SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

POZ domain alignments in Gorilla gorilla 76_3.1

These alignments are sequences aligned to the 0035720 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1buoa_               mg............................................................................
ENSGGOP00000021168  iklqssdgeifevdveiak...........................................................
ENSGGOP00000013011  fs............................................................................
ENSGGOP00000017568  fs............................................................................
ENSGGOP00000020454  is............................................................................
ENSGGOP00000006907  f.............................................................................
ENSGGOP00000019565  f.............................................................................
ENSGGOP00000008956  t.............................................................................
ENSGGOP00000003626  h.............................................................................
ENSGGOP00000021128  s.............................................................................
ENSGGOP00000007581  nsk...........................................................................
ENSGGOP00000009888  ac............................................................................
ENSGGOP00000013848  np............................................................................
ENSGGOP00000022819  np............................................................................
ENSGGOP00000017093  e.............................................................................
ENSGGOP00000003069  lf............................................................................
ENSGGOP00000009080  kvp...........................................................................
ENSGGOP00000025902  lf............................................................................
ENSGGOP00000015894  kvp...........................................................................
ENSGGOP00000007923  l.............................................................................
ENSGGOP00000027254  l.............................................................................
ENSGGOP00000014601  th............................................................................
ENSGGOP00000003676  l.............................................................................
ENSGGOP00000028136  kvp...........................................................................
ENSGGOP00000005663  f.............................................................................
ENSGGOP00000027285  yvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfrerpsh...........................
ENSGGOP00000023551  h.............................................................................
ENSGGOP00000008891  i.............................................................................
ENSGGOP00000006683  f.............................................................................
ENSGGOP00000014781  h.............................................................................
ENSGGOP00000015335  serivinvggtrhqtyrstlrtlpgtrlawlaepdahshfdydpradef.............................
ENSGGOP00000026029  i.............................................................................
ENSGGOP00000000093  f.............................................................................
ENSGGOP00000000958  elvnlnvggfkqsvdqstllrfphtrlgklltchseeailelcddysvadke..........................
ENSGGOP00000012670  v.............................................................................
ENSGGOP00000008243  i.............................................................................
ENSGGOP00000002688  devl..........................................................................
ENSGGOP00000017890  i.............................................................................
ENSGGOP00000021385  f.............................................................................
ENSGGOP00000028262  dt............................................................................
ENSGGOP00000018004  n.............................................................................
ENSGGOP00000022121  n.............................................................................
ENSGGOP00000001618  n.............................................................................
ENSGGOP00000006123  fk............................................................................
ENSGGOP00000022681  dp............................................................................
ENSGGOP00000020951  p.............................................................................
ENSGGOP00000010436  dp............................................................................
ENSGGOP00000002271  hvi...........................................................................
ENSGGOP00000028316  c.............................................................................
ENSGGOP00000027249  f.............................................................................
ENSGGOP00000014290  ife...........................................................................
ENSGGOP00000013616  qg............................................................................
ENSGGOP00000015202  del...........................................................................
ENSGGOP00000018110  cs............................................................................
ENSGGOP00000023813  cs............................................................................
ENSGGOP00000010458  fh............................................................................
ENSGGOP00000026362  skw...........................................................................
ENSGGOP00000021245  skw...........................................................................
ENSGGOP00000017324  l.............................................................................
ENSGGOP00000024987  kw............................................................................
ENSGGOP00000003648  d.............................................................................
ENSGGOP00000003210  rrvkinvgglnhevlwrtldrlprtrlgklrdcnthesllevcddynlnen...........................
ENSGGOP00000027620  d.............................................................................
ENSGGOP00000011768  d.............................................................................
ENSGGOP00000016634  kw............................................................................
ENSGGOP00000000318  ql............................................................................
ENSGGOP00000003104  tl............................................................................
ENSGGOP00000019798  kiiinvggtrhetyrstlrtlpgtrlawladpeaavcgssggggceff..............................
ENSGGOP00000018987  q.............................................................................
ENSGGOP00000010139  sli...........................................................................
ENSGGOP00000012818  ekiiinvggtrhetyrstlrtlpgtrlawladpdgggrpeef....................................
ENSGGOP00000004716  ei............................................................................
ENSGGOP00000003892  se............................................................................
ENSGGOP00000003130  hs............................................................................
ENSGGOP00000027759  i.............................................................................
ENSGGOP00000018742  em............................................................................
ENSGGOP00000022777  em............................................................................
ENSGGOP00000018018  em............................................................................
ENSGGOP00000011052  q.............................................................................
ENSGGOP00000001903  s.............................................................................
ENSGGOP00000013383  rw............................................................................
ENSGGOP00000016766  rv............................................................................
ENSGGOP00000005968  ll............................................................................
ENSGGOP00000002752  geirinvggfkrrlrshtllrfpetrlgrlllchsreailelcddyddvqre..........................
ENSGGOP00000011719  ev............................................................................
ENSGGOP00000025363  m.............................................................................
ENSGGOP00000027450  ekiiinvggtrhetyrstlrtlpgtrlawladpdgggrpetdgggvgssgssggggceff..................
ENSGGOP00000022683  re............................................................................
ENSGGOP00000009560  re............................................................................
ENSGGOP00000019691  yn............................................................................
ENSGGOP00000002738  gga...........................................................................
ENSGGOP00000000386  q.............................................................................
ENSGGOP00000028415  q.............................................................................
ENSGGOP00000013223  pvhidvgghmytsslatltkypesrigrlfdgtepivldsl.....................................
ENSGGOP00000012188  p.............................................................................
ENSGGOP00000020804  evv...........................................................................
ENSGGOP00000000312  mi............................................................................
ENSGGOP00000022687  nervilnvggtrhetyrstlktlpgtrlallasseppgdclttagdrapplspgpggcfeggagncssrggrasdhpg
ENSGGOP00000009356  pvhidvgghmytsslatltkypdsrisrlfngtepivldsl.....................................
ENSGGOP00000019989  q.............................................................................
ENSGGOP00000019033  q.............................................................................
ENSGGOP00000015316  tlm...........................................................................
ENSGGOP00000019165  q.............................................................................
ENSGGOP00000020430  ts............................................................................
ENSGGOP00000017084  ne............................................................................
ENSGGOP00000003820  nervilnvggtrhetyrstlktlpgtrlallasseppgdclttagdklqpsppplsppprapplspgpggcfeggagn
ENSGGOP00000012694  a.............................................................................
ENSGGOP00000015147  ne............................................................................
ENSGGOP00000025230  tst...........................................................................
ENSGGOP00000002975  fed...........................................................................
ENSGGOP00000024277  pvhidvgghmytsslatltkypesrigrlfdgtepivldsl.....................................
ENSGGOP00000027576  pvhidvgghmytsslatltkypesrigrlfdgtepivldsl.....................................
ENSGGOP00000018927  m.............................................................................
ENSGGOP00000008276  tvnvggsrfvlsqqalscfphtrlgklavvvasyrrpgalaavpsplelcddanpvdne...................
ENSGGOP00000011444  m.............................................................................
ENSGGOP00000000831  rriiinvggikyslpwttldefpltrlgqlkactnfddilnvcddydvtcnef.........................
ENSGGOP00000005906  e.............................................................................
ENSGGOP00000016758  gc............................................................................
ENSGGOP00000002243  hv............................................................................
ENSGGOP00000007459  pgwr..........................................................................
ENSGGOP00000009697  ti............................................................................
ENSGGOP00000012961  pa............................................................................
ENSGGOP00000000656  ervvinisglrfetqlktlcqfpetllgdpkrrmryfdplrneyff................................
ENSGGOP00000027474  l.............................................................................
ENSGGOP00000011420  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrne...................................
ENSGGOP00000021753  ervvinisglrfetqlktlaqfpntllgnpkkrmryfdplrn....................................
ENSGGOP00000001534  eilinvggrryllpwstldqfplsrlsklrlcrsyeeiaqlcddyd................................
ENSGGOP00000006456  v.............................................................................
ENSGGOP00000002216  e.............................................................................
ENSGGOP00000000423  ql............................................................................
ENSGGOP00000019822  sv............................................................................
ENSGGOP00000005961  sv............................................................................
ENSGGOP00000009230  yn............................................................................
ENSGGOP00000013547  f.............................................................................
ENSGGOP00000024337  ervvinvsglrfetqmktlaqfpetllgdpekrtqyfdplrn....................................
ENSGGOP00000007168  ervvinvsglrfetqmktlaqfpetllgdpekrtqyfdplrn....................................
ENSGGOP00000027718  pn............................................................................
ENSGGOP00000020218  pn............................................................................
ENSGGOP00000026600  si............................................................................
ENSGGOP00000019480  me............................................................................
ENSGGOP00000004482  nky...........................................................................
ENSGGOP00000018737  yn............................................................................
ENSGGOP00000011744  qrvhinisglrfetqlgtlaqfpntllgdpakrlryfdplrneyffd...............................
ENSGGOP00000018938  yn............................................................................
ENSGGOP00000013101  i.............................................................................
ENSGGOP00000001595  elvtlnvggkifttrfstikqfpasr....................................................
ENSGGOP00000000227  lnvnvgghsyqldycelasfpktrlgrlatstsrsrqlslcddyeeqtd.............................
ENSGGOP00000027568  erlvinisglrfetqlrtlslfpdtllgdpgrrvrffdplrne...................................
ENSGGOP00000010747  ss............................................................................
ENSGGOP00000020080  lrern.........................................................................
ENSGGOP00000014177  evvpln........................................................................
ENSGGOP00000002953  ealrvnvggvrrqlsaralarfpgtrlgrlhaaaseeqarrlcddydeaaref.........................
ENSGGOP00000023230  ealrvnvggvrrqlsaralarfpgtrlgrlhaaaseeqarrlcddydeaaref.........................
ENSGGOP00000016398  td............................................................................
ENSGGOP00000007622  tv............................................................................
ENSGGOP00000016123  yi............................................................................
ENSGGOP00000004395  dwltlnvggryftttrilrstlvnkepdsmlah.............................................
ENSGGOP00000017862  tv............................................................................
ENSGGOP00000008219  qrviiniaglrfetqlrtlsqfpdtllgdrekrmq...........................................
ENSGGOP00000013219  tvvelnvggefhtttlgtlrkfpgsklaemfsslakastd......................................
ENSGGOP00000022519  e.............................................................................
ENSGGOP00000009774  e.............................................................................
ENSGGOP00000015247  ky............................................................................
ENSGGOP00000024010  ky............................................................................
ENSGGOP00000019246  ky............................................................................
ENSGGOP00000016080  ..............................................................................
ENSGGOP00000007297  te............................................................................
ENSGGOP00000024948  te............................................................................
ENSGGOP00000027215  dd............................................................................
ENSGGOP00000025289  r.............................................................................
ENSGGOP00000004247  qarkplw.......................................................................
ENSGGOP00000015257  r.............................................................................
ENSGGOP00000022917  dd............................................................................
ENSGGOP00000000174  d.............................................................................
ENSGGOP00000027797  n.............................................................................
ENSGGOP00000006679  q.............................................................................
ENSGGOP00000020540  p.............................................................................
ENSGGOP00000009305  ivvnvggvrqvlygdllsqypetrlaelinclaggydtifslcddydpgkrefy........................
ENSGGOP00000026924  pfs...........................................................................
ENSGGOP00000017487  ev............................................................................
ENSGGOP00000006549  p.............................................................................
ENSGGOP00000014191  h.............................................................................
ENSGGOP00000011572  a.............................................................................
ENSGGOP00000014231  h.............................................................................
ENSGGOP00000009396  damdgklvssddddfivkrehtrasgtrkavlsgpgqsaenetdqvnfreippr........................
ENSGGOP00000000174  s.............................................................................
ENSGGOP00000004210  hl............................................................................
ENSGGOP00000018481  hl............................................................................
ENSGGOP00000014767  d.............................................................................
ENSGGOP00000010269  la............................................................................
ENSGGOP00000015462  yr............................................................................
ENSGGOP00000001664  vvlnvggaryslsrellkdfplrrvsrlhgcrserdvlevcddydr................................
ENSGGOP00000019862  esk...........................................................................
ENSGGOP00000002153  gqfaenetnevnfreipshvlskvcmyftykvrytnssteip....................................
ENSGGOP00000026844  ga............................................................................
ENSGGOP00000019651  lqy...........................................................................
ENSGGOP00000004745  lqy...........................................................................
ENSGGOP00000010052  q.............................................................................
ENSGGOP00000017655  q.............................................................................
ENSGGOP00000023577  me............................................................................
ENSGGOP00000018343  t.............................................................................
ENSGGOP00000015994  t.............................................................................
ENSGGOP00000013731  vlr...........................................................................
ENSGGOP00000026531  vlr...........................................................................
ENSGGOP00000025953  cs............................................................................
ENSGGOP00000016283  cs............................................................................
ENSGGOP00000028113  rlf...........................................................................
ENSGGOP00000011861  glyftttrstsvnkepdtmlvhmfkdkgv.................................................
ENSGGOP00000021684  p.............................................................................
ENSGGOP00000026738  ..............................................................................
ENSGGOP00000010504  fstsrqtltwipd.................................................................
ENSGGOP00000015447  p.............................................................................
ENSGGOP00000021637  ltlnvglyftttrstsvnkepdtmlvhmfkdkgv............................................
ENSGGOP00000020123  lyrn..........................................................................
ENSGGOP00000007552  ..............................................................................
ENSGGOP00000001760  vt............................................................................
ENSGGOP00000003407  ek............................................................................
ENSGGOP00000015569  qiikvyvgshwyattlqtllkypellsnpqrvywitygqtl.....................................
ENSGGOP00000024001  sikllssdgelfevdveiakqs........................................................
ENSGGOP00000016642  ..............................................................................
ENSGGOP00000020138  ..............................................................................
ENSGGOP00000002005  ..............................................................................
ENSGGOP00000025953  vss...........................................................................
ENSGGOP00000016283  vss...........................................................................
ENSGGOP00000006469  rt............................................................................
ENSGGOP00000001665  nlnsqgggh.....................................................................
ENSGGOP00000018359  nlnsqgggh.....................................................................
ENSGGOP00000003889  ey............................................................................
ENSGGOP00000015569  dlf...........................................................................
ENSGGOP00000028485  lv............................................................................
ENSGGOP00000016194  lv............................................................................
ENSGGOP00000016383  psi...........................................................................
ENSGGOP00000024913  ew............................................................................
ENSGGOP00000026844  kc............................................................................
ENSGGOP00000025740  kc............................................................................
ENSGGOP00000012961  se............................................................................
ENSGGOP00000019075  ky............................................................................
ENSGGOP00000013869  ..............................................................................
ENSGGOP00000013602  sky...........................................................................
ENSGGOP00000025575  ..............................................................................
ENSGGOP00000012784  ..............................................................................
ENSGGOP00000017129  ..............................................................................
ENSGGOP00000006469  d.............................................................................
ENSGGOP00000020636  l.............................................................................
ENSGGOP00000023818  ..............................................................................
ENSGGOP00000019810  ainn..........................................................................
ENSGGOP00000020805  k.............................................................................
ENSGGOP00000001787  rfstsrqtlmwipd................................................................
ENSGGOP00000015569  ypslvtednllwla................................................................
ENSGGOP00000000244  ser...........................................................................
ENSGGOP00000004860  lkin..........................................................................
ENSGGOP00000024823  lkin..........................................................................
ENSGGOP00000004247  a.............................................................................
ENSGGOP00000009548  ..............................................................................
ENSGGOP00000025740  tsli..........................................................................

                                                 10        20          30                           
                                                  |         |           |                           
d1buoa_               ...................--MIQLQNPSHPTGLLCKANQMRLA..GTLCDVVIMV........DS..........QE
ENSGGOP00000021168  ...................-------------------------..----------........--..........--
ENSGGOP00000013011  ...................-------SDKHAQLILAQINKMRNG..EHFCDVQLQV........GQ..........ES
ENSGGOP00000017568  ...................-------SDKHAQLILAQINKMRNG..EHFCDVQLQV........GQ..........ES
ENSGGOP00000020454  ...................--------DKHPRQTLEVINLLRKH..RELCDVVLVV........GA..........KK
ENSGGOP00000006907  ...................------SAPSHSTSLLQGLATLRAQ..GQLLDVVLTI........NR..........EA
ENSGGOP00000019565  ...................------SAPSHSTSLLQGLATLRAQ..GQLLDVVLTI........NR..........EA
ENSGGOP00000008956  ...................--------NTHAKSILNSMNSLRKS..NTLCDVTLRV........EQ..........KD
ENSGGOP00000003626  ...................-----FSVSELPSRGYGVMEEIRRQ..GKLCDVTLKI........GD..........HK
ENSGGOP00000021128  ...................---------SHAENILQIFNEFRDS..RLFTDVIICV........EG..........KE
ENSGGOP00000007581  ...................---------RHYHDAFVAMSRMRQR..GLLCDIVLHV........AA..........KE
ENSGGOP00000009888  ...................----------------EIFNELRLE..GKLCDVVIKV........NG..........FE
ENSGGOP00000013848  ...................---------AHMGKAFKVMNELRSK..QLLCDVMIVA........ED..........VE
ENSGGOP00000022819  ...................---------AHMGKAFKVMNELRSK..QLLCDVMIVA........ED..........VE
ENSGGOP00000017093  ...................-------ISSHQSHLLQQLNEQRRQ..DVFCDCSILV........EG..........KV
ENSGGOP00000003069  ...................------HKSSYADSVLTHLNLLRQQ..RLFTDVLLHA........GN..........RT
ENSGGOP00000009080  ...................-----------ECRLADELGGLWEN..SRFTDCCLCV........AG..........QE
ENSGGOP00000025902  ...................------HKSSYADSVLTHLNLLRQQ..RLFTDVLLHA........GN..........RT
ENSGGOP00000015894  ...................-----------ECRLADELGGLWEN..SRFTDCCLCV........AG..........QE
ENSGGOP00000007923  ...................----------HSEQLLQGLNLLRQH..HELCDIILRV........GD..........VK
ENSGGOP00000027254  ...................----------HSEQLLQGLNLLRQH..HELCDIILRV........GD..........VK
ENSGGOP00000014601  ...................------SSSSHSQEMLGKLNMLRND..GHFCDITIRV........QD..........KI
ENSGGOP00000003676  ...................-----FKDSTHPVDFLDAFRTFYLD..GLFTDITLQCp.......SG..........II
ENSGGOP00000028136  ...................-----------ECRLAEDLGNLWEN..TRFTDCSFFV........RG..........QE
ENSGGOP00000005663  ...................---------------MGVMNNMRKQ..KTLCDVILMV........QE..........RK
ENSGGOP00000027285  ...................-------------------------..----------........--..........--
ENSGGOP00000023551  ...................----------HAEQTFRKMESYLKQ..QQLCDVILIV........GN..........RK
ENSGGOP00000008891  ...................------PFPDHSSDILSGLNEQRTQ..GLLCDVVILV........EG..........RE
ENSGGOP00000006683  ...................------SDPAHALSLLRGLSQLRAE..RKFLDVTLEAa.......GG..........RD
ENSGGOP00000014781  ...................----------HAEQTFRKMESYLKQ..QQLCDVILIV........GN..........RK
ENSGGOP00000015335  ...................-------------------------..----------........--..........--
ENSGGOP00000026029  ...................------PFPDHSSDILSGLNEQRTQ..GLLCDVVILV........EG..........RE
ENSGGOP00000000093  ...................------HLPSHAQDMLDGLHRLRSQ..PKLADVTLLV........GG..........RE
ENSGGOP00000000958  ...................-------------------------..----------........--..........--
ENSGGOP00000012670  ...................-----YRWADHSGTVLQRLNEQRLR..GLFCDVVLVA........DE..........QR
ENSGGOP00000008243  ...................------PFPNHSSEVLCSLNEQRHD..GLLCDVLLVV........QE..........QE
ENSGGOP00000002688  ...................-------------------------..------VVNV........SG..........RR
ENSGGOP00000017890  ...................------PFPNHSSEVLCSLNEQRHD..GLLCDVLLVV........QE..........QE
ENSGGOP00000021385  ...................------TSNTHSSVVLQGFDQLRIE..GLLCDVTLVPgd......GD..........EI
ENSGGOP00000028262  ...................---------AHSAALLAQLKSFYDA..RLLCDVTIEVvtpgsgpgTG..........RL
ENSGGOP00000018004  ...................----------HAEQTFKKMENYLRH..KQLCDVILVA........GD..........RR
ENSGGOP00000022121  ...................----------HAEQTFKKMENYLRH..KQLCDVILVA........GD..........RR
ENSGGOP00000001618  ...................----------HAEQTFKKMENYLRH..KQLCDVILVA........GD..........RR
ENSGGOP00000006123  ...................-------DHDFSSDLLRQLNSLRQS..RILTDVSICA........GA..........WE
ENSGGOP00000022681  ...................-------------------------..-----ITLNV........GG..........KL
ENSGGOP00000020951  ...................---------FHACSILKQLKTMYDE..GQLTDIVVEVd.......HG..........KT
ENSGGOP00000010436  ...................-------------------------..-----VTLNV........GG..........HL
ENSGGOP00000002271  ...................---------NHAEQTLRKMENYLKE..KQLCDVLLIA........GH..........LR
ENSGGOP00000028316  ...................-----IQFTRHASDVLLNLNRLRSR..DILTDVVIVV........SR..........EQ
ENSGGOP00000027249  ...................------TSNTHSSVVLQGFDQLRLE..GLLCDVTLMP........GDtd........DA
ENSGGOP00000014290  ...................-------ANEAWKDFHGSLLRFYEN..GELCDVTLKV........GS..........KL
ENSGGOP00000013616  ...................-----------------IMKLCLEE..ELFADVTISV........EG..........RE
ENSGGOP00000015202  ...................-------------------------..-----IVLNV........SG..........RR
ENSGGOP00000018110  ...................--------SIHDTSVSAGFRALYEE..GLLLDVTLVI........ED..........HQ
ENSGGOP00000023813  ...................--------SIHDTSVSAGFRALYEE..GLLLDVTLVI........ED..........HQ
ENSGGOP00000010458  ...................-------KASHPDCVLAHLNTLRKH..CMFTDVTLWA........GD..........RA
ENSGGOP00000026362  ...................-------------------------..-----VRLNV........GG..........TY
ENSGGOP00000021245  ...................-------------------------..-----VRLNV........GG..........TY
ENSGGOP00000017324  ...................------------------------K..KTLCDVILMV........QE..........RK
ENSGGOP00000024987  ...................-------------------------..-----VRLNV........GG..........TV
ENSGGOP00000003648  ...................-------FPGHFEQIFQQLNYQRLH..GQLCDCVIVV........GN..........RH
ENSGGOP00000003210  ...................-------------------------..----------........--..........--
ENSGGOP00000027620  ...................-------FPQHSQHVLEQLNQQRQL..GLLCDCTFVV........DG..........VH
ENSGGOP00000011768  ...................-------FPQHSQHVLEQLNQQRQL..GLLCDCTFVV........DG..........VH
ENSGGOP00000016634  ...................-------------------------..-----VRLNV........GG..........TV
ENSGGOP00000000318  ...................------EIPDFSNSVLSHLNQLRMQ..GRLCDIVVNV........QG..........QA
ENSGGOP00000003104  ...................--------------LQDGLKDLLDE..KKFIDCTLKA........GD..........KS
ENSGGOP00000019798  ...................-------------------------..----------........--..........--
ENSGGOP00000018987  ...................----------HSLNLLNKIKNMKEL..AEMIDVVLTA........EG..........EK
ENSGGOP00000010139  ...................--------------LQNGLETLRME..NALTDVILCV........DI..........QE
ENSGGOP00000012818  ...................-------------------------..----------........--..........--
ENSGGOP00000004716  ...................--------ASHYRHLLRELNEQRQH..GVLCDVCVVV........EG..........KV
ENSGGOP00000003892  ...................---------DHGQKILSVLQNFREQ..NVFYDFKIIM........KD..........EI
ENSGGOP00000003130  ...................--------ESHNDSVLAALNQQRSD..GILCDITLIA........EE..........QK
ENSGGOP00000027759  ...................---YLFKDSTHPVDFLDAFRTFYLD..GLFTDITLQCp.......SG..........II
ENSGGOP00000018742  ...................--------QSYYAKLLGELNEQRKR..DFFCDCSIIV........EG..........RI
ENSGGOP00000022777  ...................--------QSYYAKLLGELNEQRKR..DFFCDCSIIV........EG..........RI
ENSGGOP00000018018  ...................--------QSYYAKLLGELNEQRKR..DFFCDCSIIV........EG..........RI
ENSGGOP00000011052  ...................-----FDVPEYSSTVLSQLNELRLQ..GKLCDIIVHI........QG..........QP
ENSGGOP00000001903  ...................-----YTLEDHTKQAFGIMNELRLS..QQLCDVTLQV........KYqdapa.....AQ
ENSGGOP00000013383  ...................-------------------------..-----VRLNV........GG..........TY
ENSGGOP00000016766  ...................------EFPDFSSTILQKLNQQRQQ..GQLCDVSIVV........QG..........HI
ENSGGOP00000005968  ...................---------------QDGLKDMLDH..GKFLDCVVRA........GE..........RE
ENSGGOP00000002752  ...................-------------------------..----------........--..........--
ENSGGOP00000011719  ...................-------------------------..-----VELNV........GG..........QV
ENSGGOP00000025363  ...................------EFPDHSRHLLQCLSEQRHQ..GFLCDCTVLV........GD..........AQ
ENSGGOP00000027450  ...................-------------------------..----------........--..........--
ENSGGOP00000022683  ...................-------FTRHSSDVLGNLNELRLR..GILTDVTLLV........GG..........QP
ENSGGOP00000009560  ...................-------FTRHSSDVLGNLNELRLR..GILTDVTLLV........GG..........QP
ENSGGOP00000019691  ...................-------WQATKASLKERFAFLFNS..ELLSDVRFVL........GK..........ER
ENSGGOP00000002738  ...................--------------LLTGYQALRAE..GFLCDVTLET........EG..........SE
ENSGGOP00000000386  ...................--MLHIEIPNFGNTVLGCLNEQRLL..GLYCDVSIVV........KG..........QA
ENSGGOP00000028415  ...................--TLQMEIPNFGNSILECLNEQRLQ..GLYCDVSVVV........KG..........HA
ENSGGOP00000013223  ...................-------------------------..----------........--..........--
ENSGGOP00000012188  ...................--MYVYESTVHCTNILLGLNDQRKK..DILCDVTLIV........ER..........KE
ENSGGOP00000020804  ...................-------------------------..------ELNV........GG..........QV
ENSGGOP00000000312  ...................----QLQNPSHPTGLLCKANQMRLA..GTLCDVVIMV........DS..........QE
ENSGGOP00000022687  .............ggreff-------------------------..----------........--..........--
ENSGGOP00000009356  ...................-------------------------..----------........--..........--
ENSGGOP00000019989  ...................--MLHIEIPNFGNTVLGCLNEQRLL..GLYCDVSIVV........KG..........QA
ENSGGOP00000019033  ...................-------YSHHCEHLLERLNKQREA..GFLCDCTIVI........GE..........FQ
ENSGGOP00000015316  ...................-------------------------..------TLNV........GG..........YL
ENSGGOP00000019165  ...................-------YSHHCEHLLERLNKQREA..GFLCDCTIVI........GE..........FQ
ENSGGOP00000020430  ...................-----TFDPSHSDNLLHGLNLLWRK..QLFCDVTLTA........QG..........QQ
ENSGGOP00000017084  ...................--------NSYCYQLLRQLNEQRKK..GILCDVSIVV........SG..........KI
ENSGGOP00000003820  cssrggrasdhpgggreff-------------------------..----------........--..........--
ENSGGOP00000012694  ...................---------THSCHLLQQLHEQRIQ..GLLCDCMLVV........KG..........VC
ENSGGOP00000015147  ...................--------NSYCYQLLRQLNEQRKK..GILCDVSIVV........SG..........KI
ENSGGOP00000025230  ...................------FDPSHSDNLLHGLNLLWRK..QLFCDVTLTA........QG..........QQ
ENSGGOP00000002975  ...................--------ENFIESSVAKLNALRKS..GQFCDVRLQV........CG..........HE
ENSGGOP00000024277  ...................-------------------------..----------........--..........--
ENSGGOP00000027576  ...................-------------------------..----------........--..........--
ENSGGOP00000018927  ...................------EFPEHSQQLLQSLREQRSQ..GFLCDCTVMV........GS..........TQ
ENSGGOP00000008276  ...................-------------------------..----------........--..........--
ENSGGOP00000011444  ...................------EFPEHSQQLLQSLREQRSQ..GFLCDCTVMV........GS..........TQ
ENSGGOP00000000831  ...................-------------------------..----------........--..........--
ENSGGOP00000005906  ...................-------LPSHSKQLLLQLNQQRTK..GFLCDVIIMV........EN..........SI
ENSGGOP00000016758  ...................---YTYQVSRHSTEMLHNLNQQRKNg.GRFCDVLLRV........GD..........ES
ENSGGOP00000002243  ...................------------HILSEHIGALLIG..EEYGDVTFVV........EK..........KR
ENSGGOP00000007459  ...................---------CCRPTLRERNALMFNN..ELMADVHFVV........GPpgat......RT
ENSGGOP00000009697  ...................----QIEFPQHSSSLLESLNRHRLE..GKFCDVSLLV........QG..........RE
ENSGGOP00000012961  ...................------------SELGEDLLKLYVK..PCCPDIDIFV........DG..........KR
ENSGGOP00000000656  ...................-------------------------..----------........--..........--
ENSGGOP00000027474  ...................------QSTNHPNNLLKELNKCRLS..ETMCDVTIVV........GS..........RS
ENSGGOP00000011420  ...................-------------------------..----------........--..........--
ENSGGOP00000021753  ...................-------------------------..----------........--..........--
ENSGGOP00000001534  ...................-------------------------..----------........--..........--
ENSGGOP00000006456  ...................----HVSFPEVTSALLESLNQQRLQ..GQLCDVSIRV........QG..........RE
ENSGGOP00000002216  ...................-------FPEHHKMILDRLNEQREQ..DRFTDITLIV........DG..........HH
ENSGGOP00000000423  ...................----VVHSDAHSDTVLASFEDQRKK..GFLCDITLIV........EN..........VH
ENSGGOP00000019822  ...................---FAYESSVHSTNVLLSLNDQRKK..DVLCDVTIFV........EG..........QR
ENSGGOP00000005961  ...................---FAYESSVHSTNVLLSLNDQRKK..DVLCDVTIFV........EG..........QR
ENSGGOP00000009230  ...................-------WQATKASLKERFAFLFNS..ELLSDVRFVL........GKgrgaaaaggpQR
ENSGGOP00000013547  ...................------TDPGHPREMLKELNQQRRA..KAFTDLKIVV........EG..........RE
ENSGGOP00000024337  ...................-------------------------..----------........--..........--
ENSGGOP00000007168  ...................-------------------------..----------........--..........--
ENSGGOP00000027718  ...................-------WQGLYPTIRERNAMMFNN..DLMADVHFVVgppg....GT..........QR
ENSGGOP00000020218  ...................-------WQGLYPTIRERNAMMFNN..DLMADVHFVVgppg....GT..........QR
ENSGGOP00000026600  ...................------NLHNFSNSVLETLNEQRNR..GHFCDVTVRI........HG..........SM
ENSGGOP00000019480  ...................-------APGHSRQLLLQLNNQRTK..GFLCDVIIVV........QN..........AL
ENSGGOP00000004482  ...................-------------------------..-----VQLNV........GG..........SL
ENSGGOP00000018737  ...................-------DDDHKTLFLKTLNEQRLE..GEFCDIAIVV........ED..........VK
ENSGGOP00000011744  ...................-------------------------..----------........--..........--
ENSGGOP00000018938  ...................-------DDDHKTLFLKTLNEQRLE..GEFCDIAIVV........ED..........VK
ENSGGOP00000013101  ...................------PFPDHSSELLSCLNEQRQL..GHLCDLTIRT........QG..........LE
ENSGGOP00000001595  ...................-------------------------..----------........--..........--
ENSGGOP00000000227  ...................-------------------------..----------........--..........--
ENSGGOP00000027568  ...................-------------------------..----------........--..........--
ENSGGOP00000010747  ...................--------PKHCQAVLKQLNEQRLS..NQFCDVTLLI........EG..........EE
ENSGGOP00000020080  ...................-------------------ALMFNN..ELVADVHFVV........GPpgat......RT
ENSGGOP00000014177  ...................-------------------------..---------I........GG..........AH
ENSGGOP00000002953  ...................-------------------------..----------........--..........--
ENSGGOP00000023230  ...................-------------------------..----------........--..........--
ENSGGOP00000016398  ...................--------ASYGPNLLEGLSKMRQE..NFLCDFVIGT........KT..........KS
ENSGGOP00000007622  ...................---------------AESLKKEFDS..PETADLKFRI........DG..........KY
ENSGGOP00000016123  ...................-------NPAHAISLLSALNEERLK..GQLCDVLLIV........GD..........QK
ENSGGOP00000004395  ...................-------------------------..----------........--..........--
ENSGGOP00000017862  ...................---------------AESLKKEFDS..PETADLKFRI........DG..........KY
ENSGGOP00000008219  ...................-------------------------..----------........--..........--
ENSGGOP00000013219  ...................-------------------------..----------........--..........--
ENSGGOP00000022519  ...................-------LPNYSQQLLQQLYTLCKE..QQFCDCTISI........GT..........IY
ENSGGOP00000009774  ...................-------LPNYSQQLLQQLYTLCKE..QQFCDCTISI........GT..........IY
ENSGGOP00000015247  ...................-------------------------..-----VKLNV........GG..........SL
ENSGGOP00000024010  ...................-------------------------..-----VKLNV........GG..........SL
ENSGGOP00000019246  ...................-------------------------..-----VKLNV........GG..........SL
ENSGGOP00000016080  ...................--------PSHSSYVLQQLNNQREW..GFLCDCCIAI........DD..........IY
ENSGGOP00000007297  ...................--------KNYNSFVLQNLNRQRKR..KEYWDMALSV........DH..........HV
ENSGGOP00000024948  ...................--------KNYNSFVLQNLNRQRKR..KEYWDMALSV........DH..........HV
ENSGGOP00000027215  ...................---------FHSDTVLSILNEQRIR..GILCDVTIIV........ED..........TK
ENSGGOP00000025289  ...................-----FQLPGHEAATLRNMNQLRAE..ERFCDVTIVA........DS..........LK
ENSGGOP00000004247  ...................-------------FYNTSLKFFLNK..PMLADVVFEI........QG..........TT
ENSGGOP00000015257  ...................-----FQLPGHEAATLRNMNQLRAE..ERFCDVTIVA........DS..........LK
ENSGGOP00000022917  ...................---------FHSDTVLSILNEQRIR..GILCDVTIIV........ED..........TK
ENSGGOP00000000174  ...................-----------------FLQRLLEQ..GIHSDVVFVV........HG..........KP
ENSGGOP00000027797  ...................--------PWHMKKAFKVMNELRSQ..NLLCDVTIVA........ED..........ME
ENSGGOP00000006679  ...................----------HSVRVLQELNKQREK..GQYCDATLDV........GG..........LV
ENSGGOP00000020540  ...................--------------------HFLNN..KEMSDVTFLV........EG..........RP
ENSGGOP00000009305  ...................-------------------------..----------........--..........--
ENSGGOP00000026924  ...................----------------AALRSLVNN..PRYSDVCFVVgq......ER..........QE
ENSGGOP00000017487  ...................-------------------------..-----VELNV........GG..........QV
ENSGGOP00000006549  ...................--------------------HFLNN..KEMSDVTFLV........EG..........RP
ENSGGOP00000014191  ...................-----FQFEQQGDVVLQKMNLLRQQ..NLFCDVSIYI........ND..........TE
ENSGGOP00000011572  ...................---------SHSLVLLQQLNMQREF..GFLCDCTVAI........GD..........VY
ENSGGOP00000014231  ...................---------------------FLNN..KEMSDVTFLV........EG..........KL
ENSGGOP00000009396  ...................-------------------------..----------........--..........--
ENSGGOP00000000174  ...................-------------------------..--CPDICFRV........AG..........CS
ENSGGOP00000004210  ...................-------------TVAESLKREFDN..PDTADLKFLV........DG..........KY
ENSGGOP00000018481  ...................-------------TVAESLKREFDN..PDTADLKFLV........DG..........KY
ENSGGOP00000014767  ...................--LLHFKFENYGDSMLQKMNKLREE..NKFCDVTVLI........DD..........IE
ENSGGOP00000010269  ...................---------NHGLILLQQLNAQREF..GFLCDCTVAI........GD..........VY
ENSGGOP00000015462  ...................-------SAQHSQALLRGLLALRDS..GILFDVVLVV........EG..........RH
ENSGGOP00000001664  ...................-------------------------..----------........--..........--
ENSGGOP00000019862  ...................---------SSPFNLLHEMHELRLL..GHLCDVTVSV........EYqgvr......KD
ENSGGOP00000002153  ...................-------------------------..----------........--..........--
ENSGGOP00000026844  ...................-------------------------..-EFCDITLLL........DG..........HP
ENSGGOP00000019651  ...................-----------NKNLLKYLNDDRQKq.PSFCDLLIIV........EG..........KE
ENSGGOP00000004745  ...................-----------NKNLLKYLNDDRQKq.PSFCDLLIIV........EG..........KE
ENSGGOP00000010052  ...................----------YSGSLLNSLNEQRGH..GLFCDVTVIV........ED..........RK
ENSGGOP00000017655  ...................----------YSGSLLNSLNEQRGH..GLFCDVTVIV........ED..........RK
ENSGGOP00000023577  ...................-------APGHSRQLLLQLNNQRTK..GFLCDVIIVV........QN..........AL
ENSGGOP00000018343  ...................-------DPSHAPAVLRQLNEQRLR..GLFCDVTLIA........GD..........TK
ENSGGOP00000015994  ...................-------DPSHAPAVLRQLNEQRLR..GLFCDVTLIA........GD..........TK
ENSGGOP00000013731  ...................-------------------------..-------LNV........GG..........CI
ENSGGOP00000026531  ...................-------------------------..-------LNV........GG..........CI
ENSGGOP00000025953  ...................-------------------------..-FLCDVTMKSv.......DG..........KE
ENSGGOP00000016283  ...................-------------------------..-FLCDVTMKSv.......DG..........KE
ENSGGOP00000028113  ...................------------------------Q..PDLCDVDLVLvp......QR..........SV
ENSGGOP00000011861  ...................-------------------------..----------........--..........--
ENSGGOP00000021684  ...................---------CHAQRVLQTLNAYRRS..GTLTDVVLRA........GG..........RD
ENSGGOP00000026738  ...................------------------MNKLRAE..EWFCDMTIVA........DS..........LK
ENSGGOP00000010504  ...................-------------------------..----------........--..........--
ENSGGOP00000015447  ...................---------CHAQRVLQTLNAYRRS..GTLTDVVLRA........GG..........RD
ENSGGOP00000021637  ...................-------------------------..----------........--..........--
ENSGGOP00000020123  ...................--------PRFLRLAFLQLHHQQQS..DVFCDVLLQA........EG..........EA
ENSGGOP00000007552  ...................-------------------------..----------........--..........--
ENSGGOP00000001760  ...................------VNPWHMKKAFKVMNELRSQ..NLLCDVTIVA........ED..........ME
ENSGGOP00000003407  ...................-------------------------..-----VTLLV........DG..........TR
ENSGGOP00000015569  ...................-------------------------..----------........--..........--
ENSGGOP00000024001  ...................-------------------------..----------........--..........--
ENSGGOP00000016642  ...................---------NHSQAVLQRLQELLRQ..GNASDVVLRV........QAagtdev....RV
ENSGGOP00000020138  ...................-------------------------..---SDLKIKV........GD..........RH
ENSGGOP00000002005  ...................-------------------------..----DLKIKV........GD..........RH
ENSGGOP00000025953  ...................--------SSFFEEFGKLLREADEM..DSIHDVTFQV........GN..........RL
ENSGGOP00000016283  ...................--------SSFFEEFGKLLREADEM..DSIHDVTFQV........GN..........RL
ENSGGOP00000006469  ...................--------------LQKDMADLYEY..KYCTDVDLIF........QE..........TC
ENSGGOP00000001665  ...................-------------------------..----------........--..........--
ENSGGOP00000018359  ...................-------------------------..----------........--..........--
ENSGGOP00000003889  ...................-----------AVSLLEQLKLFYEQ..QLFTDIVLIV........EG..........TE
ENSGGOP00000015569  ...................-------------------------..------HFNV........GG..........WH
ENSGGOP00000028485  ...................----------------ADFGAMVNN..PHLSDVQFQTd.......SG..........EV
ENSGGOP00000016194  ...................----------------ADFGAMVNN..PHLSDVQFQTd.......SG..........EV
ENSGGOP00000016383  ...................------RLPSPYGSDRLVQLAARLR..PALCDTLITV........GS..........QE
ENSGGOP00000024913  ...................-----LRSEEHPSQFFAEAQRLREQ..RLLLDEEVSV........AG..........RV
ENSGGOP00000026844  ...................-------------TLHEDYGRLWES..RQFCDVEFVLge......KE..........EC
ENSGGOP00000025740  ...................-------------TLHEDYGRLWES..RQFCDVEFVLge......KE..........EC
ENSGGOP00000012961  ...................-------------KLSQDLLRLLRE..EFHTDVTFSV........GC..........TL
ENSGGOP00000019075  ...................-------------------------..-----VKLNV........GG..........AL
ENSGGOP00000013869  ...................-------------------------..----------........--..........--
ENSGGOP00000013602  ...................-------------------------..-----VKLNV........GG..........AL
ENSGGOP00000025575  ...................-------------------------..----DLVLEV........SG..........RR
ENSGGOP00000012784  ...................-------------------------..-----VQIRL........ED..........RC
ENSGGOP00000017129  ...................-------------------------..----DLVLEV........SG..........RR
ENSGGOP00000006469  ...................-------------------------..----------........--..........EE
ENSGGOP00000020636  ...................-------------------------..-------IIV........DN..........TR
ENSGGOP00000023818  ...................-------------------------..-----VQVWV........GG..........QL
ENSGGOP00000019810  ...................-------------------------..----------........--..........--
ENSGGOP00000020805  ...................-------------------------..-------FVV........SG..........KY
ENSGGOP00000001787  ...................-------------------------..----------........--..........--
ENSGGOP00000015569  ...................-------------------------..----------........--..........--
ENSGGOP00000000244  ...................-------------------------..-----VTLIV........DN..........TR
ENSGGOP00000004860  ...................-------------------------..----------........--..........--
ENSGGOP00000024823  ...................-------------------------..----------........--..........--
ENSGGOP00000004247  ...................------------SHYNSDLNNLLFC..CQCVDVVFYN........PDlk........EV
ENSGGOP00000009548  ...................-------------------------..----------........--..........--
ENSGGOP00000025740  ...................----------------QDMKAYLEGagAEFCDITLLL........DG..........HP

                      40        50                                                                  
                       |         |                                                                  
d1buoa_               .FHAHRTVLACTSK.MF.EI.LF.......................................................
ENSGGOP00000021168  .----------QSV.TI.KT.ML.......................................................
ENSGGOP00000013011  .FKAHRLVLAASSP.YF.AA.LF.......................................................
ENSGGOP00000017568  .FKAHRLVLAASSP.YF.AA.LF.......................................................
ENSGGOP00000020454  .IYAHRVILSACSP.YF.RA.MF.......................................................
ENSGGOP00000006907  .FPAHKVVLAACSD.YF.RA.MF.......................................................
ENSGGOP00000019565  .FPAHKVVLAACSD.YF.RA.MF.......................................................
ENSGGOP00000008956  .FPAHRIVLAACSD.YF.CA.MF.......................................................
ENSGGOP00000003626  .FSAHRIVLAASIP.YF.HA.MF.......................................................
ENSGGOP00000021128  .FPCHRAVLSACSS.YF.RA.MF.......................................................
ENSGGOP00000007581  .IRAHKVVLASCSP.YF.HA.MF.......................................................
ENSGGOP00000009888  .FSAHKNILCSCSS.YF.RA.LF.......................................................
ENSGGOP00000013848  .IEAHRVVLAACSP.YF.CA.MF.......................................................
ENSGGOP00000022819  .IEAHRVVLAACSP.YF.CA.MF.......................................................
ENSGGOP00000017093  .FKAHRNVLFASSG.YF.KM.LL.......................................................
ENSGGOP00000003069  .FPCHRAVLAACSR.YF.EA.MF.......................................................
ENSGGOP00000009080  .FQAHKAILAARSP.VF.SA.MF.......................................................
ENSGGOP00000025902  .FPCHRAVLAACSR.YF.EA.MF.......................................................
ENSGGOP00000015894  .FQAHKAILAARSP.VF.SA.MF.......................................................
ENSGGOP00000007923  .IHAHKVVLASVSP.YF.KA.MF.......................................................
ENSGGOP00000027254  .IHAHKVVLASVSP.YF.KA.MF.......................................................
ENSGGOP00000014601  .FRAHKVVLAACSD.FF.RT.KL.......................................................
ENSGGOP00000003676  .FHCHRAVLAACSN.YF.KA.MF.......................................................
ENSGGOP00000028136  .FKAHKSVLAARSP.VF.NA.MF.......................................................
ENSGGOP00000005663  .IPAHRVVLAAASH.FF.NL.MF.......................................................
ENSGGOP00000027285  .------VLSKVCM.YF.TC.KV.......................................................
ENSGGOP00000023551  .IPAHRLVLSSVSD.YF.AA.MF.......................................................
ENSGGOP00000008891  .FPTHRSVLAACSQ.YF.KK.LF.......................................................
ENSGGOP00000006683  .FPAHRAVLAAASP.YF.RA.MF.......................................................
ENSGGOP00000014781  .IPAHRLVLSSVSD.YF.AA.MF.......................................................
ENSGGOP00000015335  .-------------.--.--.--.......................................................
ENSGGOP00000026029  .FPTHRSVLAACSQ.YF.KK.LF.......................................................
ENSGGOP00000000093  .LPCHRGLLALSSP.YF.HA.MF.......................................................
ENSGGOP00000000958  .-------------.--.--.--.......................................................
ENSGGOP00000012670  .VPAHRNLLAVCSD.YF.NS.MF.......................................................
ENSGGOP00000008243  .YRTHRSVLAACSK.YF.KK.LF.......................................................
ENSGGOP00000002688  .FETWKNTLDRYPD.TL.LG.SS.......................................................
ENSGGOP00000017890  .YRTHRSVLAACSK.YF.KK.LF.......................................................
ENSGGOP00000021385  .FPVHRAMMASASD.YF.KA.MF.......................................................
ENSGGOP00000028262  .FSCNRNVLAAACP.YF.KS.MF.......................................................
ENSGGOP00000018004  .IPAHRLVLSSVSD.YF.AA.MF.......................................................
ENSGGOP00000022121  .IPAHRLVLSSVSD.YF.AA.MF.......................................................
ENSGGOP00000001618  .IPAHRLVLSSVSD.YF.AA.MF.......................................................
ENSGGOP00000006123  .IPCHRNVLASSSP.YF.RA.MF.......................................................
ENSGGOP00000022681  .YTTSLATLTSFPDsML.GA.MF.......................................................
ENSGGOP00000020951  .FSCHRNVLAAISP.YF.RS.MF.......................................................
ENSGGOP00000010436  .YTTSLTTLTRYPDsML.GA.MF.......................................................
ENSGGOP00000002271  .IPAHRLVLSAVSD.YF.AA.MF.......................................................
ENSGGOP00000028316  .FRAHKTVLMACSG.LF.YS.IF.......................................................
ENSGGOP00000027249  .FPVHRVMMASASD.YF.KA.MF.......................................................
ENSGGOP00000014290  .ISCHKLVLACVIP.YF.RA.MF.......................................................
ENSGGOP00000013616  .FQLHRLVLSAQSC.FF.RS.MF.......................................................
ENSGGOP00000015202  .FQTWRTTLERYPD.TL.LG.ST.......................................................
ENSGGOP00000018110  .FQAHKALLATQSD.YF.RI.MF.......................................................
ENSGGOP00000023813  .FQAHKALLATQSD.YF.RI.MF.......................................................
ENSGGOP00000010458  .FPCHRAVLAASSR.YF.EA.MF.......................................................
ENSGGOP00000026362  .FLTTRQTLCRDPK.SF.LY.RL.......................................................
ENSGGOP00000021245  .FLTTRQTLCRDPK.SF.LY.RL.......................................................
ENSGGOP00000017324  .IPAHRVVLAAASH.FF.NL.MF.......................................................
ENSGGOP00000024987  .FLTTRQTLCREQK.SF.LS.RL.......................................................
ENSGGOP00000003648  .FKAHRSVLAACST.HF.RA.LF.......................................................
ENSGGOP00000003210  .-------------.--.--.--.......................................................
ENSGGOP00000027620  .FKAHKAVLAACSE.YF.KM.LF.......................................................
ENSGGOP00000011768  .FKAHKAVLAACSE.YF.KM.LF.......................................................
ENSGGOP00000016634  .FLTTRQTLCREQK.SF.LS.RL.......................................................
ENSGGOP00000000318  .FRAHKVVLAASSP.YF.RD.HM.......................................................
ENSGGOP00000003104  .LPCHRLILSACSP.YF.RE.YF.......................................................
ENSGGOP00000019798  .-------------.--.--.--.......................................................
ENSGGOP00000018987  .FPCHRLVLAAFSP.YF.KA.MF.......................................................
ENSGGOP00000010139  .FSCHRVVLAAASN.YF.RA.MF.......................................................
ENSGGOP00000012818  .-------------.--.--.--.......................................................
ENSGGOP00000004716  .FKAHKNVLLGSSR.YF.KT.LY.......................................................
ENSGGOP00000003892  .IPCHRCVLAACSD.FF.RA.MF.......................................................
ENSGGOP00000003130  .FHAHKAVLAACSD.YF.RA.MF.......................................................
ENSGGOP00000027759  .FHCHRAVLAACSN.YF.KA.MF.......................................................
ENSGGOP00000018742  .FKAHRNILFANSG.YF.RA.LL.......................................................
ENSGGOP00000022777  .FKAHRNILFANSG.YF.RA.LL.......................................................
ENSGGOP00000018018  .FKAHRNILFANSG.YF.RA.LL.......................................................
ENSGGOP00000011052  .FRAHKAVLAASSP.YF.RD.HS.......................................................
ENSGGOP00000001903  .FMAHKVVLASSSP.VF.KA.MF.......................................................
ENSGGOP00000013383  .FVTTRQTLGREPK.SF.LC.RL.......................................................
ENSGGOP00000016766  .FRAHKAVLAASSP.YF.CD.QV.......................................................
ENSGGOP00000005968  .FPCHRLVLAACSP.YF.RA.RF.......................................................
ENSGGOP00000002752  .-------------.--.--.--.......................................................
ENSGGOP00000011719  yFTRHSTLISIPHS.LL.WK.MF.......................................................
ENSGGOP00000025363  .FRAHRAVLASCSM.YF.HL.FY.......................................................
ENSGGOP00000027450  .-------------.--.--.--.......................................................
ENSGGOP00000022683  .LRAHKAVLIACSG.FF.YS.IF.......................................................
ENSGGOP00000009560  .LRAHKAVLIACSG.FF.YS.IF.......................................................
ENSGGOP00000019691  .IPAHRFVLAAGSA.VF.DA.MF.......................................................
ENSGGOP00000002738  .FPAHRSLLACSSD.YF.RA.LF.......................................................
ENSGGOP00000000386  .FKAHRAVLAASSL.YF.RD.LF.......................................................
ENSGGOP00000028415  .FKAHRAVLAASSS.YF.RD.LF.......................................................
ENSGGOP00000013223  .-------------.--.--.--.......................................................
ENSGGOP00000012188  .FRAHRAVLAACSE.YF.WQ.AL.......................................................
ENSGGOP00000020804  yVTKHSTLLSVPDS.TL.AS.MF.......................................................
ENSGGOP00000000312  .FHAHRTVLACTSK.MF.EI.LF.......................................................
ENSGGOP00000022687  .-------------.--.--.--.......................................................
ENSGGOP00000009356  .-------------.--.--.--.......................................................
ENSGGOP00000019989  .FKAHRAVLAASSL.YF.RD.LF.......................................................
ENSGGOP00000019033  .FKAHRNVLASFSE.YF.GA.IY.......................................................
ENSGGOP00000015316  .YITQKQTLTKYPD.TF.LE.GI.......................................................
ENSGGOP00000019165  .FKAHRNVLASFSE.YF.GA.IY.......................................................
ENSGGOP00000020430  .FHCHKAVLASCSQ.YF.RS.LFsshpplgggvggqdglgapkappqeepgtpssspddkll................
ENSGGOP00000017084  .FKAHKNILVAGSR.FF.KT.LY.......................................................
ENSGGOP00000003820  .-------------.--.--.--.......................................................
ENSGGOP00000012694  .FKAHKNVLAAFSQ.YF.SR.SL.......................................................
ENSGGOP00000015147  .FKAHKNILVAGSR.FF.KT.LY.......................................................
ENSGGOP00000025230  .FHCHKAVLASCSQ.YF.RS.LFsshpplgggvggqdglgapkdqqqppqqqpsqqqqpppqeepgtpssspddkll.
ENSGGOP00000002975  .MLAHRAVLACCSP.YL.FE.IF.......................................................
ENSGGOP00000024277  .-------------.--.--.--.......................................................
ENSGGOP00000027576  .-------------.--.--.--.......................................................
ENSGGOP00000018927  .FLAHRAVLASCSP.FF.QL.FY.......................................................
ENSGGOP00000008276  .-------------.--.--.--.......................................................
ENSGGOP00000011444  .FLAHRAVLASCSP.FF.QL.FY.......................................................
ENSGGOP00000000831  .-------------.--.--.--.......................................................
ENSGGOP00000005906  .FRAHKNVLAASSI.YF.KS.LV.......................................................
ENSGGOP00000016758  .FPAHRAVLAACSE.YF.ES.VFsaqlgdggaadggpadvggataapggg............................
ENSGGOP00000002243  .FPAHRVILAARCQ.YF.RA.LL.......................................................
ENSGGOP00000007459  .VPAHKYVLAVGSS.VF.YA.MF.......................................................
ENSGGOP00000009697  .LRAHKAVLAAASP.YF.HD.KL.......................................................
ENSGGOP00000012961  .FKAHRAILSARSS.YF.AA.ML.......................................................
ENSGGOP00000000656  .-------------.--.--.--.......................................................
ENSGGOP00000027474  .FPAHKAVLACAAG.YF.QN.LF.......................................................
ENSGGOP00000011420  .-------------.--.--.--.......................................................
ENSGGOP00000021753  .-------------.--.--.--.......................................................
ENSGGOP00000001534  .-------------.--.--.--.......................................................
ENSGGOP00000006456  .FRAHRAVLAASSP.YF.HD.QV.......................................................
ENSGGOP00000002216  .FKAHKAVLAACSK.FF.YK.FF.......................................................
ENSGGOP00000000423  .FRAHKALLAASSE.YF.SM.MF.......................................................
ENSGGOP00000019822  .FRAHRSVLAACSS.YF.HS.RI.......................................................
ENSGGOP00000005961  .FRAHRSVLAACSS.YF.HS.RI.......................................................
ENSGGOP00000009230  .IPAHRFVLAAGSA.VF.DA.MF.......................................................
ENSGGOP00000013547  .FEVHQNVLASCSL.YF.KD.LI.......................................................
ENSGGOP00000024337  .-------------.--.--.--.......................................................
ENSGGOP00000007168  .-------------.--.--.--.......................................................
ENSGGOP00000027718  .LPGHKYVLAVGSS.VF.HA.MF.......................................................
ENSGGOP00000020218  .LPGHKYVLAVGSS.VF.HA.MF.......................................................
ENSGGOP00000026600  .LRAHRCVLAAGSP.FF.QD.KL.......................................................
ENSGGOP00000019480  .FRAHKNVLAASSA.YL.KS.LV.......................................................
ENSGGOP00000004482  .YYTTVRALTRHDT.ML.KA.MF.......................................................
ENSGGOP00000018737  .FRAHRCVLAACST.YF.KK.LF.......................................................
ENSGGOP00000011744  .-------------.--.--.--.......................................................
ENSGGOP00000018938  .FRAHRCVLAACST.YF.KK.LF.......................................................
ENSGGOP00000013101  .YRTHRAVLAACSH.YF.KK.LF.......................................................
ENSGGOP00000001595  .-------------.-L.AR.ML.......................................................
ENSGGOP00000000227  .-------------.--.--.--.......................................................
ENSGGOP00000027568  .-------------.--.--.--.......................................................
ENSGGOP00000010747  .YKAHKSVLSANSE.YF.RD.LF.......................................................
ENSGGOP00000020080  .VPAHKYVLAVCSS.VF.YA.MF.......................................................
ENSGGOP00000014177  .FTTRLSTLRCYED.TMlAA.MF.......................................................
ENSGGOP00000002953  .-------------.--.--.--.......................................................
ENSGGOP00000023230  .-------------.--.--.--.......................................................
ENSGGOP00000016398  .FDVHKSVMASCSE.YF.YN.IL.......................................................
ENSGGOP00000007622  .IHVHKAVLKIRCE.HF.RS.MF.......................................................
ENSGGOP00000016123  .FRAHKNVLAASSE.YF.QS.LF.......................................................
ENSGGOP00000004395  .-------------.--.--.MF.......................................................
ENSGGOP00000017862  .IHVHKAVLKIRCE.HF.RS.MF.......................................................
ENSGGOP00000008219  .-------------.--.--.-F.......................................................
ENSGGOP00000013219  .-------------.--.--.--.......................................................
ENSGGOP00000022519  .FRAHKLVLAAASL.LF.KT.LL.......................................................
ENSGGOP00000009774  .FRAHKLVLAAASL.LF.KT.LL.......................................................
ENSGGOP00000015247  .HYTTLRTLTGQDT.ML.KA.MF.......................................................
ENSGGOP00000024010  .HYTTLRTLTGQDT.ML.KA.MF.......................................................
ENSGGOP00000019246  .HYTTLRTLTGQDT.ML.KA.MF.......................................................
ENSGGOP00000016080  .FQAHKAVLAACSS.YF.RM.FF.......................................................
ENSGGOP00000007297  .FFAHRNVLAAVSP.LV.RS.LI.......................................................
ENSGGOP00000024948  .FFAHRNVLAAVSP.LV.RS.LI.......................................................
ENSGGOP00000027215  .FKAHSNVLAASSL.YF.KN.IF.......................................................
ENSGGOP00000025289  .FRGHKVILAACSP.FL.RD.QF.......................................................
ENSGGOP00000004247  .VPAHRAILVARCE.VM.AA.MF.......................................................
ENSGGOP00000015257  .FRGHKVILAACSP.FL.RD.QF.......................................................
ENSGGOP00000022917  .FKAHSNVLAASSL.YF.KN.IF.......................................................
ENSGGOP00000000174  .FRVHRCVLGARSA.YF.AN.ML.......................................................
ENSGGOP00000027797  .ISAHRVVLAACSP.YF.HA.MF.......................................................
ENSGGOP00000006679  .FKAHWSVLACCSH.FF.QS.LY.......................................................
ENSGGOP00000020540  .FYAHKVLLFTASP.RF.KA.LL.......................................................
ENSGGOP00000009305  .-------------.--.--.--.......................................................
ENSGGOP00000026924  .VFAHRCLLACRCN.FF.QR.LL.......................................................
ENSGGOP00000017487  .YVTKHSTLASRTA.LW.RM.FS.......................................................
ENSGGOP00000006549  .FYAHKVLLFTASP.RF.KA.LL.......................................................
ENSGGOP00000014191  .FQGHKVILAACST.FM.RD.QF.......................................................
ENSGGOP00000011572  .FKAHRAVLAAFSN.YF.KM.IF.......................................................
ENSGGOP00000014231  .FYAHKVLLVTASN.RF.KT.LM.......................................................
ENSGGOP00000009396  .-------------.--.--.--.......................................................
ENSGGOP00000000174  .FLCHKAFFCGRSD.YF.RA.LL.......................................................
ENSGGOP00000004210  .IYAHKVLLKIRCE.HF.RS.SL.......................................................
ENSGGOP00000018481  .IYAHKVLLKIRCE.HF.RS.SL.......................................................
ENSGGOP00000014767  .VQGHKIVFAAGSP.FL.RD.QF.......................................................
ENSGGOP00000010269  .FKAHKSVLASFSN.YF.KM.LF.......................................................
ENSGGOP00000015462  .IEAHRILLAASCD.YF.RG.VC.......................................................
ENSGGOP00000001664  .-------------.--.--.--.......................................................
ENSGGOP00000019862  .FMAHKAVLAATSK.FF.KE.VF.......................................................
ENSGGOP00000002153  .-------------.--.--.--.......................................................
ENSGGOP00000026844  .RPAHKAILAARSS.YF.EA.MF.......................................................
ENSGGOP00000019651  .FSAHKVVVAVGSS.YF.HA.CL.......................................................
ENSGGOP00000004745  .FSAHKVVVAVGSS.YF.HA.CL.......................................................
ENSGGOP00000010052  .FRAHKNILSASST.YF.HQ.LF.......................................................
ENSGGOP00000017655  .FRAHKNILSASST.YF.HQ.LF.......................................................
ENSGGOP00000023577  .FRAHKNVLAASSA.YL.KS.LV.......................................................
ENSGGOP00000018343  .FPAHRSVLAASSP.FF.RE.ALltsaplplppatggaapnpatttapppasppa.......................
ENSGGOP00000015994  .FPAHRSVLAASSP.FF.RE.ALltsaplplppatggaapnpatttaassssssssssssssssassssssssssppp
ENSGGOP00000013731  .YTARRESLCRFKD.SM.LAsMF.......................................................
ENSGGOP00000026531  .YTARRESLCRFKD.SM.LAsMF.......................................................
ENSGGOP00000025953  .FPCHKCVLCARLE.YF.HS.ML.......................................................
ENSGGOP00000016283  .FPCHKCVLCARLE.YF.HS.ML.......................................................
ENSGGOP00000028113  .FPAHKGVLAAYSQ.FF.HS.LF.......................................................
ENSGGOP00000011861  .-------------.--.--.--.......................................................
ENSGGOP00000021684  .FPCHRAALSAGSA.YF.RS.LF.......................................................
ENSGGOP00000026738  .FRGHKVILAARSP.FL.RD.QF.......................................................
ENSGGOP00000010504  .------------S.FF.SS.LL.......................................................
ENSGGOP00000015447  .FPCHRAALSAGSA.YF.RS.LV.......................................................
ENSGGOP00000021637  .-------------.--.--.--.......................................................
ENSGGOP00000020123  .VPAHCCILSACSP.FF.TE.RL.......................................................
ENSGGOP00000007552  .----RFVLAVGSA.VF.DA.MF.......................................................
ENSGGOP00000001760  .ISAHRVVLAACSP.YF.HA.MF.......................................................
ENSGGOP00000003407  .FVVNPQIFTAHPD.TM.LG.RM.......................................................
ENSGGOP00000015569  .-------------.--.--.--.......................................................
ENSGGOP00000024001  .------------V.TL.KI.ML.......................................................
ENSGGOP00000016642  .FHAHRLLLGLHSE.LF.RE.LL.......................................................
ENSGGOP00000020138  .ISAHKFVLAARSD.SW.SL.AN.......................................................
ENSGGOP00000002005  .ISAHKFVLAARSD.SW.SL.AN.......................................................
ENSGGOP00000025953  .FPAHKYILAVHSD.FF.QK.LF.......................................................
ENSGGOP00000016283  .FPAHKYILAVHSD.FF.QK.LF.......................................................
ENSGGOP00000006469  .FPVHRAILAARCP.FF.KT.LL.......................................................
ENSGGOP00000001665  .-------------.--.--.--.......................................................
ENSGGOP00000018359  .-------------.--.--.--.......................................................
ENSGGOP00000003889  .FPCHKMVLATCSS.YF.SL.LF.......................................................
ENSGGOP00000015569  .FSVPRSKLSQFPD.SL.LW.KE.......................................................
ENSGGOP00000028485  .LYAHKFVLYARCP.LL.IQ.YV.......................................................
ENSGGOP00000016194  .LYAHKFVLYARCP.LL.IQ.YV.......................................................
ENSGGOP00000016383  .FPAHSLVLAGVSQ.QL.GR.--.......................................................
ENSGGOP00000024913  .YGVHRVILAAISS.LF.RD.RL.......................................................
ENSGGOP00000026844  .VQGHVAIVTARSR.WL.RR.KItqarerlaqkleqeatpvpreapgvaagga.........................
ENSGGOP00000025740  .VQGHVAIVTARSR.WL.RR.KItqarerlaqkleqeatpvpreapgvaagga.........................
ENSGGOP00000012961  .FKAHKAVLLARVP.DF.YF.HT.......................................................
ENSGGOP00000019075  .YYTTMQTLTKQDT.ML.KA.MF.......................................................
ENSGGOP00000013869  .-------------.--.--.--.......................................................
ENSGGOP00000013602  .YYTTMQTLTKQDT.ML.KA.MF.......................................................
ENSGGOP00000025575  .LRAHKAVLAARSD.YF.RA.RA.......................................................
ENSGGOP00000012784  .YPVSKRKLIEQSD.YF.RA.LY.......................................................
ENSGGOP00000017129  .LRAHKAVLAARSD.YF.RA.RA.......................................................
ENSGGOP00000006469  .LKAHKAVISARSP.FF.RN.LL.......................................................
ENSGGOP00000020636  .FVVDPSIFTAQPN.TM.LG.RM.......................................................
ENSGGOP00000023818  .FQADRALLVEHCG.FF.RG.LF.......................................................
ENSGGOP00000019810  .-------------.--.--.--.......................................................
ENSGGOP00000020805  .IYAHK-VLKDVCE.HV.HS.LL.......................................................
ENSGGOP00000001787  .------------S.FF.SS.LL.......................................................
ENSGGOP00000015569  .-------------.--.--.--.......................................................
ENSGGOP00000000244  .FVVDPSIFTAQPN.TM.LG.RM.......................................................
ENSGGOP00000004860  .-------------.--.--.--.......................................................
ENSGGOP00000024823  .-------------.--.--.--.......................................................
ENSGGOP00000004247  .VEAHKIVLCAVSH.VF.ML.LFnvksptdiqdssiirttqdlfainrdtafpgashes...................
ENSGGOP00000009548  .-------------.--.--.ML.......................................................
ENSGGOP00000025740  .RPAHKAILAARSR.--.--.--.......................................................

                              60                              70        80                 90       
                               |                               |         |                  |       
d1buoa_               .....H...RNSQH....................YTLDF..LSPKTFQQILEYAYTATLQ....A.....KAE.D...
ENSGGOP00000021168  .....E...DLGMDdegdddp.............VPLPN..VNAAILKKVIQWCT-----....-.....---.-...
ENSGGOP00000013011  .....T...GGMKEsskdv...............VPILG..IEAGIFQILLDFIYTGIVN....I.....GVN.N...
ENSGGOP00000017568  .....T...GGMKEsskdv...............VPILG..IEAGIFQILLDFIYTGIVN....I.....GVN.N...
ENSGGOP00000020454  .....T...GELAEsrqte...............VVIRD..IDERAMELLIDFAYTSQIT....V.....EEG.N...
ENSGGOP00000006907  .....T...GGMREasqdv...............IELKG..VSARGLRHIIDFAYSAEVT....L.....DLD.C...
ENSGGOP00000019565  .....T...GGMREasqdv...............IELKG..VSARGLRHIIDFAYSAEVT....L.....DLD.C...
ENSGGOP00000008956  .....T...SELSEkgkpy...............VDIQG..LTASTMEILLDFVYTETVH....V.....TVE.N...
ENSGGOP00000003626  .....T...NDMMEckqde...............IVMQG..MDPSALEALINFAYNGNLA....I.....DQQ.N...
ENSGGOP00000021128  .....C...NDHREsreml...............VEING..ILAEAMECFLQYVYTGKVK....I.....TTE.N...
ENSGGOP00000007581  .....T...NEMSEsrqth...............VTLHD..IDPQALDQLVQFAYTAEIV....V.....GEG.N...
ENSGGOP00000009888  .....T...SGWNNtekkv...............YNIPG..ISPDMMKLIIEYAYTRTVP....I.....TPD.N...
ENSGGOP00000013848  .....T...GDMSEskakk...............IEIKD..VDGQTLSKLIDYIYTAEIE....V.....TEE.N...
ENSGGOP00000022819  .....T...GDMSEskakk...............IEIKD..VDGQTLSKLIDYIYTAEIE....V.....TEE.N...
ENSGGOP00000017093  .....S...QNSKEtsqptt..............ATFQA..FSPDTFTVILDFVYSGKLS....L.....TGQ.N...
ENSGGOP00000003069  .....S...GGLKEsqdse...............VNFDNs.IHPEVLELLLDYAYSSRVI....I.....NEE.N...
ENSGGOP00000009080  .....E...HEMEEskknr...............VEIND..VEPEVFKEMMCFIYTGKAP....N.....LDK.M...
ENSGGOP00000025902  .....S...GGLKEsqdse...............VNFDNs.IHPEVLELLLDYAYSSRVI....I.....NEE.N...
ENSGGOP00000015894  .....E...HEMEEskknr...............VEIND..VEPEVFKEMMCFIYTGKAP....N.....LDK.M...
ENSGGOP00000007923  .....T...GNLSEkense...............VEFQC..IDETALQAIVEYAYTGTVF....I.....SQD.T...
ENSGGOP00000027254  .....T...GNLSEkense...............VEFQC..IDETALQAIVEYAYTGTVF....I.....SQD.T...
ENSGGOP00000014601  .....V...GQAEDenknv...............LDLHH..VTVTGFIPLLEYAYTATLS....I.....NTE.N...
ENSGGOP00000003676  .....T...ADMKEkfknk...............IKLSG..IHHDILEGLVNYAYTSQIE....I.....TKR.N...
ENSGGOP00000028136  .....E...HEMEEskknr...............VEIND..LDPEVFKEMMRFIYTGRAP....N.....LDK.M...
ENSGGOP00000005663  .....T...TNMLEsksfe...............VELKD..AEPDIIEQLVEFAYTARIS....V.....NSN.N...
ENSGGOP00000027285  .....R...CANSS....................IEIP-..----------------EFP....I.....APE.I...
ENSGGOP00000023551  .....T...SDVCEakqee...............IKMEG..IDPNALWDLVQFAYTGCLE....L.....KED.T...
ENSGGOP00000008891  .....T...SGAVVdqqnv...............YEIDF..VSAEALTALMDFAYTATLT....V.....STA.N...
ENSGGOP00000006683  .....A...GQLREsraer...............VRLHG..VPPDMLQLLLDFSYTGRVA....V.....SGD.N...
ENSGGOP00000014781  .....T...SDVCEakqee...............IKMEG..IDPNALWDLVQFAYTGCLE....L.....KED.T...
ENSGGOP00000015335  .....-...-----....................--FFD..RHPGVFAHILNYYRTGKLH....C.....PAD.V...
ENSGGOP00000026029  .....T...SGAVVdqqnv...............YEIDF..VSAEALTALMDFAYTATLT....V.....STA.N...
ENSGGOP00000000093  .....A...GDFAEsfsar...............VELRD..VEPAVVGQLVDFVYTGRLT....I.....TQG.N...
ENSGGOP00000000958  .....-...-----....................-YYFD..RNPSLFRYVLNFYYTGKLH....V.....MEE.Lc..
ENSGGOP00000012670  .....T...IGMREafqke...............VELIG..ASYIGLKAVVDFLYGGELV....L.....DGG.N...
ENSGGOP00000008243  .....T...AGTLAsqpyv...............YEIDF..VQPEALAAILEFAYTSTLT....I.....TAG.N...
ENSGGOP00000002688  .....E...K---Effydadsg............EYFFD..RDPDMFRHVLNFYRTGRLH....C.....PRQ.E...
ENSGGOP00000017890  .....T...AGTLAsqpyv...............YEIDF..VQPEALAAILEFAYTSTLT....I.....TAG.N...
ENSGGOP00000021385  .....T...GGMKEqdlmc...............IKLHG..VNKVGLKKIIDFIYTAKLS....L.....NMD.N...
ENSGGOP00000028262  .....T...GGMYEsqqas...............VTMHD..VDAESFEVLVDYCYTGRVS....L.....SEA.N...
ENSGGOP00000018004  .....T...NDVREarqee...............IKMEG..VEPNSLWSLIQYAYTGRLE....L.....KED.N...
ENSGGOP00000022121  .....T...NDVREarqee...............IKMEG..VEPNSLWSLIQYAYTGRLE....L.....KED.N...
ENSGGOP00000001618  .....T...NDVREarqee...............IKMEG..VEPNSLWSLIQYAYTGRLE....L.....KED.N...
ENSGGOP00000006123  .....C...SSFREkseak...............VQLKG..IDPPTLDQIVSYVYTGEAR....I.....AAD.N...
ENSGGOP00000022681  .....S...GKMPTkrdsqg..............NCFID..RDGKVFRYILNFLRTSHLD....L.....PED.Fqe.
ENSGGOP00000020951  .....T...SGLTEstqke...............VRIVG..VEAESMDLVLNYAYTSRVI....L.....TEA.N...
ENSGGOP00000010436  .....G...GDFPTardpqg..............NYFID..RDGPLFRYVLNFLRTSELTlp..L.....DFK.E...
ENSGGOP00000002271  .....T...NDLLEakqee...............VRMEG..VDPNALNSLVQYAYTGVLQ....L.....KED.T...
ENSGGOP00000028316  .....T...DQLKCnlsv................INLDPe.INPEGFCILLDFMYTSRLN....L.....REG.N...
ENSGGOP00000027249  .....T...GGMKEqdlmc...............IKLHG..VSKVGLRKIIDFIYTAKLS....L.....NMD.N...
ENSGGOP00000014290  .....L...SEMAEakqtl...............IEIRD..FDGDAIEDLVKFVYSSRLT....L.....TVD.N...
ENSGGOP00000013616  .....T...SNLKEahnrv...............IVLQD..VSESVFQLLVDYIYHGTVK....L.....RAE.E...
ENSGGOP00000015202  .....E...KEFFFnedtk...............EYFFD..RDPEVFRCVLNFYRTGKLH....Y.....PRY.E...
ENSGGOP00000018110  .....T...ADMRErdqdk...............IHLKG..LTATGFSHVLQFMYYGTIE....L.....SMN.T...
ENSGGOP00000023813  .....T...ADMRErdqdk...............IHLKG..LTATGFSHVLQFMYYGTIE....L.....SMN.T...
ENSGGOP00000010458  .....S...HGLREsrddt...............VNFQDn.LHPEVLELLLDFAYSSRIA....I.....NEE.N...
ENSGGOP00000026362  .....C...QADPDldsdkdetg...........AYLID..RDPTYFGPVLNYLRHGKLV....I.....NKD.La..
ENSGGOP00000021245  .....C...QADPDldsdkdetg...........AYLID..RDPTYFGPVLNYLRHGKLV....I.....NKD.La..
ENSGGOP00000017324  .....T...TNMLEsksfe...............VELKD..AEPDIIEQLVEFAYTARIS....V.....NSN.N...
ENSGGOP00000024987  .....C...QGEELqsdrdetg............AYLID..RDPTYFGPILNFLRHGKLV....L.....DKD.Ma..
ENSGGOP00000003648  .....SvaeG---Dqtmnm...............IQLDSevVTAEAFAALIDMMYTSTLM....L.....GES.N...
ENSGGOP00000003210  .....-...-----....................EYFFD..RHPGAFTSILNFYRTGKLH....M.....MEE.M...
ENSGGOP00000027620  .....V...DQKDV....................VHLDI..SNAAGLGQVLEFMYTAKLS....L.....SPE.N...
ENSGGOP00000011768  .....V...DQKDV....................VHLDI..SNAAGLGQVLEFMYTAKLS....L.....SPE.N...
ENSGGOP00000016634  .....C...QGEELqsdrdetg............AYLID..RDPTYFGPILNFLRHGKLV....L.....DKD.Ma..
ENSGGOP00000000318  .....Sl..NEMST....................VSISVi.KNPTVFEQLLSFCYTGRIC....L.....QLA.D...
ENSGGOP00000003104  .....L...SEIDEakkke...............VVLDN..VDPAILDLIIKYLYSASID....L.....NDG.N...
ENSGGOP00000019798  .....-...-----....................---FD..RHPGVFAYVLNYYRTGKLH....C.....PAD.V...
ENSGGOP00000018987  .....T...CGLLEcnqre...............VILYD..ITAESVSVLLNYMYNAALE....I.....NNA.N...
ENSGGOP00000010139  .....C...NDLKEkyekr...............IIIKG..VDAETMHTLLDYTYTSKAL....I.....TKQ.N...
ENSGGOP00000012818  .....-...-----....................--FFD..RHPGVFAYVLNYYRTGKLH....C.....PAD.V...
ENSGGOP00000004716  .....C...QVQKTseqatv..............THLDI..VTAQGFKAIIDFMYSAHLA....L.....TSR.N...
ENSGGOP00000003892  .....E...VNMKErddgs...............VTITN..LSSKAVKAFLDYAYTGKTK....I.....TDD.N...
ENSGGOP00000003130  .....S...LCMVEsgade...............VNLHG..VTSLGLKQALEFAYTGQQTkqilL.....EPG.V...
ENSGGOP00000027759  .....T...ADMK-....................--LSG..IHHDILEGLVNYAYTSQIE....I.....TKR.N...
ENSGGOP00000018742  .....I...HYIQDsgrhst..............ASLDI..VTSDAFSIILDFLYSGKLD....L.....CGE.N...
ENSGGOP00000022777  .....I...HYIQDsgrhst..............ASLDI..VTSDAFSIILDFLYSGKLD....L.....CGE.N...
ENSGGOP00000018018  .....I...HYIQDsgrhst..............ASLDI..VTSDAFSIILDFLYSGKLD....L.....CGE.N...
ENSGGOP00000011052  .....A...LSTMSg...................LSISVi.KNPNVFEQLLSFCYTGRMS....L.....QLK.D...
ENSGGOP00000001903  .....T...NGLREqgmev...............VSIEG..IHPKVMERLIEFAYTASIS....M.....GEK.C...
ENSGGOP00000013383  .....C...CQEDPeldsdkdetg..........AYLID..RDPTYFGPILNYLRHGKLI....I.....TKE.La..
ENSGGOP00000016766  .....Ll..KNSRR....................IVLPDv.MNPRVFENILLSSYTGRLV....M.....PAP.E...
ENSGGOP00000005968  .....L...AEPERage.................LHLEE..VSPDVVAQVLHYLYTSEIA....L.....DEA.S...
ENSGGOP00000002752  .....-...-----....................-FYFD..RNPELFPYVLHFYHTGKLH....V.....MAE.-...
ENSGGOP00000011719  .....S...PKRDTandlakdskg..........RFFID..RDGFLFRYILDYLRDRQVV....L.....PDH.Fpe.
ENSGGOP00000025363  .....K...DQLDKrdi.................VHLNSdiVTAPAFALLLEFMYEGKLQ....F.....KDL.P...
ENSGGOP00000027450  .....-...-----....................---FD..RHPGVFAYVLNYYRTGKLH....C.....PAD.V...
ENSGGOP00000022683  .....R...GRAGVgvdv................LSLPGg.PEARGFAPLLDFMYTSRLR....L.....SPA.T...
ENSGGOP00000009560  .....R...GRAGVgvdv................LSLPGg.PEARGFAPLLDFMYTSRLR....L.....SPA.T...
ENSGGOP00000019691  .....N...GGMATtsae................IELPD..VEPAAFLALLRFLYSDEVQ....I.....GPE.T...
ENSGGOP00000002738  .....K...SHTQEsrarv...............IHLHV..PSAAGLQRLLDFIYTAWLS....L.....SMD.T...
ENSGGOP00000000386  .....S...GNSKSa...................FELPGs.VPPACFQQILSFCYTGRLT....M.....TAS.E...
ENSGGOP00000028415  .....N...NSRSAv...................VELPAa.VQPQSFQQILSFCYTGRLS....M.....NVG.D...
ENSGGOP00000013223  .....-...---KQ....................HYFID..RDGQMFRYILNFLRTSKLL....I.....PDD.Fkd.
ENSGGOP00000012188  .....V...GQTKNdlv.................VSLPEe.VTARGFGPLLQFAYTAKLL....L.....SRE.N...
ENSGGOP00000020804  .....S...PSSPQlprdsra.............RFFID..RDGFLFRYVLDYLRDKQLA....L.....PEH.Fpe.
ENSGGOP00000000312  .....H...RNSQH....................YTLDF..LSPKTFQQILEYAYTATLQ....A.....KAE.D...
ENSGGOP00000022687  .....-...-----....................---FD..RHPGVFAYVLNYYRTGKLH....C.....PAD.V...
ENSGGOP00000009356  .....-...---KQ....................HYFID..RDGEIFRYVLSFLRTSKLL....L.....PDD.Fkd.
ENSGGOP00000019989  .....S...GNSKSa...................FELPGs.VPPACFQQILSFCYTGRLT....M.....TAS.E...
ENSGGOP00000019033  .....R...STSENn...................VFLDQsqVKADGFQKLLEFIYTGTLN....L.....DSW.N...
ENSGGOP00000015316  .....V...NGKILcpfdadg.............HYFID..RDGLLFRHVLNFLRNGELL....L.....PEG.Fre.
ENSGGOP00000019165  .....R...STSENn...................VFLDQsqVKADGFQKLLEFIYTGTLN....L.....DSW.N...
ENSGGOP00000020430  .....T...SPR-Ainn.................LVLQG..CSSIGLRLVLEYLYTANVT....L.....SLD.T...
ENSGGOP00000017084  .....C...FSNKEspnqnnt.............THLDI..AAVQGFSVILDFLYSGNLV....L.....TSQ.N...
ENSGGOP00000003820  .....-...-----....................---FD..RHPGVFAYVLNYYRTGKLH....C.....PAD.V...
ENSGGOP00000012694  .....F...QNSSSqkndv...............FHLDV..KNVSGIGQILDFMYTSHLD....L.....NQD.N...
ENSGGOP00000015147  .....C...FSNKEspnqnnt.............THLDI..AAVQGFSVILDFLYSGNLV....L.....TSQ.N...
ENSGGOP00000025230  .....T...SPR-Ainn.................LVLQG..CSSIGLRLVLEYLYTANVT....L.....SLD.T...
ENSGGOP00000002975  .....N...SDSDPhgish...............VKFDD..LNPEAVEVLLNYAYTAQLK....A.....DKE.L...
ENSGGOP00000024277  .....-...---KQ....................HYFID..RDGQMFRYILNFLRTSKLL....I.....PDD.Fkd.
ENSGGOP00000027576  .....-...---KQ....................HYFID..RDGQMFRYILNFLRTSKLL....I.....PDD.Fkd.
ENSGGOP00000018927  .....K...ERELDkrdl................VCIHNeiVTAPAFGLLLDFMYAGQLT....L.....RGD.Tp..
ENSGGOP00000008276  .....-...-----....................-YFFD..RSSQAFRYVLHYYRTGRLHv...M.....EQL.C...
ENSGGOP00000011444  .....K...ERELDkrdl................VCIHNeiVTAPAFGLLLDFMYAGQLT....L.....RGD.Tp..
ENSGGOP00000000831  .....-...-----....................--FFD..RNPGAFGTILTFLRAGKLR....L.....LRE.-...
ENSGGOP00000005906  .....L...HDNLIn...................LDTDM..VSSTVFQQILDFIYTGKLL....P.....SDQ.Paep
ENSGGOP00000016758  .....A...GGSRE....................LEMHT..ISSKVFGDILDFAYTSRIV....V.....RLE.S...
ENSGGOP00000002243  .....Y...GGMREsqpeae..............IPLQD..TTAEAFTMLLKYIYTGRAT....L.....TDE.Keev
ENSGGOP00000007459  .....Y...GDLAEvkse................IHIPD..VEPAAFLILLKYMYSDEID....L.....EAD.T...
ENSGGOP00000009697  .....L...LGDAPr...................LTLPSv.IEADAFEGLLQLIYSGRLR....L.....PLD.A...
ENSGGOP00000012961  .....S...GCWAEssqey...............VTLQG..ISHVELNVMMHFIYGGTLD....I.....PDKtN...
ENSGGOP00000000656  .....-...-----....................----D..RNRPSFDAILYY-------....-.....---.-...
ENSGGOP00000027474  .....L...NTGLDaart................YVVDF..ITPANFEKVLSFVYTSELF....T.....DLI.N...
ENSGGOP00000011420  .....-...-----....................-YFFD..RNRPSFDAILYY-------....-.....---.-...
ENSGGOP00000021753  .....-...-----....................EYFFD..RNRPSFDAILYYY------....-.....---.-...
ENSGGOP00000001534  .....-...----Edsq.................EFFFD..RSPSAFGVIVSFLAAGKLV....L.....LQE.M...
ENSGGOP00000006456  .....Ll..KGMTS....................ISLPSv.MDPGAFETVLASAYTGRLS....M.....AAA.D...
ENSGGOP00000002216  .....Q...EFTQEpl..................VEIEG..VSKMAFRHLIEFTYTAKLM....Iq....GEE.E...
ENSGGOP00000000423  .....A...EEGEIgqsi................YMLEG..MVADTFGILLEFIYTGYLH....A.....SEK.S...
ENSGGOP00000019822  .....V...GQADGeln.................ITLPEe.VTVKGFEPLIQFAYTAKLI....L.....SKE.N...
ENSGGOP00000005961  .....V...GQADGeln.................ITLPEe.VTVKGFEPLIQFAYTAKLI....L.....SKE.N...
ENSGGOP00000009230  .....N...GGMATtsae................IELPD..VEPAAFLALLRFLYSDEVQ....I.....GPE.T...
ENSGGOP00000013547  .....Q...RSVQDsgqggrekle..........LVLSN..LQADVLELLLEFVYTGSLV....I.....DSA.N...
ENSGGOP00000024337  .....-...-----....................EYFFD..RNRPSFDAILYY-------....-.....---.-...
ENSGGOP00000007168  .....-...-----....................EYFFD..RNRPSFDAILYY-------....-.....---.-...
ENSGGOP00000027718  .....Y...GELAEdkde................IRIPD..VEPAAFLAMLKYIYCDEID....L.....AAD.T...
ENSGGOP00000020218  .....Y...GELAEdkde................IRIPD..VEPAAFLAMLKYIYCDEID....L.....AAD.T...
ENSGGOP00000026600  .....L...LGYSD....................IEIPSv.VSVQSVQKLIDFMYSGVLR....V.....SQS.E...
ENSGGOP00000019480  .....V...HDNLLn...................LDHDM..VSPAVFRLVLDFIYTGRLA....D.....GAE.Aaaa
ENSGGOP00000004482  .....S...GRMEVltdkeg..............WILID..RCGKHFGTILNYLRDDTIT....L.....PQN.Rqe.
ENSGGOP00000018737  .....K...KLEVDsssv................IEIDF..LRSDIFEEVLNYMYTAKIS....V.....KKE.D...
ENSGGOP00000011744  .....-...-----....................-----..R------------------....-.....---.-...
ENSGGOP00000018938  .....K...KLEVDsssv................IEIDF..LRSDIFEEVLNYMYTAKIS....V.....KKE.D...
ENSGGOP00000013101  .....T...EGGGGavmgaggsgtaaggagagv.CELDF..VGPEALGALLEFAYTATLT....T.....SSA.N...
ENSGGOP00000001595  .....D...GRDQEfkmvgg..............QIFVD..RDGDLFSFILDFLRTHQLLlp..T.....DFS.D...
ENSGGOP00000000227  .....-...-----....................EYFFD..RDPAVFQLVYNFYLSGVLL....V.....LDE.-...
ENSGGOP00000027568  .....-...-----....................-YFFD..RNRPSFDAILYYY------....-.....---.-...
ENSGGOP00000010747  .....I...EKGAVssheav..............VDLSG..FCKASFLPLLEFAYTSVLS....F.....DFC.S...
ENSGGOP00000020080  .....Y...WDLAEvkse................IHIPD..VEPAAFLILLKYVYSDEID....L.....EAD.T...
ENSGGOP00000014177  .....S...GRHYIptdseg..............RYFID..RDGTHFGDVLNFLRSGDLP....-.....PRE.R...
ENSGGOP00000002953  .....-...-----....................--YFD..RHPGFFLSLLHFYRTGHLHv...L.....DEL.C...
ENSGGOP00000023230  .....-...-----....................--YFD..RHPGFFLSLLHFYRTGHLHv...L.....DEL.C...
ENSGGOP00000016398  .....K...KDPSTqr..................VDLND..ISPLGLATVIAYAYTGKLT....L.....SLY.T...
ENSGGOP00000007622  .....Q...SYWNEdmkev...............IEIDQ..FSYPVYRAFLQYLYTDTVD....L.....PPE.D...
ENSGGOP00000016123  .....T...NKENEsqtv................FQLDF..CEPDAFDNVLNYIYSSSLF....V.....EKS.S...
ENSGGOP00000004395  .....K...DKGVWgnkqdhrg............AFLID..RSPEYFEPILNYLRHGQLI....V.....NDGiN...
ENSGGOP00000017862  .....Q...SYWNEdmkev...............IEIDQ..FSYPVYRAFLQYLYTDTVD....L.....PPE.D...
ENSGGOP00000008219  .....F...DSMRN....................EYFFD..RNRPSFDGIL---------....-.....---.-...
ENSGGOP00000013219  .....-...----Aeg..................RFFID..RPSTYFRPILDYLRTGQVP....-.....-TQ.H...
ENSGGOP00000022519  .....D...NTDTIs...................IDASV..VSPEEFALLLEMMYTGKLP....V.....GKH.N...
ENSGGOP00000009774  .....D...NTDTIs...................IDASV..VSPEEFALLLEMMYTGKLP....V.....GKH.N...
ENSGGOP00000015247  .....S...GRVEVltdagg..............WVLID..RSGRHFGTILNYLRDGSVP....L.....PES.Tre.
ENSGGOP00000024010  .....S...GRVEVltdagg..............WVLID..RSGRHFGTILNYLRDGSVP....L.....PES.Tre.
ENSGGOP00000019246  .....S...GRVEVltdagg..............WVLID..RSGRHFGTILNYLRDGSVP....L.....PES.Tre.
ENSGGOP00000016080  .....M...NHQHStaq.................LNLSNmkISAECFDLILQFMYLGKIM....T.....APS.S...
ENSGGOP00000007297  .....S...SNDMKtadelfit............IDTSY..LSPVTVDQLLDYFYSGKVV....I.....SEQ.N...
ENSGGOP00000024948  .....S...SNDMKtadelfit............IDTSY..LSPVTVDQLLDYFYSGKVV....I.....SEQ.N...
ENSGGOP00000027215  .....W...SHTICisshv...............LELDD..LKAEVFTEILNYIYSSTVV....Vk....RQE.T...
ENSGGOP00000025289  .....L...LNPSSelq.................VSLM-..HSARIVADLLLSCYTGALE....F.....AVR.D...
ENSGGOP00000004247  .....N...GNYMEaksvl...............IPVYG..VSKETFLSFLEYLYTDSCCp...A.....GIF.Q...
ENSGGOP00000015257  .....L...LNPSSelq.................VSLM-..HSARIVADLLLSCYTGALE....F.....AVR.D...
ENSGGOP00000022917  .....W...SHTICisshv...............LELDD..LKAEVFTEILNYIYSSTVV....Vk....RQE.T...
ENSGGOP00000000174  .....D...TKWKGksvvv...............L--RHplINPVAFGALLQYLYTGRLD....I.....GVE.H...
ENSGGOP00000027797  .....T...VKIMPknkkv...............VVIRV..DDKWNLQIQVDRSYIARIS....I.....FKT.N...
ENSGGOP00000006679  .....G...DGSGGs...................VVLPA..GFAEIFGLLLDFFYTGHLA....L.....TSG.N...
ENSGGOP00000020540  .....S...SKPTNdgtc................IEIGY..VKYSIFQLVMQYLYYGGPEsll.I.....KNN.E...
ENSGGOP00000009305  .....-...-----....................---FD..RDPDAFKCVIEVYYFGEVH....M.....KK-.-...
ENSGGOP00000026924  .....G...TEPGPgvpsp...............VVLST..VPTEAFLAVLEFLYTNSVK....L.....HRH.S...
ENSGGOP00000017487  .....R...RRPAElprdsra.............RFFID..RDGFLFRYVLDYLRDKQLA....L.....PEH.Fpe.
ENSGGOP00000006549  .....S...SKPTNdgtc................IEIGY..VKYSIFQLVMQYLYYGGPEsll.I.....KNN.E...
ENSGGOP00000014191  .....L...LTQSKh...................VRITIl.QSAEVGRKLLLSCYTGALE....V.....KRK.E...
ENSGGOP00000011572  .....I...HQTSEcik.................IQPTD..IQPDIFSYLLHIMYTGK--....-.....---.-...
ENSGGOP00000014231  .....T...NKSEQdgdsskt.............IEISD..MKYHIFQMMMQYLYYGGTEsme.I.....PTA.D...
ENSGGOP00000009396  .....-...-----....................-----..CYPKHAKACMYFTYKVHYS....N.....SSA.Eipe
ENSGGOP00000000174  .....D...DHFQEseepatsggppa........VTLHG..ISPDVFTHVLYYVYSDHTE....L.....SPE.A...
ENSGGOP00000004210  .....E...DNEDDi...................VEMSE..FSYPVYRAFLEYLYTDSIS....L.....SPE.E...
ENSGGOP00000018481  .....E...DNEDDi...................VEMSE..FSYPVYRAFLEYLYTDSIS....L.....SPE.E...
ENSGGOP00000014767  .....Ll..NDSRE....................VKISIl.QSSEVGRQLLLSCYSGVLE....F.....PEM.E...
ENSGGOP00000010269  .....V...HQTSEcvr.................LKPTD..IQPDIFSYLLHLMYTGKMA....P.....QL-.-...
ENSGGOP00000015462  .....V...WSRRPiksse...............VKIRG..VKQNAMCLLISFKYTSRII....P.....CVM.N...
ENSGGOP00000001664  .....-...----E....................-----..-------------------....-.....---.-...
ENSGGOP00000019862  .....L...NEKSVdgtrtn..............VYLNE..VQVADFASFLEFVYTAKVQ....V.....EED.R...
ENSGGOP00000002153  .....-...-----....................-----..----------------EFP....I.....APE.I...
ENSGGOP00000026844  .....R...SFMPEdgqvn...............ISIGEmvPSRQAFESMLRYIYYGEVN....M.....PPE.Dslr
ENSGGOP00000019651  .....S...KNPSTdv..................VTLDH..VTHSVFQHLLEFLYTSEFF....V.....YKY.E...
ENSGGOP00000004745  .....S...KNPSTdv..................VTLDH..VTHSVFQHLLEFLYTSEFF....V.....YKY.E...
ENSGGOP00000010052  .....S...VAGQV....................VELSF..IRAEIFAEILNYIYSSKIVr...V.....RSD.L...
ENSGGOP00000017655  .....S...VAGQV....................VELSF..IRAEIFAEILNYIYSSKIVr...V.....RSD.L...
ENSGGOP00000023577  .....V...HDNLLn...................LDHDM..VSPAVFRLVLDFIYTGRL-....-.....---.-...
ENSGGOP00000018343  .....S...SPPRV....................LELPG..VPAAAFSDVLNFIYSARLA....L.....PGG.Ggdg
ENSGGOP00000015994  asppaS...SPPRV....................LELPG..VPAAAFSDVLNFIYSARLA....L.....PGG.Ggdg
ENSGGOP00000013731  .....S...GRFPLktdesg..............ACVID..RDGRLFKYLLDYLH-GEVQip..T.....DEQ.T...
ENSGGOP00000026531  .....S...GRFPLktdesg..............ACVID..RDGRLFKYLLDYLH-GEVQip..T.....DEQ.T...
ENSGGOP00000025953  .....S...SSWIEasscaa..............LEMP-..IHSDILKVILDYLYTDEAV....VikesqNVD.F...
ENSGGOP00000016283  .....S...SSWIEasscaa..............LEMP-..IHSDILKVILDYLYTDEAV....VikesqNVD.F...
ENSGGOP00000028113  .....T...QNKQLqrve................LSLEA..LAPGGLQQILNFIYTSKLL....V.....NAA.N...
ENSGGOP00000011861  .....-...----Wgnkqdhrg............AFLID..RSPVYFEPILNYLRHGQLI....V.....NDGiN...
ENSGGOP00000021684  .....A...AGRPErgpavvpvvpvapeap....GTSPA..GTAAALAVVLDYVYGAGVR....L.....RAE.De..
ENSGGOP00000026738  .....L...LNPSSe...................LQVSL..MHSARIVALLLSCYTGTLE....F.....AVR.D...
ENSGGOP00000010504  .....S...GRISTlkdetg..............AIFID..RDPTVFAPILNFLRTKELD....P.....RGV.H...
ENSGGOP00000015447  .....V...PVVPVapeap...............GTSPA..GTAAALAVVLDYVYGAGVR....L.....RAE.De..
ENSGGOP00000021637  .....-...----Wgnkqdhrg............AFLID..RSPVYFEPILNYLLCGQLI....V.....NNGiN...
ENSGGOP00000020123  .....Q...RERPAqgrkvv..............LELGG..LKISTLRKLVDFLYTSEME....V.....SQE.E...
ENSGGOP00000007552  .....N...GGMATtste................IELPD..VEPAAFLALLKFLYSDEVQ....I.....GPE.T...
ENSGGOP00000001760  .....T...-----....................-----..-------------------....-.....---.-...
ENSGGOP00000003407  .....F...GPGREynftrpnekgey........EIAEG..ISATVFRTVLDYYKTGIIN....C.....PDG.Is..
ENSGGOP00000015569  .....-...-----....................--LIH..GDGQMFRHILNFLRLGKLF....L.....PSE.F...
ENSGGOP00000024001  .....E...NLGMDdegdndp.............VPLPN..VNAAIL-------------....-.....---.-...
ENSGGOP00000016642  .....S...NQSEAv...................LQEPR..DCAAVFDKFIRYLYCGELT....L.....LLT.Q...
ENSGGOP00000020138  .....L...SSTKE....................LDLSD..ANPEVTMTMLRWIYTDELE....F.....RED.Dvf.
ENSGGOP00000002005  .....L...SSTKE....................LDLSD..ANPEVTMTMLRWIYTDELE....F.....RED.Dvf.
ENSGGOP00000025953  .....L...SDGNTseftdiyqkdedsagchl..FVVEK..VHPDMFEYLLQFIYTDTCD....-.....---.-...
ENSGGOP00000016283  .....L...SDGNTseftdiyqkdedsagchl..FVVEK..VHPDMFEYLLQFIYTDTCD....-.....---.-...
ENSGGOP00000006469  .....S...SSPEYgaeiimd.............INTAG..IDMPMFSALLHYLYTGEFG....M.....EDS.R...
ENSGGOP00000001665  .....-...-----....................-YFID..RDGKAFRHILNFLRLGRLD....L.....PRG.Yge.
ENSGGOP00000018359  .....-...-----....................-YFID..RDGKAFRHILNFLRLGRLD....L.....PRG.Yge.
ENSGGOP00000003889  .....F...NGSYRqdrfhltfqqillalytivvFVFIS..ANITQCKHFFTQLYTTICK....L.....SVE.Dvlq
ENSGGOP00000015569  .....A...SALTSsesq................RLFID..RDGSTFRHVHYYLYTSKLS....F.....SSC.A...
ENSGGOP00000028485  .....N...NEGFSavedgvltqr..........VLLGD..VSTEAARTFLHYLYTADTG....L.....PPG.L...
ENSGGOP00000016194  .....N...NEGFSavedgvltqr..........VLLGD..VSTEAARTFLHYLYTADTG....L.....PPG.L...
ENSGGOP00000016383  .....-...-RGQW....................ALGEG..ISPSTFAQLLNFVYGESVE....L.....QPG.E...
ENSGGOP00000024913  .....L...GGGGPrpp.................FSL-E..VSPGGWEAVLTFAYEGV--....L.....GPA.S...
ENSGGOP00000026844  .....R...----Ppllh................VAIRE..AEARPFEVLMQFLYTDKIK....Y.....PRK.Ghve
ENSGGOP00000025740  .....R...----Ppllh................VAIRE..AEARPFEVLMQFLYTDKIK....Y.....PRK.Ghve
ENSGGOP00000012961  .....I...GQTSNsltnqep.............IAVEN..VEALEFRTFLQIIYSSNRN....-.....---.-...
ENSGGOP00000019075  .....S...GRMEVltdseaw.............ALLPS..M-TMLFGKILKYLRAFKLP....L.....K--.-...
ENSGGOP00000013869  .....-...-----....................IELEG..ISVMVMREILDYIFSGQIR....L.....NED.T...
ENSGGOP00000013602  .....S...GRMEV....................-----..-------------------....-.....---.-...
ENSGGOP00000025575  .....S...RDV--....................LRVQG..VSLTALRLLLADAYSGR--....-.....---.-...
ENSGGOP00000012784  .....R...SGMREalsqeaggpev.........QQLRG..LSAPGLRLVLDFINAGGAR....E.....GWL.Lgpr
ENSGGOP00000017129  .....S...RDV--....................LRVQG..VSLTALRLLLADAYSGR--....-.....---.-...
ENSGGOP00000006469  .....Q...RRIRTgeeitdrtlrtptr......IILDEsiIPKKYAKVILHCMYTDVVD....L.....SVL.Hcsp
ENSGGOP00000020636  .....F...GSGREhnftrpnekgey........EVAEG..IGSTVFRAILLYFRDGVLX....-.....---.-...
ENSGGOP00000023818  .....R...SGMREtraae...............VRLGV..LSAGGFRATLQVLRGDRPA....L.....AAE.-...
ENSGGOP00000019810  .....-...-----....................LVLQG..CSSIGLRLVLEYLYTANVT....L.....SLD.T...
ENSGGOP00000020805  .....E...GNEDVi...................VEMSE..FSYSVYWAFLEYLHTNSIS....L.....SPQ.E...
ENSGGOP00000001787  .....S...GRISTlrdetgal............KVFSH..CDPIHMFPVLDNLH-HLFL....C.....RGV.S...
ENSGGOP00000015569  .....-...----Et...................VALIE..CECSEFRFIVNFLRSQKIL....Lpd...NFS.N...
ENSGGOP00000000244  .....F...GSGREhnftrpnekgey........EVAEG..IGSTVFRAILALM------....-.....---.-...
ENSGGOP00000004860  .....-...-----....................----DplVTKVAFATALKNLYMSEVE....I.....NLE.D...
ENSGGOP00000024823  .....-...-----....................----DplVTKVAFATALKNLYMSEVE....I.....NLE.D...
ENSGGOP00000004247  .....S...GNPPLr...................VIVKDa.LFCSCLSDILRFIYSGA--....-.....---.-...
ENSGGOP00000009548  .....L...SGMREsqgte...............VSLRT..ISTQDLRLLVSFAYSGVVR....A.....RWP.G...
ENSGGOP00000025740  .....-...-----....................-----..-------------------....-.....---.-...

                                                            100       110       120                 
                                                              |         |         |                 
d1buoa_               ..................................LDDLLYAAEILEIEYLEEQCLKMLE---tiq.............
ENSGGOP00000021168  ..................................----------------------------hhkddp..........
ENSGGOP00000013011  ..................................VQELIIAADMLQLTEVVHLCCEFLK---g...............
ENSGGOP00000017568  ..................................VQELIIAADMLQLTEVVHLCCEFLK---g...............
ENSGGOP00000020454  ..................................VQTLLPAACLLQLAEIQEACCEFLK---r...............
ENSGGOP00000006907  ..................................VQDVLGAAVFLQMLPVVELCEEFL----k...............
ENSGGOP00000019565  ..................................VQDVLGAAVFLQMLPVVELCEEFL----k...............
ENSGGOP00000008956  ..................................VQELLPAACLLQLKGVKQACCEFLE---s...............
ENSGGOP00000003626  ..................................VQSLLMGASFLQLQSIKDACCTFLR---e...............
ENSGGOP00000021128  ..................................VQYLFETSSLFQISVLRDACAKFLE---e...............
ENSGGOP00000007581  ..................................VQTLLPAASLLQLNGVRDACCKFLL---s...............
ENSGGOP00000009888  ..................................VEKLLAAADQFNIMGIVRGCCEFLK---s...............
ENSGGOP00000013848  ..................................VQVLLPAASLLQLMDVRQNCCDFLQ---s...............
ENSGGOP00000022819  ..................................VQVLLPAASLLQLMDVRQNCCDFLQ---s...............
ENSGGOP00000017093  ..................................VIEVMSAASFLQMTDVISVCKTFIK---s...............
ENSGGOP00000003069  ..................................AESLLEAGDMLEFQDIRDACAEFLEK--................
ENSGGOP00000009080  ..................................ADDLLAAADKYALERLKVMCEDALCS--................
ENSGGOP00000025902  ..................................AESLLEAGDMLEFQDIRDACAEFLEK--................
ENSGGOP00000015894  ..................................ADDLLAAADKYALERLKVMCEDALCS--................
ENSGGOP00000007923  ..................................VESLLPAANLLQIKLVLKECCAFLE---s...............
ENSGGOP00000027254  ..................................VESLLPAANLLQIKLVLKECCAFLE---s...............
ENSGGOP00000014601  ..................................IIDVLAAASYMQMFSVASTCSEFMK---s...............
ENSGGOP00000003676  ..................................VQSLLEAADLLQFLSVKKACERFLV---r...............
ENSGGOP00000028136  ..................................ADNLLAAADKYALERLKVMCEEALCS--................
ENSGGOP00000005663  ..................................VQSLLDAANQYQIEPVKKMCVDFLKE--................
ENSGGOP00000027285  ..................................VLELLMAANFLD----------------c...............
ENSGGOP00000023551  ..................................IENLLAAACLLQLPQVVEVCCHFLMK--................
ENSGGOP00000008891  ..................................VGDILSAARLLEIPAVSHVCADLL----d...............
ENSGGOP00000006683  ..................................AEPLLRAADLLQFPAVKEACGAFLQ---q...............
ENSGGOP00000014781  ..................................IENLLAAACLLQLPQVVEVCCHFLMK--................
ENSGGOP00000015335  ..................................CG--------------------------plyeeelafwgidetd
ENSGGOP00000026029  ..................................VGDILSAARLLEIPAVSHVCADLL----d...............
ENSGGOP00000000093  ..................................VEALTRTAARLHFPSVQKVCGRYLQ---q...............
ENSGGOP00000000958  ..................................VFSFCQEIEYWGINEL------------fidsccsnryqerkee
ENSGGOP00000012670  ..................................IDYVLETAHLLQIWTVVDFCCEYLE---q...............
ENSGGOP00000008243  ..................................VKHILNAARMLEIQCIVNVCLEIM----................
ENSGGOP00000002688  ..................................CI--------------------------qafdeelafyglvpel
ENSGGOP00000017890  ..................................VKHILNAARMLEIQCIVNVCLEIM----................
ENSGGOP00000021385  ..................................LQDTLEAASFLQILPVLDFCKVFLI---s...............
ENSGGOP00000028262  ..................................VQRLYAASDMLQLEYVREACASFLA---r...............
ENSGGOP00000018004  ..................................IECLLSTACLLQLSQVVEACCKFLMK--................
ENSGGOP00000022121  ..................................IECLLSTACLLQLSQVVEACCKFLMK--................
ENSGGOP00000001618  ..................................IECLLSTACLLQLSQVVEACCKFLMK--................
ENSGGOP00000006123  ..................................VLPMMEAASMLQFPKLFEACSSYLQ---s...............
ENSGGOP00000022681  ..................................MGLLRREADFYQVQPLIEALQ-------ekevel..........
ENSGGOP00000020951  ..................................VQALFTAASIFQIPSIQDQCAKYMI---s...............
ENSGGOP00000010436  ..................................FDLLRKEADFYQIEPLIQ----------cln.............
ENSGGOP00000002271  ..................................IESLLAAACLLQLTQVIDVCSNFLIK--................
ENSGGOP00000028316  ..................................IMAVMATAMYLQMEHVVDTCRKFI----k...............
ENSGGOP00000027249  ..................................LQDTLEAASFLQILPVLDFCKVFLI---s...............
ENSGGOP00000014290  ..................................VQPLLYAACILQVELVARACCEYM----k...............
ENSGGOP00000013616  ..................................LQEIYEVSDMYQLTSLFEECSRFL----a...............
ENSGGOP00000015202  ..................................CI--------------------------sayddelafygilpei
ENSGGOP00000018110  ..................................VHEILQAAMYVQLIEVVKFCCSFL----l...............
ENSGGOP00000023813  ..................................VHEILQAAMYVQLIEVVKFCCSFL----l...............
ENSGGOP00000010458  ..................................AESLLEAGDMLQFHDVRDAAAEFLEK--................
ENSGGOP00000026362  ..................................EEGVLEEAEFYNITSLIKLVKDKIR---erdsk...........
ENSGGOP00000021245  ..................................EEGVLEEAEFYNITSLIKLVKDKIR---erdsk...........
ENSGGOP00000017324  ..................................VQSLLDAANQYQIEPVKKMCVDFLKE--................
ENSGGOP00000024987  ..................................EEGVLEEAEFYNIGPLIRIIKDRMEE--kd..............
ENSGGOP00000003648  ..................................VMDVLLAASHLHLNSVVKACKHYL----t...............
ENSGGOP00000003210  ..................................----------------------------calsfgqeldywgide
ENSGGOP00000027620  ..................................VDDVLAVATFLQMQDIITAC--------h...............
ENSGGOP00000011768  ..................................VDDVLAVATFLQMQDIITAC--------h...............
ENSGGOP00000016634  ..................................EEGVLEEAEFYNIGPLIRIIKDRMEE--kd..............
ENSGGOP00000000318  ..................................IISYLTAASFLQMQHIIDKCTQIL----................
ENSGGOP00000003104  ..................................VQDIFALASRFQIPSVFTVCVSYLQK--................
ENSGGOP00000019798  ..................................CG--------------------------plfeeeltfwgidetd
ENSGGOP00000018987  ..................................VQTVAMAAYFMQMEEVFSVCQKYMMD--................
ENSGGOP00000010139  ..................................VQRVLEAANLFQFLRMVDACASFLT---e...............
ENSGGOP00000012818  ..................................CG--------------------------plfeeeltfwgidetd
ENSGGOP00000004716  ..................................VIEVMSAASFLQMTDIVQACHDFI----k...............
ENSGGOP00000003892  ..................................VEMFFQLSSFLQVSFLSKACSDFLIK--................
ENSGGOP00000003130  ..................................IQDVLAAGSHLQLLELLNLCSHYLIQ--................
ENSGGOP00000027759  ..................................VQSLLEAADLLQFLSVKKACERFLVRHL................
ENSGGOP00000018742  ..................................VIEVMSAASYLQMNDVVNFCKTYI----r...............
ENSGGOP00000022777  ..................................VIEVMSAASYLQMNDVVNFCKTYI----r...............
ENSGGOP00000018018  ..................................VIEVMSAASYLQMNDVVNFCKTYI----r...............
ENSGGOP00000011052  ..................................VVSFLTAASFLQMQCVIDKCTQIL----e...............
ENSGGOP00000001903  ..................................VLHVMNGAVMYQIDSVVRACSDFLV---q...............
ENSGGOP00000013383  ..................................EEGVLEEAEFYNIASLVRLVKERIR---dne.............
ENSGGOP00000016766  ..................................IVSYLTAASFLQMWHVVDKCTEVL----e...............
ENSGGOP00000005968  ..................................VQDLFAAAHRFQIPSIFTICVSFLQK--r...............
ENSGGOP00000002752  ..................................----------------------------lcvfsfsqeieywgin
ENSGGOP00000011719  ..................................KGRLKREAEYFQLPDLVKL---------lt..............
ENSGGOP00000025363  ..................................IEDVLAAASYLHMYDIVKVCKKKLK---e...............
ENSGGOP00000027450  ..................................C---------------------------gplfeeeltfwgidet
ENSGGOP00000022683  ..................................APAVLAAATYLQMEHVVQACHRFI----q...............
ENSGGOP00000009560  ..................................APAVLAAATYLQMEHVVQACHRFI----q...............
ENSGGOP00000019691  ..................................VMTTLYTAKKYAVPALEAHCVEFLTKHL................
ENSGGOP00000002738  ..................................VEDTLEAASYLQVTEALGLCGRYLE---r...............
ENSGGOP00000000386  ..................................QLVVMYTAGFLQIQHIVERG--------tdlm............
ENSGGOP00000028415  ..................................QFLLMYTAGFLQIQEIMEKGTE------ff..............
ENSGGOP00000013223  ..................................YTLLYEEAKYFQLQPMLL----------emerwkq.........
ENSGGOP00000012188  ..................................IREVIRCAEFLRMHNLEDSCFSFLQT--q...............
ENSGGOP00000020804  ..................................KERLLREAEYFQLTDLVKLL--------spkvtkq.........
ENSGGOP00000000312  ..................................LDDLLYAAEILEIEYLEEQCLKIL----e...............
ENSGGOP00000022687  ..................................C---------------------------gplfeeelafwgidet
ENSGGOP00000009356  ..................................FSLLYEEARYYQLQPMVRELER------wqqeqe..........
ENSGGOP00000019989  ..................................QLVVMYTAGFLQIQHIVERG--------tdlm............
ENSGGOP00000019033  ..................................VKEIHQAADYLKVEEVVTKC--------k...............
ENSGGOP00000015316  ..................................NQLLAQEAEFFQLKGLAE----------evksrwek........
ENSGGOP00000019165  ..................................VKEIHQAADYLKVEEVVTKC--------k...............
ENSGGOP00000020430  ..................................VEEVLSVSKILHIPQVTKLCVQFLNDQI................
ENSGGOP00000017084  ..................................AIEVMTVASYLQMSEVVQTCRNFIK---d...............
ENSGGOP00000003820  ..................................C---------------------------gplfeeelafwgidet
ENSGGOP00000012694  ..................................IQVMLDTAQCLQVQNVLSLCHTFLK---s...............
ENSGGOP00000015147  ..................................AIEVMTVASYLQMSEVVQTCRNFIK---d...............
ENSGGOP00000025230  ..................................VEEVLSVSKILHIPQVTKLCVQFLNDQI................
ENSGGOP00000002975  ..................................VKDVYSAAKKLKMDRVKQVCGDYLL---s...............
ENSGGOP00000024277  ..................................YTLLYEEAKYFQLQPMLL----------emerwkq.........
ENSGGOP00000027576  ..................................YTLLYEEAKYFQLQPMLL----------emerwkq.........
ENSGGOP00000018927  ..................................VEDVLAAASYLHMNDIVKVCKRRL----q...............
ENSGGOP00000008276  ..................................ALSFLQEIQYWGIDEL------------sidsccrdrryfrrke
ENSGGOP00000011444  ..................................VEDVLAAASYLHMNDIVKVCKRRL----q...............
ENSGGOP00000000831  ..................................----------------------------mcalsfqeellywgia
ENSGGOP00000005906  .................................nFSTLLTAASYLQLPELAALCRRKL----k...............
ENSGGOP00000016758  ..................................FPELMTAAKFLLMRSVIEICQEVIK---q...............
ENSGGOP00000002243  ..................................LLDFLSLAHKYGFPELEDSTSEYLC---t...............
ENSGGOP00000007459  ..................................VLATLYAAKKYIVPALAKACVNFLE---ts..............
ENSGGOP00000009697  ..................................LPAHLLVASGLQMWQVVDQCSEILR---e...............
ENSGGOP00000012961  ..................................VGQILNMADMYGLEGLKEVAIYIL----r...............
ENSGGOP00000000656  ..................................----------------------------yqsggrirrpvnvpid
ENSGGOP00000027474  ..................................VGVIYEVAERLGMEDLLQACH-------s...............
ENSGGOP00000011420  ..................................----------------------------yqsggrlrrpvnvpld
ENSGGOP00000021753  ..................................----------------------------qsggrlrrpvnvpldm
ENSGGOP00000001534  ..................................----------------------------calsfqeelaywgiee
ENSGGOP00000006456  ..................................IVNFLTVGSVLQMWHIVDKCTELLR---e...............
ENSGGOP00000002216  ..................................ANDVWKAAEFLQMLEAIK----------al..............
ENSGGOP00000000423  ..................................TEQILATAQFLKVYDLVKAYTDF-----................
ENSGGOP00000019822  ..................................VDEVCKCVEFLSVHNIEESCFQFL----k...............
ENSGGOP00000005961  ..................................VDEVCKCVEFLSVHNIEESCFQFL----k...............
ENSGGOP00000009230  ..................................VMTTLYTAKKYAVPALEAHCVEFLTKHL................
ENSGGOP00000013547  ..................................AKTLLEAASKFQFHTFCKVCVSFLEK--................
ENSGGOP00000024337  ..................................----------------------------yqsggrlkrpvnvpfd
ENSGGOP00000007168  ..................................----------------------------yqsggrlkrpvnvpfd
ENSGGOP00000027718  ..................................VLATLYAAKKYIVPHLARACVNFLE---ts..............
ENSGGOP00000020218  ..................................VLATLYAAKKYIVPHLARACVNFLE---ts..............
ENSGGOP00000026600  ..................................ALQILTAASILQIKTVIDECTRI-----vsq.............
ENSGGOP00000019480  ........................aavapgaepsLGAVLAAASYLQIPDLVALCKKRLK---r...............
ENSGGOP00000004482  ..................................IKELMAEAKYYLIQGLVNMCQ-------s...............
ENSGGOP00000018737  ..................................VNLMMSSGQILGIRFLDKLCS-------q...............
ENSGGOP00000011744  ..................................----------------------------nrpsfdgilyyyqsgg
ENSGGOP00000018938  ..................................VNLMMSSGQILGIRFLDKLCS-------q...............
ENSGGOP00000013101  ..................................MPAVLQAARLLEIPCVIAACMEIL----q...............
ENSGGOP00000001595  ..................................YLRLQREALFYELHSLVDL---------lnpy............
ENSGGOP00000000227  ..................................----------------------------lcprcfleelgywgvr
ENSGGOP00000027568  ..................................----------------------------qsggrlrrpvnvpldi
ENSGGOP00000010747  ..................................MADVAILARHLFMSEVLEICE-------s...............
ENSGGOP00000020080  ..................................VLATLWAAKKYIVPALAKACVNFL----gt..............
ENSGGOP00000014177  ..................................VRAVYKEAQYYAIGPLLEQLEN------m...............
ENSGGOP00000002953  ..................................VFAFGQEADYWGLGE-------------nalaaccraryler..
ENSGGOP00000023230  ..................................VFAFGQEADYWGLGE-------------nalaaccraryler..
ENSGGOP00000016398  ..................................IGSIISAAVYLQIHTLVKMCSDFLI---r...............
ENSGGOP00000007622  ..................................AIGLLDLATSYCENRLKKLCQHIIK---r...............
ENSGGOP00000016123  ..................................LAAVQELGYSLGISFLTN----------iv..............
ENSGGOP00000004395  ..................................LLGVLEEARFFGIDSLIEHLEV------aik.............
ENSGGOP00000017862  ..................................AIGLLDLATSYCENRLKKLCQHIIK---r...............
ENSGGOP00000008219  ..................................----------------------------yyyqsggkirrpanvp
ENSGGOP00000013219  ..................................IPEVYREAQFYEIKPLVKLLED------mpqi............
ENSGGOP00000022519  ..................................FSKIISLADSLQMFDVAVSCKNLL----t...............
ENSGGOP00000009774  ..................................FSKIISLADSLQMFDVAVSCKNLL----t...............
ENSGGOP00000015247  ..................................LGELLGEARYYLVQGLIEDCQ-------la..............
ENSGGOP00000024010  ..................................LGELLGEARYYLVQGLIEDCQ-------la..............
ENSGGOP00000019246  ..................................LGELLGEARYYLVQGLIEDCQ-------la..............
ENSGGOP00000016080  ..................................FEQFKVAMNYLQLYNVPD----------cle.............
ENSGGOP00000007297  ..................................VEELLRGAQYFNTPRLRVHCNDFLIK--................
ENSGGOP00000024948  ..................................VEELLRGAQYFNTPRLRVHCNDFLIK--................
ENSGGOP00000027215  ..................................VTDLAAAGKKLGISFLED----------l...............
ENSGGOP00000025289  ..................................IVNYLTAASYLQMEHVVEKCRNAL----s...............
ENSGGOP00000004247  ..................................AMCLLICAEMYQVSRLQHICELFIIT--q...............
ENSGGOP00000015257  ..................................IVNYLTAASYLQMEHVVEKCRNAL----s...............
ENSGGOP00000022917  ..................................VTDLAAAGKKLGISFLED----------l...............
ENSGGOP00000000174  ..................................VSDCERLAKQCQLWDL------------l...............
ENSGGOP00000027797  ..................................FKVLLPAAGLLQLQDVKKTCCEFLE---s...............
ENSGGOP00000006679  ..................................RDQVLLAARELRVPEAVELCQSF-----................
ENSGGOP00000020540  ..................................IMELLSAAKFFQLEALQRHCEIIC----aks.............
ENSGGOP00000009305  ..................................----------------------------gicpicfknemdfwkv
ENSGGOP00000026924  ..................................VLEVLTAAVEYGLEELRELCLQFV----v...............
ENSGGOP00000017487  ..................................KERLLREAEYFQ----------------................
ENSGGOP00000006549  ..................................IMELLSAAKFFQLEALQRHCEIIC----aks.............
ENSGGOP00000014191  ..................................LLKYLTAASYLQMVHIVEKCTEAL----s...............
ENSGGOP00000011572  ..................................----------------------------gpkqi...........
ENSGGOP00000014231  ..................................ILELLSAASLFQLHALQRHCE-------ilc.............
ENSGGOP00000009396  ...............................fltALEVLMASDFL-----------------di..............
ENSGGOP00000000174  ..................................AYDVLSVADMYLLPGLKRLCGRSLA---q...............
ENSGGOP00000004210  ..................................AVGLLDLATFYRENRLKKLCQQTIKQ--g...............
ENSGGOP00000018481  ..................................AVGLLDLATFYRENRLKKLCQQTIKQ--g...............
ENSGGOP00000014767  ..................................LVNYLTAASFLQMSHIVERCTQALWK--f...............
ENSGGOP00000010269  ..................................----------------------------idpvrleqg.......
ENSGGOP00000015462  ..................................ILKTCCISCHPQIPEIIHFCCDFLM---s...............
ENSGGOP00000001664  ..................................----------------------------rneyffdrhseafgfi
ENSGGOP00000019862  ..................................VQRMLEVAEKLKCLDLSETCF-------q...............
ENSGGOP00000002153  ..................................ALELLMAANFLD----------------c...............
ENSGGOP00000026844  psylfaapyyygfynnrlqayckqnlemnvtvqnVLQILEAADKTQALDMKRHCLHIIV---h...............
ENSGGOP00000019651  ..................................IPLVLEAAKFLDIIDAVK----------l...............
ENSGGOP00000004745  ..................................IPLVLEAAKFLDIIDAVK----------l...............
ENSGGOP00000010052  ..................................LDELIKSGQLLGVK--------------fia.............
ENSGGOP00000017655  ..................................LDELIKSGQLLGVK--------------fia.............
ENSGGOP00000023577  ..................................----------------------------a...............
ENSGGOP00000018343  ................................aaVAEIGALGRRLGISRL------------q...............
ENSGGOP00000015994  ................................aaVAEIGALGRRLGIS--------------rl..............
ENSGGOP00000013731  ..................................RIALQEEADYFGIP--------------ypys............
ENSGGOP00000026531  ..................................RIALQEEADYFGIP--------------ypys............
ENSGGOP00000025953  ..................................ICSVLVVADQLLITRLKEICEVALT---e...............
ENSGGOP00000016283  ..................................ICSVLVVADQLLITRLKEICEVALT---e...............
ENSGGOP00000028113  ..................................VHEVLSAASLLQMADIAASCQELL----................
ENSGGOP00000011861  ..................................LLGVLEEARFFGIDSLIEHLEV------aik.............
ENSGGOP00000021684  ..................................AAAVLALAERLGVAGLREACVRFL----e...............
ENSGGOP00000026738  ..................................IVNYLTATSYLQMEHVVEKCRNALSQ--f...............
ENSGGOP00000010504  ..................................GSSLLHEAQFYGLTPLVRR---------lqlr............
ENSGGOP00000015447  ..................................AAAVLALAERLGVAGLREACVRFL----e...............
ENSGGOP00000021637  ..................................LLGVLEAARFFEIYSLIEHLEV------aik.............
ENSGGOP00000020123  ..................................AQDVLSAARQLRVSEL------------es..............
ENSGGOP00000007552  ..................................VMTTLYTAKKYAVPALEAHCVEFLKKNL................
ENSGGOP00000001760  ..................................--VLLPAAGLLQLQDVKKTCCEFLES--q...............
ENSGGOP00000003407  ..................................IPDLRDTCDYLCI---------------nfdfntircqdl....
ENSGGOP00000015569  ..................................----------------------------kewplfcqeveeyhip
ENSGGOP00000024001  ..................................----------------------------krkiiqwctnqkdnpp
ENSGGOP00000016642  ..................................AIPLHRLATKYGVASLQRGVADYMR---ah..............
ENSGGOP00000020138  ..................................LTELMKLANRFQLQLLRERCEK------g...............
ENSGGOP00000002005  ..................................LTELMKLANRFQLQLLRERCEK------g...............
ENSGGOP00000025953  ..................................----------------------------f...............
ENSGGOP00000016283  ..................................----------------------------f...............
ENSGGOP00000006469  ..................................FQ--------------------------nv..............
ENSGGOP00000001665  ..................................TALLRAEADFYQIRPLLDAL--------rel.............
ENSGGOP00000018359  ..................................TALLRAEADFYQIRPLLDAL--------rel.............
ENSGGOP00000003889  ............................rcraenCVRLLSFADLFSCEELK-----------qs..............
ENSGGOP00000015569  ..................................ELSLL-----------------------yeqalglqlmpllqtl
ENSGGOP00000028485  ..................................SSELSSLAHRFGVSELVHLCEQ------................
ENSGGOP00000016194  ..................................SSELSSLAHRFGVSELVHLCEQ------................
ENSGGOP00000016383  ..................................LRPLQEAARALGVQSLEEACW-------r...............
ENSGGOP00000024913  ..................................QGDVLAAAEALGAPRVKAAAQ-------qt..............
ENSGGOP00000026844  ..............................dvllIMDVYKLALSFQLCRLEQLCRQYIEA--svdlqnvlvvcesaar
ENSGGOP00000025740  ..............................dvllIMDVYKLALSFQLCRLEQLCRQYIEA--svdlqnvlvvcesaar
ENSGGOP00000012961  ..................................----------------------------ik..............
ENSGGOP00000019075  ..................................----------------------------kelve...........
ENSGGOP00000013869  ..................................IQDVVQAADLLLLTDLKTLCCEFLE---g...............
ENSGGOP00000013602  ..................................----------------------------ltdsegwilidrx...
ENSGGOP00000025575  ..................................----------------------------x...............
ENSGGOP00000012784  ................gekgggvdedeemdevslLSELVEAASFLQVTSLLQLL--------lsqvrlnnclemyrla
ENSGGOP00000017129  ..................................----------------------------x...............
ENSGGOP00000006469  ...........svgslsevqalvagkpnmtraeeAMELYHIALFLEFNMLAQGCEDIIAE--s...............
ENSGGOP00000020636  ..................................----------------------------tptpivs.........
ENSGGOP00000023818  ..................................----------------------------dv..............
ENSGGOP00000019810  ..................................VEEVLSVSKILHIPQVTKLCVQFLNDQI................
ENSGGOP00000020805  ..................................AVGLQDLATFYKENHLKK----------a...............
ENSGGOP00000001787  ..................................INVLRHEAEFYGITPLVRR---------lllce...........
ENSGGOP00000015569  ..................................IDVLEAEVEILEIPALTE----------avrwy...........
ENSGGOP00000000244  ..................................----------------------------h...............
ENSGGOP00000004860  ..................................VLGVLASAHILQFSGLFQRCVDVMI---a...............
ENSGGOP00000024823  ..................................VLGVLASAHILQFSGLFQRCVDVMI---a...............
ENSGGOP00000004247  ..................................----------------------------fq..............
ENSGGOP00000009548  ..................................LLRAAQAALQYQSSSCLDLCQKGL----a...............
ENSGGOP00000025740  ..................................----------------------------w...............

d1buoa_               ....................................................
ENSGGOP00000021168  ....................................................
ENSGGOP00000013011  ....................................................
ENSGGOP00000017568  ....................................................
ENSGGOP00000020454  ....................................................
ENSGGOP00000006907  ....................................................
ENSGGOP00000019565  ....................................................
ENSGGOP00000008956  ....................................................
ENSGGOP00000003626  ....................................................
ENSGGOP00000021128  ....................................................
ENSGGOP00000007581  ....................................................
ENSGGOP00000009888  ....................................................
ENSGGOP00000013848  ....................................................
ENSGGOP00000022819  ....................................................
ENSGGOP00000017093  ....................................................
ENSGGOP00000003069  ....................................................
ENSGGOP00000009080  ....................................................
ENSGGOP00000025902  ....................................................
ENSGGOP00000015894  ....................................................
ENSGGOP00000007923  ....................................................
ENSGGOP00000027254  ....................................................
ENSGGOP00000014601  ....................................................
ENSGGOP00000003676  ....................................................
ENSGGOP00000028136  ....................................................
ENSGGOP00000005663  ....................................................
ENSGGOP00000027285  ....................................................
ENSGGOP00000023551  ....................................................
ENSGGOP00000008891  ....................................................
ENSGGOP00000006683  ....................................................
ENSGGOP00000014781  ....................................................
ENSGGOP00000015335  vepccwmtyrqh........................................
ENSGGOP00000026029  ....................................................
ENSGGOP00000000093  ....................................................
ENSGGOP00000000958  nh..................................................
ENSGGOP00000012670  ....................................................
ENSGGOP00000008243  ....................................................
ENSGGOP00000002688  vgdccleeyrdrkkena...................................
ENSGGOP00000017890  ....................................................
ENSGGOP00000021385  ....................................................
ENSGGOP00000028262  ....................................................
ENSGGOP00000018004  ....................................................
ENSGGOP00000022121  ....................................................
ENSGGOP00000001618  ....................................................
ENSGGOP00000006123  ....................................................
ENSGGOP00000022681  ....................................................
ENSGGOP00000020951  ....................................................
ENSGGOP00000010436  ....................................................
ENSGGOP00000002271  ....................................................
ENSGGOP00000028316  ....................................................
ENSGGOP00000027249  ....................................................
ENSGGOP00000014290  ....................................................
ENSGGOP00000013616  ....................................................
ENSGGOP00000015202  igdccyeeykdrkrena...................................
ENSGGOP00000018110  ....................................................
ENSGGOP00000023813  ....................................................
ENSGGOP00000010458  ....................................................
ENSGGOP00000026362  ....................................................
ENSGGOP00000021245  ....................................................
ENSGGOP00000017324  ....................................................
ENSGGOP00000024987  ....................................................
ENSGGOP00000003648  ....................................................
ENSGGOP00000003210  iylesccqaryhqk......................................
ENSGGOP00000027620  ....................................................
ENSGGOP00000011768  ....................................................
ENSGGOP00000016634  ....................................................
ENSGGOP00000000318  ....................................................
ENSGGOP00000003104  ....................................................
ENSGGOP00000019798  vepccwmtyrqh........................................
ENSGGOP00000018987  ....................................................
ENSGGOP00000010139  ....................................................
ENSGGOP00000012818  vepccwmtyrqh........................................
ENSGGOP00000004716  ....................................................
ENSGGOP00000003892  ....................................................
ENSGGOP00000003130  ....................................................
ENSGGOP00000027759  ....................................................
ENSGGOP00000018742  ....................................................
ENSGGOP00000022777  ....................................................
ENSGGOP00000018018  ....................................................
ENSGGOP00000011052  ....................................................
ENSGGOP00000001903  ....................................................
ENSGGOP00000013383  ....................................................
ENSGGOP00000016766  ....................................................
ENSGGOP00000005968  ....................................................
ENSGGOP00000002752  effidsccsysyhgrkve..................................
ENSGGOP00000011719  ....................................................
ENSGGOP00000025363  ....................................................
ENSGGOP00000027450  dvepccwmtyrqh.......................................
ENSGGOP00000022683  ....................................................
ENSGGOP00000009560  ....................................................
ENSGGOP00000019691  ....................................................
ENSGGOP00000002738  ....................................................
ENSGGOP00000000386  ....................................................
ENSGGOP00000028415  ....................................................
ENSGGOP00000013223  ....................................................
ENSGGOP00000012188  ....................................................
ENSGGOP00000020804  ....................................................
ENSGGOP00000000312  ....................................................
ENSGGOP00000022687  dvepccwmtyrqh.......................................
ENSGGOP00000009356  ....................................................
ENSGGOP00000019989  ....................................................
ENSGGOP00000019033  ....................................................
ENSGGOP00000015316  ....................................................
ENSGGOP00000019165  ....................................................
ENSGGOP00000020430  ....................................................
ENSGGOP00000017084  ....................................................
ENSGGOP00000003820  dvepccwmtyrqhr......................................
ENSGGOP00000012694  ....................................................
ENSGGOP00000015147  ....................................................
ENSGGOP00000025230  ....................................................
ENSGGOP00000002975  ....................................................
ENSGGOP00000024277  ....................................................
ENSGGOP00000027576  ....................................................
ENSGGOP00000018927  ....................................................
ENSGGOP00000008276  l...................................................
ENSGGOP00000011444  ....................................................
ENSGGOP00000000831  edhldgcckrrylqkieefa................................
ENSGGOP00000005906  ....................................................
ENSGGOP00000016758  ....................................................
ENSGGOP00000002243  ....................................................
ENSGGOP00000007459  ....................................................
ENSGGOP00000009697  ....................................................
ENSGGOP00000012961  ....................................................
ENSGGOP00000000656  ifseeirfyqlgeeamekfrede.............................
ENSGGOP00000027474  ....................................................
ENSGGOP00000011420  ifseeirfyelgeeamemfrede.............................
ENSGGOP00000021753  fseeikfyelgeeamekfrede..............................
ENSGGOP00000001534  ahlercclrkl.........................................
ENSGGOP00000006456  ....................................................
ENSGGOP00000002216  ....................................................
ENSGGOP00000000423  ....................................................
ENSGGOP00000019822  ....................................................
ENSGGOP00000005961  ....................................................
ENSGGOP00000009230  ....................................................
ENSGGOP00000013547  ....................................................
ENSGGOP00000024337  ifteevkfyqlgeeallkfred..............................
ENSGGOP00000007168  ifteevkfyqlgeeallkfred..............................
ENSGGOP00000027718  ....................................................
ENSGGOP00000020218  ....................................................
ENSGGOP00000026600  ....................................................
ENSGGOP00000019480  ....................................................
ENSGGOP00000004482  ....................................................
ENSGGOP00000018737  ....................................................
ENSGGOP00000011744  rlrrpvnvsldvfadeirfyqlgdeamerfrede..................
ENSGGOP00000018938  ....................................................
ENSGGOP00000013101  ....................................................
ENSGGOP00000001595  ....................................................
ENSGGOP00000000227  lkytprccricfeerrdel.................................
ENSGGOP00000027568  fleeirfyqlgdealaafred...............................
ENSGGOP00000010747  ....................................................
ENSGGOP00000020080  ....................................................
ENSGGOP00000014177  ....................................................
ENSGGOP00000002953  ....................................................
ENSGGOP00000023230  ....................................................
ENSGGOP00000016398  ....................................................
ENSGGOP00000007622  ....................................................
ENSGGOP00000016123  ....................................................
ENSGGOP00000004395  ....................................................
ENSGGOP00000017862  ....................................................
ENSGGOP00000008219  idifadeisfyelgseamdqfrede...........................
ENSGGOP00000013219  ....................................................
ENSGGOP00000022519  ....................................................
ENSGGOP00000009774  ....................................................
ENSGGOP00000015247  ....................................................
ENSGGOP00000024010  ....................................................
ENSGGOP00000019246  ....................................................
ENSGGOP00000016080  ....................................................
ENSGGOP00000007297  ....................................................
ENSGGOP00000024948  ....................................................
ENSGGOP00000027215  ....................................................
ENSGGOP00000025289  ....................................................
ENSGGOP00000004247  ....................................................
ENSGGOP00000015257  ....................................................
ENSGGOP00000022917  ....................................................
ENSGGOP00000000174  ....................................................
ENSGGOP00000027797  ....................................................
ENSGGOP00000006679  ....................................................
ENSGGOP00000020540  ....................................................
ENSGGOP00000009305  dlkflddcckshlsekreele...............................
ENSGGOP00000026924  ....................................................
ENSGGOP00000017487  ....................................................
ENSGGOP00000006549  ....................................................
ENSGGOP00000014191  ....................................................
ENSGGOP00000011572  ....................................................
ENSGGOP00000014231  ....................................................
ENSGGOP00000009396  ....................................................
ENSGGOP00000000174  ....................................................
ENSGGOP00000004210  ....................................................
ENSGGOP00000018481  ....................................................
ENSGGOP00000014767  ....................................................
ENSGGOP00000010269  ....................................................
ENSGGOP00000015462  ....................................................
ENSGGOP00000001664  llfillyvrghgklrfaprmcelsfynemiywglegahleyccqrrlddrms
ENSGGOP00000019862  ....................................................
ENSGGOP00000002153  ....................................................
ENSGGOP00000026844  ....................................................
ENSGGOP00000019651  ....................................................
ENSGGOP00000004745  ....................................................
ENSGGOP00000010052  ....................................................
ENSGGOP00000017655  ....................................................
ENSGGOP00000023577  ....................................................
ENSGGOP00000018343  ....................................................
ENSGGOP00000015994  ....................................................
ENSGGOP00000013731  ....................................................
ENSGGOP00000026531  ....................................................
ENSGGOP00000025953  ....................................................
ENSGGOP00000016283  ....................................................
ENSGGOP00000028113  ....................................................
ENSGGOP00000011861  ....................................................
ENSGGOP00000021684  ....................................................
ENSGGOP00000026738  ....................................................
ENSGGOP00000010504  ....................................................
ENSGGOP00000015447  ....................................................
ENSGGOP00000021637  ....................................................
ENSGGOP00000020123  ....................................................
ENSGGOP00000007552  ....................................................
ENSGGOP00000001760  ....................................................
ENSGGOP00000003407  ....................................................
ENSGGOP00000015569  slsealaqceaykswtqe..................................
ENSGGOP00000024001  ....................................................
ENSGGOP00000016642  ....................................................
ENSGGOP00000020138  ....................................................
ENSGGOP00000002005  ....................................................
ENSGGOP00000025953  ....................................................
ENSGGOP00000016283  ....................................................
ENSGGOP00000006469  ....................................................
ENSGGOP00000001665  ....................................................
ENSGGOP00000018359  ....................................................
ENSGGOP00000003889  ....................................................
ENSGGOP00000015569  dnl.................................................
ENSGGOP00000028485  ....................................................
ENSGGOP00000016194  ....................................................
ENSGGOP00000016383  ....................................................
ENSGGOP00000024913  ....................................................
ENSGGOP00000026844  lqlsqlkehclnfv......................................
ENSGGOP00000025740  lqlsqlkehclnfv......................................
ENSGGOP00000012961  ....................................................
ENSGGOP00000019075  ....................................................
ENSGGOP00000013869  ....................................................
ENSGGOP00000013602  ....................................................
ENSGGOP00000025575  ....................................................
ENSGGOP00000012784  qvyglpdlqeaclrfm....................................
ENSGGOP00000017129  ....................................................
ENSGGOP00000006469  ....................................................
ENSGGOP00000020636  ....................................................
ENSGGOP00000023818  ....................................................
ENSGGOP00000019810  ....................................................
ENSGGOP00000020805  ....................................................
ENSGGOP00000001787  ....................................................
ENSGGOP00000015569  ....................................................
ENSGGOP00000000244  ....................................................
ENSGGOP00000004860  ....................................................
ENSGGOP00000024823  ....................................................
ENSGGOP00000004247  ....................................................
ENSGGOP00000009548  ....................................................
ENSGGOP00000025740  ....................................................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0035720 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]