mediterranea MMB-1
NoYes   halophilic archaeon DL31
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella paludicola SANAE
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanoculleus bourgensis MS2
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Natrinema sp. J7-2
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Haloquadratum walsbyi DSM 16790
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Halalkalicoccus jeotgali B3
NoYes   Halobacterium salinarum R1
NoYes   Halobacterium sp. NRC-1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Aspergillus fumigatus A1163
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum Dd2
NoYes   Frankia sp. EuI1c
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Corynebacterium halotolerans YIM 70093 = DSM 44683
NoYes   Corynebacterium glutamicum MB001
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Corynebacterium glutamicum ATCC 13032
NoYes   Erysipelothrix rhusiopathiae SY1027
NoYes   Eubacterium siraeum V10Sc8a
NoYes   [Clostridium] stercorarium Clostridiu subsp. stercorarium DSM 8532
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Ruminococcus champanellensis 18P13
NoYes   Clostridium acidurici 9a
NoYes   Coprococcus catus GD/7
NoYes   Roseburia intestinalis XB6B4
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Melissococcus plutonius ATCC 35311
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus casseliflavus EC20
NoYes   Enterococcus faecium Aus0085
NoYes   Enterococcus faecium NRRL B-2354
NoYes   Enterococcus faecium DO
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis D32
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Leuconostoc carnosum JB16
NoYes   Leuconostoc mesenteroides subsp. mesenteroides J18
NoYes   Leuconostoc gelidum JB7
NoYes   Lactobacillus paracasei subsp. paracasei 8700:2
NoYes   Lactobacillus casei LOCK919
NoYes   Lactobacillus casei W56
NoYes   Lactobacillus casei LC2W
NoYes   Lactobacillus casei BD-II
NoYes   Lactobacillus casei BL23
NoYes   Lactobacillus casei str. Zhang
NoYes   Lactobacillus rhamnosus LOCK908
NoYes   Lactobacillus rhamnosus LOCK900
NoYes   Lactobacillus rhamnosus ATCC 8530
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus johnsonii N6.2
NoYes   Lactobacillus johnsonii DPC 6026
NoYes   Lactobacillus johnsonii NCC 533
NoYes   Lactobacillus salivarius UCC118
NoYes   Lactobacillus amylovorus GRL 1112
NoYes   Lactobacillus plantarum 16
NoYes   Lactobacillus plantarum ZJ316
NoYes   Lactobacillus plantarum subsp. plantarum ST-III
NoYes   Lactobacillus plantarum subsp. plantarum P-8
NoYes   Lactobacillus plantarum WCFS1
NoYes   Lactobacillus helveticus R0052
NoYes   Lactobacillus helveticus H10
NoYes   Lactobacillus helveticus CNRZ32
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ND02
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
NoYes   Lactobacillus delbrueckii subsp. bulgaricus 2038
NoYes   Lactobacillus brevis KB290
NoYes   Pediococcus pentosaceus SL4
NoYes   Streptococcus constellatus subsp. pharyngis C1050
NoYes   Streptococcus constellatus subsp. pharyngis C818
NoYes   Streptococcus constellatus subsp. pharyngis C232
NoYes   Streptococcus intermedius B196
NoYes   Streptococcus intermedius C270
NoYes   Streptococcus anginosus C238
NoYes   Streptococcus anginosus C1051
NoYes   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
NoYes   Streptococcus gallolyticus subsp. gallolyticus ATCC 43143
NoYes   Streptococcus lutetiensis 033
NoYes   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
NoYes   Streptococcus dysgalactiae subsp. equisimilis RE378
NoYes   Streptococcus oligofermentans AS 1.3089
NoYes   Streptococcus parasanguinis FW213
NoYes   Streptococcus pneumoniae A026
NoYes   Streptococcus pneumoniae ST556
NoYes   Streptococcus pneumoniae SPNA45
NoYes   Streptococcus pneumoniae SPN994039
NoYes   Streptococcus pneumoniae SPN994038
NoYes   Streptococcus pneumoniae SPN034183
NoYes   Streptococcus pneumoniae SPN034156
NoYes   Streptococcus pneumoniae INV104
NoYes   Streptococcus pneumoniae INV200
NoYes   Streptococcus pneumoniae OXC141
NoYes   Streptococcus pneumoniae gamPNI0373
NoYes   Streptococcus pneumoniae AP200
NoYes   Streptococcus pneumoniae ATCC 700669
NoYes   Streptococcus pneumoniae TCH8431/19A
NoYes   Streptococcus pneumoniae CGSP14
NoYes   Streptococcus pneumoniae G54
NoYes   Streptococcus pneumoniae JJA
NoYes   Streptococcus pneumoniae 70585
NoYes   Streptococcus pneumoniae Hungary19A-6
NoYes   Streptococcus pneumoniae Taiwan19F-14
NoYes   Streptococcus pneumoniae D39
NoYes   Streptococcus pneumoniae 670-6B
NoYes   Streptococcus pneumoniae R6
NoYes   Streptococcus pneumoniae TIGR4
NoYes   Streptococcus agalactiae ILRI112
NoYes   Streptococcus agalactiae ILRI005
NoYes   Streptococcus agalactiae 09mas018883
NoYes   Streptococcus agalactiae 2-22
NoYes   Streptococcus agalactiae SA20-06
NoYes   Streptococcus agalactiae GD201008-001
NoYes   Streptococcus agalactiae NEM316
NoYes   Streptococcus agalactiae 2603V/R
NoYes   Streptococcus mutans GS-5
NoYes   Streptococcus mutans LJ23
NoYes   Streptococcus mutans UA159
NoYes   Streptococcus suis T15
NoYes   Streptococcus suis TL13
NoYes   Streptococcus suis SC070731
NoYes   Streptococcus suis S735
NoYes   Streptococcus suis ST3
NoYes   Streptococcus suis D9
NoYes   Streptococcus suis SS12
NoYes   Streptococcus suis D12
NoYes   Streptococcus suis ST1
NoYes   Streptococcus suis A7
NoYes   Streptococcus suis JS14
NoYes   Streptococcus suis BM407
NoYes   Streptococcus suis SC84
NoYes   Streptococcus suis GZ1
NoYes   Streptococcus suis 98HAH33
NoYes   Streptococcus suis 05ZYH33
NoYes   Streptococcus salivarius CCHSS3
NoYes   Streptococcus salivarius JIM8777
NoYes   Exiguobacterium antarcticum B7
NoYes   Amphibacillus xylanus NBRC 15112
NoYes   Bacillus amyloliquefaciens subsp. plantarum sequencing
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5033
NoYes   Bacillus amyloliquefaciens subsp. plantarum AS43.3
NoYes   Bacillus amyloliquefaciens subsp. plantarum YAU B9601-Y2
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5113
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus amyloliquefaciens subsp. plantarum CAU B946
NoYes   Bacillus amyloliquefaciens LFB112
NoYes   Bacillus amyloliquefaciens CC178
NoYes   Bacillus amyloliquefaciens Y2
NoYes   Bacillus amyloliquefaciens IT-45
NoYes   Bacillus amyloliquefaciens XH7
NoYes   Bacillus amyloliquefaciens LL3
NoYes   Bacillus amyloliquefaciens TA208
NoYes   Bacillus amyloliquefaciens DSM 7
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis XF-1
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BAB-1
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis str. RO-NN-1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus subtilis subsp. spizizenii str. W23
NoYes   Bacillus subtilis subsp. natto BEST195
NoYes   Bacillus megaterium WSH-002
NoYes   Bacillus megaterium QM B1551
NoYes   Sorangium cellulosum So0157-2
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Methanolobus psychrophilus R15
NoYes   Methanosarcina mazei Tuc01
NoYes   Natrinema pellirubrum DSM 15624
NoYes   Haloquadratum walsbyi C23
NoYes   Halorhabdus tiamatea SARL4B
NoYes   Natronomonas moolapensis 8.8.11
NoYes   Haloarcula hispanica N601
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   2_050719S (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]