SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

POZ domain alignments in Macaca mulatta 76_1

These alignments are sequences aligned to the 0035720 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1buoa_               mg............................................................................
ENSMMUP00000002434  fs............................................................................
ENSMMUP00000002433  fs............................................................................
ENSMMUP00000006823  yvklissdghefivkreh............................................................
ENSMMUP00000022077  is............................................................................
ENSMMUP00000000957  f.............................................................................
ENSMMUP00000023470  t.............................................................................
ENSMMUP00000010575  s.............................................................................
ENSMMUP00000022822  n.............................................................................
ENSMMUP00000010571  s.............................................................................
ENSMMUP00000010572  s.............................................................................
ENSMMUP00000006555  ey............................................................................
ENSMMUP00000002090  f.............................................................................
ENSMMUP00000026293  lf............................................................................
ENSMMUP00000026389  e.............................................................................
ENSMMUP00000010669  yr............................................................................
ENSMMUP00000024681  kvp...........................................................................
ENSMMUP00000030222  th............................................................................
ENSMMUP00000023260  l.............................................................................
ENSMMUP00000036581  th............................................................................
ENSMMUP00000027081  l.............................................................................
ENSMMUP00000015644  f.............................................................................
ENSMMUP00000002087  f.............................................................................
ENSMMUP00000003441  kvp...........................................................................
ENSMMUP00000025168  kd............................................................................
ENSMMUP00000023910  f.............................................................................
ENSMMUP00000020763  nsk...........................................................................
ENSMMUP00000040638  f.............................................................................
ENSMMUP00000008445  serivinvggtrhqtyrstlrtlpgtrlawlaepdahshfdydpradef.............................
ENSMMUP00000026256  h.............................................................................
ENSMMUP00000010352  dt............................................................................
ENSMMUP00000025120  i.............................................................................
ENSMMUP00000014737  v.............................................................................
ENSMMUP00000022621  elvnlnvggfkqsvdqstllrfphtrlgklltchseeailelcddysvadke..........................
ENSMMUP00000014736  v.............................................................................
ENSMMUP00000033332  hs............................................................................
ENSMMUP00000006749  hs............................................................................
ENSMMUP00000020619  i.............................................................................
ENSMMUP00000006378  dt............................................................................
ENSMMUP00000003698  n.............................................................................
ENSMMUP00000003699  n.............................................................................
ENSMMUP00000003696  n.............................................................................
ENSMMUP00000006059  devl..........................................................................
ENSMMUP00000025169  s.............................................................................
ENSMMUP00000022998  dp............................................................................
ENSMMUP00000039544  dp............................................................................
ENSMMUP00000012059  c.............................................................................
ENSMMUP00000003069  f.............................................................................
ENSMMUP00000005739  qg............................................................................
ENSMMUP00000019026  del...........................................................................
ENSMMUP00000019025  del...........................................................................
ENSMMUP00000005742  qg............................................................................
ENSMMUP00000030686  alivlnvsgtrfqtwqdtlerypdtllgsser..............................................
ENSMMUP00000018201  cs............................................................................
ENSMMUP00000008491  rrvrlnvgglahevlwrtldrlprtrlgklrdcnthdsllevcddyslddney.........................
ENSMMUP00000031952  ppe...........................................................................
ENSMMUP00000014752  fh............................................................................
ENSMMUP00000002089  l.............................................................................
ENSMMUP00000030019  ql............................................................................
ENSMMUP00000025170  ..............................................................................
ENSMMUP00000023524  d.............................................................................
ENSMMUP00000038958  q.............................................................................
ENSMMUP00000030021  ql............................................................................
ENSMMUP00000018103  rrvkinvgglnhevlwrtldrlprtrlgklrdcnthesllevcddynlnen...........................
ENSMMUP00000010534  d.............................................................................
ENSMMUP00000000204  kw............................................................................
ENSMMUP00000000205  kw............................................................................
ENSMMUP00000027009  tl............................................................................
ENSMMUP00000037617  ql............................................................................
ENSMMUP00000027263  ei............................................................................
ENSMMUP00000024327  ..............................................................................
ENSMMUP00000014401  se............................................................................
ENSMMUP00000036732  se............................................................................
ENSMMUP00000029120  glsl..........................................................................
ENSMMUP00000006905  s.............................................................................
ENSMMUP00000026033  em............................................................................
ENSMMUP00000017930  q.............................................................................
ENSMMUP00000027974  ll............................................................................
ENSMMUP00000009849  ka............................................................................
ENSMMUP00000027973  ll............................................................................
ENSMMUP00000005452  p.............................................................................
ENSMMUP00000006135  ekiiinvggtrhetyrstlrtlpgtrlawladpdgggrpetdgggaggsggggceff.....................
ENSMMUP00000033937  ev............................................................................
ENSMMUP00000035430  a.............................................................................
ENSMMUP00000006134  ekiiinvggtrhetyrstlrtlpgtrlawladpdgggrpetdgggaggsggggceff.....................
ENSMMUP00000017929  rv............................................................................
ENSMMUP00000005743  qg............................................................................
ENSMMUP00000039027  ll............................................................................
ENSMMUP00000013437  geirinvggfkrrlrshtllrfpetrlgrlllchsreailelcddyddvqre..........................
ENSMMUP00000023621  q.............................................................................
ENSMMUP00000020548  m.............................................................................
ENSMMUP00000021377  re............................................................................
ENSMMUP00000030798  a.............................................................................
ENSMMUP00000030800  a.............................................................................
ENSMMUP00000006106  pvhidvgghmytsslatltkypesrigrlfdgtepivldsl.....................................
ENSMMUP00000041295  pvhidvgghmytsslatltkypesrigrlfdgtepivldsl.....................................
ENSMMUP00000012739  p.............................................................................
ENSMMUP00000012740  p.............................................................................
ENSMMUP00000009286  mi............................................................................
ENSMMUP00000014850  pvhidvgghmytsslatltkypdsrisrlfngtepivldsl.....................................
ENSMMUP00000000376  q.............................................................................
ENSMMUP00000038684  q.............................................................................
ENSMMUP00000009285  mi............................................................................
ENSMMUP00000038685  ik............................................................................
ENSMMUP00000010727  tst...........................................................................
ENSMMUP00000032065  ne............................................................................
ENSMMUP00000011064  ne............................................................................
ENSMMUP00000028802  q.............................................................................
ENSMMUP00000016597  tlm...........................................................................
ENSMMUP00000039147  nervilnvggtrhetyrstlktlpgtrlallasseppgdclttagdklqpsppplsppprapplspgpggcfeggagn
ENSMMUP00000028804  q.............................................................................
ENSMMUP00000016234  nervilnvggtrhetyrstlktlpgtrlallasseppgdclttagdklqpsppplsppprapplspgpggcfeggagn
ENSMMUP00000039149  nervilnvggtrhetyrstlktlpgtrlallasseppgdclttagdklqpsppplsppprapplspgpggcfeggagn
ENSMMUP00000011063  ne............................................................................
ENSMMUP00000016235  nervilnvggtrhetyrstlktlpgtrlallasseppgdclttagdklqpsppplsppprapplspgpggcfeggagn
ENSMMUP00000016233  nervilnvggtrhetyrstlktlpgtrlallasseppgdclttagdklqpsppplsppprapplspgpggcfeggagn
ENSMMUP00000010726  tst...........................................................................
ENSMMUP00000018252  fed...........................................................................
ENSMMUP00000024617  cftvnvggsrfvlsqqalscfphtrlgklavvvasyrrpgalaavpsplelcddanpvdne.................
ENSMMUP00000000919  rriiinvggikyslpwttldefpltrlgqlkactnfddilnvcddydvtcnef.........................
ENSMMUP00000037246  m.............................................................................
ENSMMUP00000013275  dwl...........................................................................
ENSMMUP00000018253  gy............................................................................
ENSMMUP00000005453  p.............................................................................
ENSMMUP00000023548  evve..........................................................................
ENSMMUP00000033751  hv............................................................................
ENSMMUP00000033833  ti............................................................................
ENSMMUP00000024583  ervvinisglrfetqlktlaqfpetllgdpkkrmryfdplrne...................................
ENSMMUP00000025813  ky............................................................................
ENSMMUP00000001402  e.............................................................................
ENSMMUP00000002937  pa............................................................................
ENSMMUP00000000727  eilinvggrryrlpwstldqfplsrlsklrlcrsyeeiaqlcddyd................................
ENSMMUP00000024588  ervvinisglrfetqlktlcqfpetllgdpkrrmryfdplrneyff................................
ENSMMUP00000021084  f.............................................................................
ENSMMUP00000027790  l.............................................................................
ENSMMUP00000007841  ec............................................................................
ENSMMUP00000016103  ervvinisglrfetqlktlaqfpntllgnpkkrmryfdplrn....................................
ENSMMUP00000029806  ei............................................................................
ENSMMUP00000018718  e.............................................................................
ENSMMUP00000028260  di............................................................................
ENSMMUP00000005173  v.............................................................................
ENSMMUP00000014526  sv............................................................................
ENSMMUP00000021082  f.............................................................................
ENSMMUP00000004903  ql............................................................................
ENSMMUP00000014525  sv............................................................................
ENSMMUP00000035588  sv............................................................................
ENSMMUP00000039976  si............................................................................
ENSMMUP00000008505  i.............................................................................
ENSMMUP00000037061  ervvinvsglrfetqmktlaqfpetllgdpekrtqyfdplrn....................................
ENSMMUP00000027168  si............................................................................
ENSMMUP00000024883  pn............................................................................
ENSMMUP00000039977  si............................................................................
ENSMMUP00000025164  nky...........................................................................
ENSMMUP00000030139  qrvhinisglrfetqlgtlaqfpntllgdpakrlryfdplrneyffd...............................
ENSMMUP00000028983  yn............................................................................
ENSMMUP00000038906  i.............................................................................
ENSMMUP00000035151  ..............................................................................
ENSMMUP00000005415  i.............................................................................
ENSMMUP00000040535  e.............................................................................
ENSMMUP00000040351  erlvinisglrfetqlrtlslfpdtllgdpgrrvrffdplrne...................................
ENSMMUP00000019699  vs............................................................................
ENSMMUP00000019737  ss............................................................................
ENSMMUP00000019796  lnvnvgghsyqldycelvsfpktrlgrlatstsrsrqlslcddyeeqtd.............................
ENSMMUP00000025467  hvi...........................................................................
ENSMMUP00000025466  hvi...........................................................................
ENSMMUP00000033334  f.............................................................................
ENSMMUP00000031332  td............................................................................
ENSMMUP00000017138  siklqssdgeifevdveiak..........................................................
ENSMMUP00000014427  f.............................................................................
ENSMMUP00000034103  rw............................................................................
ENSMMUP00000024981  ky............................................................................
ENSMMUP00000015290  rw............................................................................
ENSMMUP00000023727  ll............................................................................
ENSMMUP00000035669  ll............................................................................
ENSMMUP00000039489  te............................................................................
ENSMMUP00000001343  tvvelnvggefhtttlgtlrkfpgskla..................................................
ENSMMUP00000027673  tv............................................................................
ENSMMUP00000032869  k.............................................................................
ENSMMUP00000029829  dwltlnvgeryftttwstlvnkepdsmlv.................................................
ENSMMUP00000024495  e.............................................................................
ENSMMUP00000039462  qrviiniaglrfetqlrtlsqfpetllgdrekrmq...........................................
ENSMMUP00000017362  ealrvnvggvrrllsaralarfpgtrlgrlqaaaseeqarrlcddydaaarefyf.......................
ENSMMUP00000023496  h.............................................................................
ENSMMUP00000024450  vvlnvggaryslsrellkdfplrrvsrlhgcrserdvlevcddyd.................................
ENSMMUP00000027867  qarkplw.......................................................................
ENSMMUP00000015335  r.............................................................................
ENSMMUP00000038535  dd............................................................................
ENSMMUP00000000230  d.............................................................................
ENSMMUP00000014300  elvtlnvggkifttrfftikqfpasqlacmld..............................................
ENSMMUP00000023912  q.............................................................................
ENSMMUP00000020387  p.............................................................................
ENSMMUP00000000230  s.............................................................................
ENSMMUP00000003775  ivvnvggvrqvlygdllsqypetrlaelinclaggydtifslcddydpgkrefy........................
ENSMMUP00000028507  h.............................................................................
ENSMMUP00000021793  p.............................................................................
ENSMMUP00000000677  h.............................................................................
ENSMMUP00000006314  a.............................................................................
ENSMMUP00000000676  d.............................................................................
ENSMMUP00000039849  d.............................................................................
ENSMMUP00000033224  la............................................................................
ENSMMUP00000008762  esk...........................................................................
ENSMMUP00000002939  pa............................................................................
ENSMMUP00000029460  esk...........................................................................
ENSMMUP00000000342  lqy...........................................................................
ENSMMUP00000014504  q.............................................................................
ENSMMUP00000031090  t.............................................................................
ENSMMUP00000035436  me............................................................................
ENSMMUP00000026976  ga............................................................................
ENSMMUP00000010614  vlr...........................................................................
ENSMMUP00000035434  me............................................................................
ENSMMUP00000038298  fstsrqtlmwip..................................................................
ENSMMUP00000027972  rlf...........................................................................
ENSMMUP00000014079  cs............................................................................
ENSMMUP00000028191  an............................................................................
ENSMMUP00000035799  an............................................................................
ENSMMUP00000035800  an............................................................................
ENSMMUP00000003697  ..............................................................................
ENSMMUP00000011066  yi............................................................................
ENSMMUP00000001153  yi............................................................................
ENSMMUP00000009897  pp............................................................................
ENSMMUP00000014371  ..............................................................................
ENSMMUP00000006589  qiikvyvgshwyattlqtllkypellsnpqrvywitygqtl.....................................
ENSMMUP00000019047  ek............................................................................
ENSMMUP00000012684  ser...........................................................................
ENSMMUP00000018177  ..............................................................................
ENSMMUP00000028191  pvi...........................................................................
ENSMMUP00000035799  pvi...........................................................................
ENSMMUP00000035800  pvi...........................................................................
ENSMMUP00000020974  detga.........................................................................
ENSMMUP00000005376  rt............................................................................
ENSMMUP00000014079  avs...........................................................................
ENSMMUP00000000229  adcalppel.....................................................................
ENSMMUP00000006589  dlf...........................................................................
ENSMMUP00000008168  nlnpqggghy....................................................................
ENSMMUP00000015228  edtm..........................................................................
ENSMMUP00000008698  ..............................................................................
ENSMMUP00000007840  ..............................................................................
ENSMMUP00000040702  msesr.........................................................................
ENSMMUP00000003187  pirl..........................................................................
ENSMMUP00000002939  se............................................................................
ENSMMUP00000002937  se............................................................................
ENSMMUP00000003182  pirl..........................................................................
ENSMMUP00000026976  kc............................................................................
ENSMMUP00000005455  msrfste.......................................................................
ENSMMUP00000009000  ..............................................................................
ENSMMUP00000000640  l.............................................................................
ENSMMUP00000009897  ..............................................................................
ENSMMUP00000034574  msesr.........................................................................
ENSMMUP00000002184  ..............................................................................
ENSMMUP00000018874  gt............................................................................
ENSMMUP00000037084  sr............................................................................
ENSMMUP00000037086  sr............................................................................
ENSMMUP00000005376  d.............................................................................
ENSMMUP00000006589  ypslvtednllwla................................................................
ENSMMUP00000037085  ht............................................................................
ENSMMUP00000017126  lyis..........................................................................
ENSMMUP00000023270  hl............................................................................
ENSMMUP00000027867  as............................................................................
ENSMMUP00000001193  hfllds........................................................................
ENSMMUP00000025835  dls...........................................................................

                                                 10        20         30                           4
                                                  |         |          |                            
d1buoa_               ...................--MIQLQNPSHPTGLLCKANQMRLA.GTLCDVVIMV........DS..........QE.
ENSMMUP00000002434  ...................-------SDKHAQLILAQINKMRNG.QHFCDVQLQV........GK..........ET.
ENSMMUP00000002433  ...................-------SDKHAQLILAQINKMRNG.QHFCDVQLQV........GK..........ET.
ENSMMUP00000006823  ...................-------------------------.----------........--..........--.
ENSMMUP00000022077  ...................--------DKHPRQTLEVINLLRKH.RELCDVVLVV........GA..........KK.
ENSMMUP00000000957  ...................------SAPSHSTSLLQGLATLRAQ.GQLLDVVLTI........NR..........EA.
ENSMMUP00000023470  ...................--------NTHAKSILNSMNSLRKS.NTLCDVTLRV........EQ..........KD.
ENSMMUP00000010575  ...................---------SHAENILQIFNEFRDS.RLFTDVIICV........EG..........KE.
ENSMMUP00000022822  ...................--------PWHMKKAFKVMNELRSQ.NLLCDVTIVA........ED..........ME.
ENSMMUP00000010571  ...................---------SHAENILQIFNEFRDS.RLFTDVIICV........EG..........KE.
ENSMMUP00000010572  ...................---------SHAENILQIFNEFRDS.RLFTDVIICV........EG..........KE.
ENSMMUP00000006555  ...................-----------AVSLLEQLKLFYEQ.QLFTDIVLIV........EG..........TE.
ENSMMUP00000002090  ...................---------------MGVMNNMRKQ.KTLCDVILMV........QE..........RK.
ENSMMUP00000026293  ...................------HKSSYADSVLTHLNLLRQQ.RLFTDVLLHA........GN..........RT.
ENSMMUP00000026389  ...................-------ISSHQSHLLQQLNEQRRQ.DVFCDCSILV........EG..........KV.
ENSMMUP00000010669  ...................-------SAQHSQALLRGLLALRDS.GILFDVVLVV........EG..........RH.
ENSMMUP00000024681  ...................-----------ECRLADELGGLWEN.SRFTDCCLCV........AG..........QE.
ENSMMUP00000030222  ...................------SSSSHSQEMLGKLNMLRND.GHFCDITIRV........QD..........KI.
ENSMMUP00000023260  ...................----------HSEQLLQGLNLLRQH.HELCDIILRV........GD..........VK.
ENSMMUP00000036581  ...................------SSSSHSQEMLGKLNMLRND.GHFCDITIRV........QD..........KI.
ENSMMUP00000027081  ...................-----FKDSTHPVDFLDAFRTFYLD.GLFTDITLQCp.......SG..........II.
ENSMMUP00000015644  ...................----------------KVMNELRSK.QLLCDVMIVA........ED..........VE.
ENSMMUP00000002087  ...................---------------MGVMNNMRKQ.KTLCDVILMV........QE..........RK.
ENSMMUP00000003441  ...................-----------ECRLAEDLGNLWEN.TRFTDCSFFV........RG..........QE.
ENSMMUP00000025168  ...................--------HDFSSDLLRQLNSLRQS.RILTDVSICA........GA..........RE.
ENSMMUP00000023910  ...................------SDPAHALSLLRGLSQLRAE.RKFLDVTLEAa.......GG..........RD.
ENSMMUP00000020763  ...................---------RHYHDAFVAMSRMRQR.GLLCDIVLHV........AA..........KE.
ENSMMUP00000040638  ...................------SDPAHALSLLRGLSQLRAE.RKFLDVTLEAa.......GG..........RD.
ENSMMUP00000008445  ...................-------------------------.----------........--..........--.
ENSMMUP00000026256  ...................----------HAEQTFRKMESYLKQ.QQLCDVILIV........GN..........RK.
ENSMMUP00000010352  ...................---------AHSAALLAQLKSFYDA.RQLCDVTIEVvtpgsgpgTG..........RL.
ENSMMUP00000025120  ...................------PFPDHSSDILSGLNEQRTQ.GLLCDVVILV........EG..........RE.
ENSMMUP00000014737  ...................-----YRWADHSSTVLQRLNEQRLR.GLFCDIVLVA........DE..........QR.
ENSMMUP00000022621  ...................-------------------------.----------........--..........--.
ENSMMUP00000014736  ...................-----YRWADHSSTVLQRLNEQRLR.GLFCDIVLVA........DE..........QR.
ENSMMUP00000033332  ...................--------ESHNDSVLAALNQQRSD.GILCDITLIA........EE..........QK.
ENSMMUP00000006749  ...................--------ESHNDSVLAALNQQRSD.GILCDITLIA........EE..........QK.
ENSMMUP00000020619  ...................------PFPNHSSEVLCSLNEQRHD.GLLCDVLLVV........QE..........QE.
ENSMMUP00000006378  ...................---------AHSAALLAQLKSFYDA.RLLCDVTIEVvtpgsgpgTG..........RL.
ENSMMUP00000003698  ...................----------HAEQTFKKMENYLRH.KQLCDVILVA........GD..........RR.
ENSMMUP00000003699  ...................----------HAEQTFKKMENYLRH.KQLCDVILVA........GD..........RR.
ENSMMUP00000003696  ...................----------HAEQTFKKMENYLRH.KQLCDVILVA........GD..........RR.
ENSMMUP00000006059  ...................-------------------------.------VVNV........SG..........RR.
ENSMMUP00000025169  ...................-------------DLLRQLNSLRQS.RILTDVSICA........GA..........RE.
ENSMMUP00000022998  ...................-------------------------.-----ITLNV........GG..........KL.
ENSMMUP00000039544  ...................-------------------------.-----VTLNV........GG..........HL.
ENSMMUP00000012059  ...................-----IQFTRHASDVLLNLNRLRSR.DILTDVVIVV........SR..........EQ.
ENSMMUP00000003069  ...................------TSNTHSSVVLQGFDQLRLE.GLLCDVTLMP........GDtd........DA.
ENSMMUP00000005739  ...................-----------------IMKLCLEE.ELFADVTISV........EG..........RE.
ENSMMUP00000019026  ...................-------------------------.-----IVLNV........SG..........RR.
ENSMMUP00000019025  ...................-------------------------.-----IVLNV........SG..........RR.
ENSMMUP00000005742  ...................-----------------IMKLCLEE.ELFADVTISV........EG..........RE.
ENSMMUP00000030686  ...................-------------------------.----------........--..........--.
ENSMMUP00000018201  ...................--------SIHDTSVSAGFRALYEE.GLLLDVTLVI........ED..........HQ.
ENSMMUP00000008491  ...................-------------------------.----------........--..........--.
ENSMMUP00000031952  ...................-------------CHLWQLNSLRQS.RILTDVSICA........GA..........RE.
ENSMMUP00000014752  ...................-------KASHPDCVLAHLNTLRKH.CMFTDVTLWA........GD..........RA.
ENSMMUP00000002089  ...................------------------------K.KTLCDVILMV........QE..........RK.
ENSMMUP00000030019  ...................------EIPDFSNSVLSHLNQLRMQ.GRLCDIVVNV........QG..........QA.
ENSMMUP00000025170  ...................---------------LRQLNSLRQS.RILTDVSICA........GA..........RE.
ENSMMUP00000023524  ...................-------FPGHFEQIFQQLNYQRLH.GQLCDCVIVV........GN..........RH.
ENSMMUP00000038958  ...................----------HSLNLLNKIKNMKEL.AEMIDVVLIA........EG..........EK.
ENSMMUP00000030021  ...................------EIPDFSNSVLSHLNQLRMQ.GRLCDIVVNV........QG..........QA.
ENSMMUP00000018103  ...................-------------------------.----------........--..........--.
ENSMMUP00000010534  ...................-------FPQHSQHVLEQLNQQRQL.GLLCDCTFVV........DG..........VH.
ENSMMUP00000000204  ...................-------------------------.-----VRLNV........GG..........TV.
ENSMMUP00000000205  ...................-------------------------.-----VRLNV........GG..........TV.
ENSMMUP00000027009  ...................--------------LQDGLKDLLDE.KKFIDCTLKA........GD..........KS.
ENSMMUP00000037617  ...................------EIPDFSNSVLSHLNQLRMQ.GRLCDIVVNV........QG..........QA.
ENSMMUP00000027263  ...................--------ASHYRHLLRELNEQRQH.GVLCDVCVVV........EG..........KV.
ENSMMUP00000024327  ...................--------------MLEGLQRLRSQ.PKLADVTLLV........GG..........RE.
ENSMMUP00000014401  ...................---------DHGQKILSVLQNFREQ.NVFYDFKIIM........KD..........EI.
ENSMMUP00000036732  ...................---------DHGQKILSVLQNFREQ.NVFYDFKIIM........KD..........EI.
ENSMMUP00000029120  ...................-------------FLQNGLETVRLE.DALTDVILCV........DI..........QE.
ENSMMUP00000006905  ...................-----YTLEDHTKQAFGIMNELRLS.QQLCDVTLQV........KYqdapa.....AQ.
ENSMMUP00000026033  ...................--------QSYYAKLLGELNEQRKR.DFFCDCSIIV........EG..........RI.
ENSMMUP00000017930  ...................-----FDVPEYSSTVLSQLNELRLQ.GKLCDIIVHI........QG..........QP.
ENSMMUP00000027974  ...................---------------QDGLKDMLDH.GKFLDCVVRA........GE..........RE.
ENSMMUP00000009849  ...................----------HGGALLTGYQALRAE.GFLCDVTLET........EG..........SE.
ENSMMUP00000027973  ...................---------------QDGLKDMLDH.GKFLDCVVRA........GE..........RE.
ENSMMUP00000005452  ...................---------FHACSILKQLKTMYDE.GQLTDIVVEVd.......HG..........KT.
ENSMMUP00000006135  ...................-------------------------.----------........--..........--.
ENSMMUP00000033937  ...................-------------------------.-----VELNV........GG..........QVy
ENSMMUP00000035430  ...................---------THSCHLLQQLHEQRIQ.GLLCDCMLVV........KG..........VC.
ENSMMUP00000006134  ...................-------------------------.----------........--..........--.
ENSMMUP00000017929  ...................------EFPDFSSTILQKLNQQRQQ.GQLCDVSIVV........QG..........HI.
ENSMMUP00000005743  ...................-----------------IMKLCLEE.ELFADVTISV........EG..........RE.
ENSMMUP00000039027  ...................---------------QDGLKDMLDH.GKFLDCVVRA........GE..........RE.
ENSMMUP00000013437  ...................-------------------------.----------........--..........--.
ENSMMUP00000023621  ...................--TLQMEIPNFGNSILECLNEQRLQ.GLYCDVSVVV........KG..........HA.
ENSMMUP00000020548  ...................------EFPDHSRHLLQCLSEQRHQ.GFLCDCTVLV........GD..........AQ.
ENSMMUP00000021377  ...................-------FTRHSSDVLGNLNELRLR.GILTDVTLLV........GG..........QP.
ENSMMUP00000030798  ...................---------THSCHLLQQLHEQRIQ.GLLCDCMLVV........KG..........VC.
ENSMMUP00000030800  ...................---------THSCHLLQQLHEQRIQ.GLLCDCMLVV........KG..........VC.
ENSMMUP00000006106  ...................-------------------------.----------........--..........--.
ENSMMUP00000041295  ...................-------------------------.----------........--..........--.
ENSMMUP00000012739  ...................--MYVYESTVHCTNILLGLNDQRKK.DILCDVTLIV........ER..........KE.
ENSMMUP00000012740  ...................--MYVYESTVHCTNILLGLNDQRKK.DILCDVTLIV........ER..........KE.
ENSMMUP00000009286  ...................----QLQNPSHPTGLLCKANQMRLA.GTLCDVVIMV........DS..........QE.
ENSMMUP00000014850  ...................-------------------------.----------........--..........--.
ENSMMUP00000000376  ...................--MLHIEIPNFGNTVLGCLNEQRLL.GLYCDVSIVV........KG..........QA.
ENSMMUP00000038684  ...................-------YSHHCEHLLERLNKQREA.GFLCDCTIVI........GE..........FQ.
ENSMMUP00000009285  ...................----QLQNPSHPTGLLCKANQMRLA.GTLCDVVIMV........DS..........QE.
ENSMMUP00000038685  ...................-----MQYSHHCEHLLERLNKQREA.GFLCDCTIVI........GE..........FQ.
ENSMMUP00000010727  ...................------FDPSHSDNLLHGLNLLWRK.QLFCDVTLTA........QG..........QQ.
ENSMMUP00000032065  ...................--------NSYCYQLLRQLNEQRKK.GILCDVSIVV........SG..........KI.
ENSMMUP00000011064  ...................--------NSYCYQLLRQLNEQRKK.GILCDVSIVV........SG..........KI.
ENSMMUP00000028802  ...................-------YSHHCEHLLERLNKQREA.GFLCDCTIVI........GE..........FQ.
ENSMMUP00000016597  ...................-------------------------.------TLNV........GG..........YL.
ENSMMUP00000039147  cssrggrasdhpgggreff-------------------------.----------........--..........--.
ENSMMUP00000028804  ...................-------YSHHCEHLLERLNKQREA.GFLCDCTIVI........GE..........FQ.
ENSMMUP00000016234  cssrggrasdhpgggreff-------------------------.----------........--..........--.
ENSMMUP00000039149  cssrggrasdhpgggreff-------------------------.----------........--..........--.
ENSMMUP00000011063  ...................--------NSYCYQLLRQLNEQRKK.GILCDVSIVV........SG..........KI.
ENSMMUP00000016235  cssrggrasdhpgggreff-------------------------.----------........--..........--.
ENSMMUP00000016233  cssrggrasdhpgggreff-------------------------.----------........--..........--.
ENSMMUP00000010726  ...................------FDPSHSDNLLHGLNLLWRK.QLFCDVTLTA........QG..........QQ.
ENSMMUP00000018252  ...................--------ENFIESSVAKLNALRKS.GQFCDVRLQV........CG..........HE.
ENSMMUP00000024617  ...................-------------------------.----------........--..........--.
ENSMMUP00000000919  ...................-------------------------.----------........--..........--.
ENSMMUP00000037246  ...................------ELPSHSKQLLLQLNQQRTK.GFLCDVIIMV........EN..........SI.
ENSMMUP00000013275  ...................-------------------------.------TLNV........GG..........RY.
ENSMMUP00000018253  ...................---LMFEDENFIESSVAKLNALRKS.GQFCDVRLQV........CG..........HE.
ENSMMUP00000005453  ...................---------FHACSILKQLKTMYDE.GQLTDIVVEVd.......HG..........KT.
ENSMMUP00000023548  ...................-------------------------.-------LNV........GG..........QVy
ENSMMUP00000033751  ...................------------HILSEHIGALLIG.EEYGDVTFVV........EK..........KR.
ENSMMUP00000033833  ...................----QIEFPQHSSSLLESLNRHRLE.GKFCDVSLLV........QG..........RE.
ENSMMUP00000024583  ...................-------------------------.----------........--..........--.
ENSMMUP00000025813  ...................-------------------------.-----VKLNV........GG..........AL.
ENSMMUP00000001402  ...................-------FPEHGGRLLGRLRQQREL.GFLCDCTVLV........GD..........AR.
ENSMMUP00000002937  ...................------------SELGEDLLKLYVK.PCCPDIDIFV........DG..........KR.
ENSMMUP00000000727  ...................-------------------------.----------........--..........--.
ENSMMUP00000024588  ...................-------------------------.----------........--..........--.
ENSMMUP00000021084  ...................------TDPGHPREMLKELNQQRRA.KAFTDLKIVV........EG..........RE.
ENSMMUP00000027790  ...................------QSTNHPNNLLKELNKCRLS.ETMCDVTIVV........GS..........RS.
ENSMMUP00000007841  ...................--------SSHCSELSWRQNEQRRQ.GLFCDITLCFgga.....GG..........RE.
ENSMMUP00000016103  ...................-------------------------.----------........--..........--.
ENSMMUP00000029806  ...................-------------------------.-----VQLNV........GG..........TR.
ENSMMUP00000018718  ...................-------FPEHHKMILDRLNEQREQ.DRFTDITLIV........DG..........HH.
ENSMMUP00000028260  ...................-------------------------.-----VELNV........GG..........QV.
ENSMMUP00000005173  ...................----HVSFPEVTSALLESLNQQRLQ.GQLCDVSIRV........QG..........RE.
ENSMMUP00000014526  ...................---FAYESSVHSTNVLLSLNDQRKK.DVLCDVTIFV........EG..........QR.
ENSMMUP00000021082  ...................------TDPGHPREMLKELNQQRRA.KAFTDLKIVV........EG..........RE.
ENSMMUP00000004903  ...................----VVHSDAHSDTVLASFEDQRKK.GFLCDITLIV........EN..........VH.
ENSMMUP00000014525  ...................---FAYESSVHSTNVLLSLNDQRKK.DVLCDVTIFV........EG..........QR.
ENSMMUP00000035588  ...................---FAYESSVHSTNVLLSLNDQRKK.DVLCDVTIFV........EG..........QR.
ENSMMUP00000039976  ...................------NLHNFSNSVLETLNEQRNR.GHFCDVTVRI........HG..........SM.
ENSMMUP00000008505  ...................-------------------------.----------........GD..........HK.
ENSMMUP00000037061  ...................-------------------------.----------........--..........--.
ENSMMUP00000027168  ...................------NLHNFSNSVLETLNEQRNR.GHFCDVTVRI........HG..........SM.
ENSMMUP00000024883  ...................-------WQGLYPTIRERNAVMFNN.DLMADVHFVVgppg....GT..........QR.
ENSMMUP00000039977  ...................------NLHNFSNSVLETLNEQRNR.GHFCDVTVRI........HG..........SM.
ENSMMUP00000025164  ...................-------------------------.-----VQLNV........GG..........SL.
ENSMMUP00000030139  ...................-------------------------.----------........--..........--.
ENSMMUP00000028983  ...................-------DDDHKTLFLKTLNEQRLE.GEFCDIAIVV........ED..........VK.
ENSMMUP00000038906  ...................------PFPDHSSELLSCLNEQRQL.GHLCDLTIRT........QG..........LE.
ENSMMUP00000035151  ...................-------------------------.---------V........QE..........RK.
ENSMMUP00000005415  ...................------PFPDHSSELLSCLNEQRQL.GHLCDLTIRT........QG..........LE.
ENSMMUP00000040535  ...................-------LPNYSRQLLQQLYTLCKE.QQFCDCTISI........GT..........IY.
ENSMMUP00000040351  ...................-------------------------.----------........--..........--.
ENSMMUP00000019699  ...................-------DPQHAARLLRALSSFREE.SRFCDAHLVL........DG..........EE.
ENSMMUP00000019737  ...................--------PKHCQAVLKQLNEQRLS.NQFCDVTLLI........EG..........EE.
ENSMMUP00000019796  ...................-------------------------.----------........--..........--.
ENSMMUP00000025467  ...................---------NHAEQTLRKMENYLKE.KQLCDVLLIA........GH..........LR.
ENSMMUP00000025466  ...................---------NHAEQTLRKMENYLKE.KQLCDVLLIA........GH..........LR.
ENSMMUP00000033334  ...................-------------------AFLFNS.ELLSDVRFVL........GKgrgtaaaggpQR.
ENSMMUP00000031332  ...................--------ASYGPNLLEGLSKMRQE.NFLCDLVIGT........KT..........KS.
ENSMMUP00000017138  ...................-------------------------.----------........--..........--.
ENSMMUP00000014427  ...................-------------------AFLFNS.ELLSDVRFVL........GKgrgtaaaggpQR.
ENSMMUP00000034103  ...................-------------------------.-----VRLNV........GG..........TY.
ENSMMUP00000024981  ...................-------------------------.-----VKLNV........GG..........SL.
ENSMMUP00000015290  ...................-------------------------.-----VRLNV........GG..........TY.
ENSMMUP00000023727  ...................----HYINPAHAISLLSALNEERLK.GQLCDVLLIV........GD..........QK.
ENSMMUP00000035669  ...................----HYINPAHAISLLSALNEERLK.GQLCDVLLIV........GD..........QK.
ENSMMUP00000039489  ...................--------KNYNSFVLQNLNRQRKR.KEYWDMALSV........DH..........HV.
ENSMMUP00000001343  ...................-------------------------.----------........--..........--.
ENSMMUP00000027673  ...................---------------AESLKKEFDS.PETADLKFRI........DG..........KY.
ENSMMUP00000032869  ...................--------PSHSSYVLQQLNNQREW.GFLCDCCIAI........DD..........IY.
ENSMMUP00000029829  ...................-------------------------.----------........--..........--.
ENSMMUP00000024495  ...................-------LPNYSRQLLQQLYTLCKE.QQFCDCTISI........GT..........IY.
ENSMMUP00000039462  ...................-------------------------.----------........--..........--.
ENSMMUP00000017362  ...................-------------------------.----------........--..........--.
ENSMMUP00000023496  ...................----HIHLQNFSRSLLETLNGQRLG.GHFCDVTVRI........RE..........AS.
ENSMMUP00000024450  ...................-------------------------.----------........--..........--.
ENSMMUP00000027867  ...................-------------FYNTSLKFFLNK.PMLADVVFEI........QG..........TT.
ENSMMUP00000015335  ...................-----FQLPGHEAATLRNMNQLRAE.ERFCDVTIVA........DS..........LK.
ENSMMUP00000038535  ...................---------FHSDTVLSILNEQRIR.GILCDVTIIV........ED..........TK.
ENSMMUP00000000230  ...................-----------------FLQRLLEQ.GIHSDVVFVV........HG..........KP.
ENSMMUP00000014300  ...................-------------------------.----------........--..........--.
ENSMMUP00000023912  ...................----------HSVRVLQELNKQREK.GQYCDATLDV........GG..........LV.
ENSMMUP00000020387  ...................--------------------HFLNN.KEMSDVTFLV........EG..........RP.
ENSMMUP00000000230  ...................-------------------------.--CPDVCFRV........AG..........CS.
ENSMMUP00000003775  ...................-------------------------.----------........--..........--.
ENSMMUP00000028507  ...................---------------------FLNN.KEMSDVTFLV........EG..........KL.
ENSMMUP00000021793  ...................--------------------HFLNN.KEMSDVTFLV........EG..........RP.
ENSMMUP00000000677  ...................-----FQFEQQGDVVLQKMNLLRQQ.NLFCDVSIYI........ND..........TE.
ENSMMUP00000006314  ...................---------SHSLVLLQQLNMQREF.GFLCDCTVAI........GD..........VY.
ENSMMUP00000000676  ...................--LLHFKFENYGDSMLQKMNKLREE.NKFCDVTVLI........DD..........IE.
ENSMMUP00000039849  ...................--LLHFKFENYGDSMLQKMNKLREE.NKFCDVTVLI........DD..........IE.
ENSMMUP00000033224  ...................---------NHGLILLQQLNAQREF.GFLCDCTVAI........GD..........VY.
ENSMMUP00000008762  ...................---------SSPFNLLHEMHELRLL.GHLCDVTVSV........EYqgvr......KD.
ENSMMUP00000002939  ...................------------SELGEDLLKLYVK.PCCPDIDIFV........DG..........KR.
ENSMMUP00000029460  ...................---------SSPFNLLHEMHELRLL.GHLCDVTVSV........EYqgvr......KD.
ENSMMUP00000000342  ...................-----------NKNLLKYLNDDRQKqPSFCDLLIIV........EG..........KE.
ENSMMUP00000014504  ...................----------YSGSLLNSLNEQRGH.GLFCDVTVIV........ED..........RK.
ENSMMUP00000031090  ...................-------DPSHAPAVLRQLNEQRLR.GLFCDVTLIA........GD..........TK.
ENSMMUP00000035436  ...................-------APGHSRQLLLQLNNQRTK.GFLCDVIIVV........QN..........AL.
ENSMMUP00000026976  ...................-------------------------.-EFCDITLLL........DG..........HP.
ENSMMUP00000010614  ...................-------------------------.-------LNV........GG..........CT.
ENSMMUP00000035434  ...................-------APGHSRQLLLQLNNQRTK.GFLCDVIIVV........QN..........AL.
ENSMMUP00000038298  ...................-------------------------.----------........--..........--.
ENSMMUP00000027972  ...................------------------------Q.PDLCDVDLVLvp......QR..........SV.
ENSMMUP00000014079  ...................-------------------------.-FLCDVTMKSv.......DG..........KE.
ENSMMUP00000028191  ...................-----------------RIKECLSK.GTFSDVTFKL........DD..........GA.
ENSMMUP00000035799  ...................-----------------RIKECLSK.GTFSDVTFKL........DD..........GA.
ENSMMUP00000035800  ...................-----------------RIKECLSK.GTFSDVTFKL........DD..........GA.
ENSMMUP00000003697  ...................-------------------------.----------........--..........--.
ENSMMUP00000011066  ...................------------------YQTLFLN.GEDSDIKICA........LG..........EE.
ENSMMUP00000001153  ...................------------------YQTLFLN.GENSDIKICA........LG..........EE.
ENSMMUP00000009897  ...................----IIVVPEPPSSSEECPAHLLED.PLCADVILVLq.......ER..........VR.
ENSMMUP00000014371  ...................-------------------------.----------........--..........--.
ENSMMUP00000006589  ...................-------------------------.----------........--..........--.
ENSMMUP00000019047  ...................-------------------------.-----VTLLV........DG..........TR.
ENSMMUP00000012684  ...................-------------------------.-----VTLIV........DN..........TR.
ENSMMUP00000018177  ...................---------------------MFNN.ELMADVHFVV........GPpgat......RT.
ENSMMUP00000028191  ...................------KIPECPSMGTSEAACLLDN.PLCADVLFILq.......DQ..........EH.
ENSMMUP00000035799  ...................------KIPECPSMGTSEAACLLDN.PLCADVLFILq.......DQ..........EH.
ENSMMUP00000035800  ...................------KIPECPSMGTSEAACLLDN.PLCADVLFILq.......DQ..........EH.
ENSMMUP00000020974  ...................-------------------------.----------........--..........--.
ENSMMUP00000005376  ...................--------------LQKDMADLYEY.KYCTDVDLIF........QE..........TC.
ENSMMUP00000014079  ...................-------SSSFFEEFGKLLRETDEM.DSIHDVTFQV........GN..........RL.
ENSMMUP00000000229  ...................-------------------------.----------........--..........--.
ENSMMUP00000006589  ...................-------------------------.------HFNV........GG..........WH.
ENSMMUP00000008168  ...................-------------------------.----------........--..........--.
ENSMMUP00000015228  ...................-------------------------.----------........--..........--.
ENSMMUP00000008698  ...................-------------------------.----------........--..........--.
ENSMMUP00000007840  ...................-------------------------.----------........--..........--.
ENSMMUP00000040702  ...................-------------------------.----------........--..........--.
ENSMMUP00000003187  ...................--------PSPYGSDRLVQLAARLR.PALCDTLITV........GS..........QQ.
ENSMMUP00000002939  ...................-------------QLSQDLLRLLRE.EFHTDVTFSV........GC..........TL.
ENSMMUP00000002937  ...................-------------QLSQDLLRLLRE.EFHTDVTFSV........GC..........TL.
ENSMMUP00000003182  ...................--------PSPYGSDRLVQLAARLR.PALCDTLITV........GS..........QQ.
ENSMMUP00000026976  ...................-------------TLHEDYGRLWES.RQFCDVEFVLge......KE..........EC.
ENSMMUP00000005455  ...................-------------------------.----------........--..........--.
ENSMMUP00000009000  ...................-------------------------.----------........--..........--.
ENSMMUP00000000640  ...................-------------------------.------KFVV........DG..........KY.
ENSMMUP00000009897  ...................-------------------------.----------........--..........--.
ENSMMUP00000034574  ...................-------------------------.----------........--..........--.
ENSMMUP00000002184  ...................-------------------------.----------........--..........--.
ENSMMUP00000018874  ...................-----MEFPEHSQQLLQSLREQRSQ.GFLCDCTVMV........GS..........TQ.
ENSMMUP00000037084  ...................-------------------------.----------........--..........--.
ENSMMUP00000037086  ...................-------------------------.----------........--..........--.
ENSMMUP00000005376  ...................-------------------------.----------........--..........EE.
ENSMMUP00000006589  ...................-------------------------.----------........--..........--.
ENSMMUP00000037085  ...................-------------------------.----------........--..........--.
ENSMMUP00000017126  ...................---------QIQKFFCENFKNKDIQ.SAEADVILEC........LG..........FK.
ENSMMUP00000023270  ...................-------------TVAESLKREFDN.PDTADLKFLV........DG..........KY.
ENSMMUP00000027867  ...................-------------HYNADLNNLLFC.CQCVDVVFYN........PNlk........EV.
ENSMMUP00000001193  ...................-------------------------.----------........-G..........LQ.
ENSMMUP00000025835  ...................------------RELSEVLGQIFDS.QQGCDLSISVsvqge...DA..........LG.

                      0        50                                                                   
                      |         |                                                                   
d1buoa_               FHAHRTVLACTSK..MFEI.LF........................................................
ENSMMUP00000002434  FKAHRLVLAASSP..YFAA.LF........................................................
ENSMMUP00000002433  FKAHRLVLAASSP..YFAA.LF........................................................
ENSMMUP00000006823  --------ALTSG..TIKA.ML........................................................
ENSMMUP00000022077  IYAHRVILSACSP..YFRA.MF........................................................
ENSMMUP00000000957  FPAHKVVLAACSD..YFRA.MF........................................................
ENSMMUP00000023470  FPAHRIVLAACSD..YFCA.MF........................................................
ENSMMUP00000010575  FPCHRAVLSACSS..YFRA.MF........................................................
ENSMMUP00000022822  ISAHRVVLAACSP..YFHA.MF........................................................
ENSMMUP00000010571  FPCHRAVLSACSS..YFRA.MF........................................................
ENSMMUP00000010572  FPCHRAVLSACSS..YFRA.MF........................................................
ENSMMUP00000006555  FPCHKMVLATCSS..YFRA.MF........................................................
ENSMMUP00000002090  IPAHRVVLAAASH..FFNL.MF........................................................
ENSMMUP00000026293  FPCHRAVLAACSR..YFEA.MF........................................................
ENSMMUP00000026389  FKAHRNVLFASSG..YFKM.LL........................................................
ENSMMUP00000010669  IEAHRILLAASCD..YFRG.MF........................................................
ENSMMUP00000024681  FQAHKAILAARSP..VFSA.MF........................................................
ENSMMUP00000030222  FRAHKVVLAACSD..FFRT.KL........................................................
ENSMMUP00000023260  IHAHKVVLASVSP..YFKA.MF........................................................
ENSMMUP00000036581  FRAHKVVLAACSD..FFRT.KL........................................................
ENSMMUP00000027081  FHCHRAVLAACSN..YFKA.MF........................................................
ENSMMUP00000015644  IEAHRVVLAACSP..YFCA.MF........................................................
ENSMMUP00000002087  IPAHRVVLAAASH..FFNL.MF........................................................
ENSMMUP00000003441  FKAHKSVLAARSP..VFNA.MF........................................................
ENSMMUP00000025168  IPCHRNVLASSSP..YFRA.MF........................................................
ENSMMUP00000023910  FPAHRAVLAAASP..YFRA.MF........................................................
ENSMMUP00000020763  IRAHKVVLASCSP..YFHA.MF........................................................
ENSMMUP00000040638  FPAHRAVLAAASP..YFRA.MF........................................................
ENSMMUP00000008445  -------------..----.--........................................................
ENSMMUP00000026256  IPAHRLVLSSVSD..YFAA.MF........................................................
ENSMMUP00000010352  FPCNRNVLAAACP..YFKS.MF........................................................
ENSMMUP00000025120  FPTHRSVLAACSQ..YFKK.LF........................................................
ENSMMUP00000014737  VPAHRNLLAVCSD..YFNS.MF........................................................
ENSMMUP00000022621  -------------..----.--........................................................
ENSMMUP00000014736  VPAHRNLLAVCSD..YFNS.MF........................................................
ENSMMUP00000033332  FHAHKAVLAACSD..YFRA.MF........................................................
ENSMMUP00000006749  FHAHKAVLAACSD..YFRA.MF........................................................
ENSMMUP00000020619  YRTHRSVLAACSK..YFKK.LF........................................................
ENSMMUP00000006378  FSCNRNVLAAACP..YFKS.MF........................................................
ENSMMUP00000003698  IPAHRLVLSSVSD..YFAA.MF........................................................
ENSMMUP00000003699  IPAHRLVLSSVSD..YFAA.MF........................................................
ENSMMUP00000003696  IPAHRLVLSSVSD..YFAA.MF........................................................
ENSMMUP00000006059  FETWKNTLDRYPD..TLLG.SS........................................................
ENSMMUP00000025169  IPCHRNVLASSSP..YFRA.MF........................................................
ENSMMUP00000022998  YTTSLATLTSFPDs.MLGA.MF........................................................
ENSMMUP00000039544  YTTSLTTLTRYPDs.MLGA.MF........................................................
ENSMMUP00000012059  FRAHKTVLMACSG..LFYS.IF........................................................
ENSMMUP00000003069  FPVHRVMMASASD..YFKA.MF........................................................
ENSMMUP00000005739  FQLHRLVLSAQSC..FFRS.MF........................................................
ENSMMUP00000019026  FQTWRTTLERYPD..TLLG.ST........................................................
ENSMMUP00000019025  FQTWRTTLERYPD..TLLG.ST........................................................
ENSMMUP00000005742  FQLHRLVLSAQSC..FFRS.MF........................................................
ENSMMUP00000030686  -------------..---D.FF........................................................
ENSMMUP00000018201  FQAHKALLATQSD..YFRI.MF........................................................
ENSMMUP00000008491  -------------..----.--........................................................
ENSMMUP00000031952  IPCHRNVLASSSP..YFRA.MF........................................................
ENSMMUP00000014752  FPCHRAVLAASSR..YFEA.MF........................................................
ENSMMUP00000002089  IPAHRVVLAAASH..FFNL.MF........................................................
ENSMMUP00000030019  FRAHKVVLAASSP..YFRD.HM........................................................
ENSMMUP00000025170  IPCHRNVLASSSP..YFRA.MF........................................................
ENSMMUP00000023524  FKAHRSVLAACST..HFRA.LF........................................................
ENSMMUP00000038958  FPCHRLVLAAFSP..YFKA.MF........................................................
ENSMMUP00000030021  FRAHKVVLAASSP..YFRD.HM........................................................
ENSMMUP00000018103  -------------..----.--........................................................
ENSMMUP00000010534  FKAHKAVLAACSE..YFKM.LF........................................................
ENSMMUP00000000204  FLTTRQTLCREQK..SFLS.RL........................................................
ENSMMUP00000000205  FLTTRQTLCREQK..SFLS.RL........................................................
ENSMMUP00000027009  LPCHRLILSACSP..YFRE.YF........................................................
ENSMMUP00000037617  FRAHKVVLAASSP..YFRD.HM........................................................
ENSMMUP00000027263  FKAHKNVLLGSSR..YFKT.LY........................................................
ENSMMUP00000024327  LPCHRGLLALSSP..YFHA.MF........................................................
ENSMMUP00000014401  IPCHRCVLAACSD..FFRA.MF........................................................
ENSMMUP00000036732  IPCHRCVLAACSD..FFRA.MF........................................................
ENSMMUP00000029120  FSCHRVVLAAASN..YFRA.MF........................................................
ENSMMUP00000006905  FMAHKVVLASSSP..VFKA.MF........................................................
ENSMMUP00000026033  FKAHRNILFANSG..YFRA.LL........................................................
ENSMMUP00000017930  FRAHKAVLAASSP..YFRD.HS........................................................
ENSMMUP00000027974  FPCHRLVLAACSP..YFRA.RF........................................................
ENSMMUP00000009849  FPAHRSLLACSSD..YFRA.LF........................................................
ENSMMUP00000027973  FPCHRLVLAACSP..YFRA.RF........................................................
ENSMMUP00000005452  FSCHRNVLAAISP..YFSL.EF........................................................
ENSMMUP00000006135  -------------..----.--........................................................
ENSMMUP00000033937  FTRHSTLISIPHS..FLWK.MF........................................................
ENSMMUP00000035430  FKAHKNVLAAFSQ..YFRS.LF........................................................
ENSMMUP00000006134  -------------..----.--........................................................
ENSMMUP00000017929  FRAHKAVLAASSP..YFCD.QV........................................................
ENSMMUP00000005743  FQLHRLVLSAQSC..FFRS.MF........................................................
ENSMMUP00000039027  FPCHRLVLAACSP..YFRA.RF........................................................
ENSMMUP00000013437  -------------..----.--........................................................
ENSMMUP00000023621  FKAHRAVLAASSS..YFRD.LF........................................................
ENSMMUP00000020548  FRAHRAVLASCSM..YFHL.FY........................................................
ENSMMUP00000021377  LRAHKAVLIACSG..FFYS.IF........................................................
ENSMMUP00000030798  FKAHKNVLAAFSQ..YFRS.LF........................................................
ENSMMUP00000030800  FKAHKNVLAAFSQ..YFRS.LF........................................................
ENSMMUP00000006106  -------------..----.--........................................................
ENSMMUP00000041295  -------------..----.--........................................................
ENSMMUP00000012739  FRAHRAVLAACSE..YFWQ.AL........................................................
ENSMMUP00000012740  FRAHRAVLAACSE..YFWQ.AL........................................................
ENSMMUP00000009286  FHAHRTVLACTSK..MFEI.LF........................................................
ENSMMUP00000014850  -------------..----.--........................................................
ENSMMUP00000000376  FKAHRAVLAASSL..YFRD.LF........................................................
ENSMMUP00000038684  FKAHRNVLASFSE..YFGA.IY........................................................
ENSMMUP00000009285  FHAHRTVLACTSK..MFEI.LF........................................................
ENSMMUP00000038685  FKAHRNVLASFSE..YFGA.IY........................................................
ENSMMUP00000010727  FHCHKAVLASCSQ..YFRS.LFsshpplgggvggqdglgapkdqqqppqqqqpsqqqqpppqeepgtpssspddkll.
ENSMMUP00000032065  FKAHKNILVAGSR..FFKT.LY........................................................
ENSMMUP00000011064  FKAHKNILVAGSR..FFKT.LY........................................................
ENSMMUP00000028802  FKAHRNVLASFSE..YFGA.IY........................................................
ENSMMUP00000016597  YITQKQTLTKYPD..TFLE.GI........................................................
ENSMMUP00000039147  -------------..----.--........................................................
ENSMMUP00000028804  FKAHRNVLASFSE..YFGA.IY........................................................
ENSMMUP00000016234  -------------..----.--........................................................
ENSMMUP00000039149  -------------..----.--........................................................
ENSMMUP00000011063  FKAHKNILVAGSR..FFKT.LY........................................................
ENSMMUP00000016235  -------------..----.--........................................................
ENSMMUP00000016233  -------------..----.--........................................................
ENSMMUP00000010726  FHCHKAVLASCSQ..YFRS.LFsshpplgggvggqdglgapkdqqqppqqqqpsqqqqpppqeepgtpssspddkll.
ENSMMUP00000018252  MLAHRAVLACCSP..YLFE.IF........................................................
ENSMMUP00000024617  -------------..----.--........................................................
ENSMMUP00000000919  -------------..----.--........................................................
ENSMMUP00000037246  FRAHKNVLAASSI..YFKS.LV........................................................
ENSMMUP00000013275  FTTTRSTLVNKEPdsMLAH.MF........................................................
ENSMMUP00000018253  MLAHRAVLACCSP..YLFE.IF........................................................
ENSMMUP00000005453  FSCHRNVLAAISP..YFSL.SV........................................................
ENSMMUP00000023548  VTKHSTLLSVPDS..TLAS.MF........................................................
ENSMMUP00000033751  FPAHRVILAARCQ..YFRA.LL........................................................
ENSMMUP00000033833  LRAHKAVLAAASP..YFHD.KL........................................................
ENSMMUP00000024583  -------------..----.--........................................................
ENSMMUP00000025813  YYTTMQTLTKQDT..MLKA.MF........................................................
ENSMMUP00000001402  FPAHRAVLAACSV..YFHL.FY........................................................
ENSMMUP00000002937  FKAHRAILSARSS..YFAA.ML........................................................
ENSMMUP00000000727  -------------..----.--........................................................
ENSMMUP00000024588  -------------..----.--........................................................
ENSMMUP00000021084  FEVHQNVLASCSL..YFKD.LI........................................................
ENSMMUP00000027790  FPAHKAVLACAAG..YFQN.LF........................................................
ENSMMUP00000007841  FRAHRSVLAAATE..YFTP.LL........................................................
ENSMMUP00000016103  -------------..----.--........................................................
ENSMMUP00000029806  FSTSRQTLMWIPD..SFFS.SL........................................................
ENSMMUP00000018718  FKAHKAVLAACSK..FFYK.FF........................................................
ENSMMUP00000028260  YVTRRCTVVSVPDs.LLWR.MF........................................................
ENSMMUP00000005173  FRAHRAVLAASSP..YFHD.QV........................................................
ENSMMUP00000014526  FRAHRSVLAACSS..YFHS.RI........................................................
ENSMMUP00000021082  FEVHQNVLASCSL..YFKD.LI........................................................
ENSMMUP00000004903  FRAHKALLAASSE..YFSM.MF........................................................
ENSMMUP00000014525  FRAHRSVLAACSS..YFHS.RI........................................................
ENSMMUP00000035588  FRAHRSVLAACSS..YFHS.RI........................................................
ENSMMUP00000039976  LRAHRCVLAAGSP..FFQD.KL........................................................
ENSMMUP00000008505  FSAHRIVLTASIP..YFHA.MF........................................................
ENSMMUP00000037061  -------------..----.--........................................................
ENSMMUP00000027168  LRAHRCVLAAGSP..FFQD.KL........................................................
ENSMMUP00000024883  LPGHKYVLAVGSS..VFHA.MF........................................................
ENSMMUP00000039977  LRAHRCVLAAGSP..FFQD.KL........................................................
ENSMMUP00000025164  YYTTVRALTRHDT..MLKA.MF........................................................
ENSMMUP00000030139  -------------..----.--........................................................
ENSMMUP00000028983  FRAHRCVLAACST..YFKK.LF........................................................
ENSMMUP00000038906  YRTHRAVLAACSH..YFKK.LF........................................................
ENSMMUP00000035151  IPAHRVVLAAASH..FFNL.MF........................................................
ENSMMUP00000005415  YRTHRAVLAACSH..YFKK.LF........................................................
ENSMMUP00000040535  FRAHKLVLAAASL..LFKT.LL........................................................
ENSMMUP00000040351  -------------..----.--........................................................
ENSMMUP00000019699  IPVQKNILAAASP..YIRT.KL........................................................
ENSMMUP00000019737  YKAHKSVLSANSE..YFRD.LF........................................................
ENSMMUP00000019796  -------------..----.--........................................................
ENSMMUP00000025467  IPAHRLVLSAVSD..YFAA.MF........................................................
ENSMMUP00000025466  IPAHRLVLSAVSD..YFAA.MF........................................................
ENSMMUP00000033334  IPAHRFVLAAGSA..VFDA.MF........................................................
ENSMMUP00000031332  FDVHKSVMASCSE..YFYN.IL........................................................
ENSMMUP00000017138  ----------QSV..TIKT.ML........................................................
ENSMMUP00000014427  IPAHRFVLAAGSA..VFDA.MF........................................................
ENSMMUP00000034103  FVTTRQTLGREPK..SFLC.RL........................................................
ENSMMUP00000024981  HYTTLRTLTGQDT..MLKA.MF........................................................
ENSMMUP00000015290  FVTTRQTLGREPK..SFLC.RL........................................................
ENSMMUP00000023727  FRAHKNVLAASSE..YFQS.LF........................................................
ENSMMUP00000035669  FRAHKNVLAASSE..YFQS.LF........................................................
ENSMMUP00000039489  FFAHRNVLAAVSP..LVRS.LI........................................................
ENSMMUP00000001343  -------------..---E.MF........................................................
ENSMMUP00000027673  IHVHKAVLKIRCE..HFRS.MF........................................................
ENSMMUP00000032869  FQAHKAVLAACSS..YFRM.FF........................................................
ENSMMUP00000029829  -------------..---H.MF........................................................
ENSMMUP00000024495  FRAHKLVLAAASL..LFKT.LL........................................................
ENSMMUP00000039462  -------------..----.-F........................................................
ENSMMUP00000017362  -------------..----.--........................................................
ENSMMUP00000023496  LRAHRCVLAAGSP..FFQD.KL........................................................
ENSMMUP00000024450  -------------..----.--........................................................
ENSMMUP00000027867  VPAHRAILVARCE..VMAA.MF........................................................
ENSMMUP00000015335  FRGHKVILAACSP..FLRD.QF........................................................
ENSMMUP00000038535  FKAHSNVLAASSL..YFKN.IF........................................................
ENSMMUP00000000230  FRVHRCVLGARSA..YFAN.ML........................................................
ENSMMUP00000014300  -------------..----.--........................................................
ENSMMUP00000023912  FKAHWSVLACCSH..FFQS.LY........................................................
ENSMMUP00000020387  FYAHKVLLFTASP..RFKA.LL........................................................
ENSMMUP00000000230  FLCHKAFFCGRSD..YFRA.LL........................................................
ENSMMUP00000003775  -------------..----.--........................................................
ENSMMUP00000028507  FYAHKVLLVTASN..RFKT.LM........................................................
ENSMMUP00000021793  FYAHKVLLFTASP..RFKA.LL........................................................
ENSMMUP00000000677  FQGHKVILAACST..FMRD.QF........................................................
ENSMMUP00000006314  FKAHRAVLAAFSN..YFKM.IF........................................................
ENSMMUP00000000676  VQGHKIVFAAGSP..FLRD.QF........................................................
ENSMMUP00000039849  VQGHKIVFAAGSP..FLRD.QF........................................................
ENSMMUP00000033224  FKAHKSVLASFSN..YFKM.LF........................................................
ENSMMUP00000008762  FMAHKAVLAATSK..FFKE.VF........................................................
ENSMMUP00000002939  FKAHRAILSARSS..YFAA.ML........................................................
ENSMMUP00000029460  FMAHKAVLAATSK..FFKE.VF........................................................
ENSMMUP00000000342  FSAHKVVVAVGSS..YFHA.CL........................................................
ENSMMUP00000014504  FRAHKNILSASST..YFHQ.LF........................................................
ENSMMUP00000031090  FPAHRSVLAASSP..FFRE.ALltsaplplppatggsapnpatttaassssssssssssssssasssssssssspppa
ENSMMUP00000035436  FRAHKNVLAASSA..YLKS.LV........................................................
ENSMMUP00000026976  RPAHKAILAARSS..YFEA.MF........................................................
ENSMMUP00000010614  YTARRESLCRFKD..SMLAsMF........................................................
ENSMMUP00000035434  FRAHKNVLAASSA..YLKS.LV........................................................
ENSMMUP00000038298  -----------DS..FFSS.LL........................................................
ENSMMUP00000027972  FPAHKGVLAAYSQ..FFHS.LF........................................................
ENSMMUP00000014079  FPCHKCVLCARLE..YFHS.ML........................................................
ENSMMUP00000028191  ISAHKPLLICSCE..WMAA.MF........................................................
ENSMMUP00000035799  ISAHKPLLICSCE..WMAA.MF........................................................
ENSMMUP00000035800  ISAHKPLLICSCE..WMAA.MF........................................................
ENSMMUP00000003697  ----RLVLSSVSD..YFAA.MF........................................................
ENSMMUP00000011066  WRLHKIYL-CQSG..YFSS.MF........................................................
ENSMMUP00000001153  WSLHKIYL-CQSG..YFSS.MF........................................................
ENSMMUP00000009897  IFAHKIYLSTSSS..KFYD.LFlmdlsegelggpsgpggacpedhqghpdqhhhhhhhhhgrdfllraasfdvcesvd
ENSMMUP00000014371  -------MASASD..YFKA.MF........................................................
ENSMMUP00000006589  -------------..----.--........................................................
ENSMMUP00000019047  FVVNPQIFTAHPD..TMLG.RM........................................................
ENSMMUP00000012684  FVVDPSIFTAQPN..TMLG.RM........................................................
ENSMMUP00000018177  VPAHKYF-SVGSS..VFY-.LF........................................................
ENSMMUP00000028191  IFAHRIYLATSSS..KFYD.LFlmeceespnwsegacekekqsrdfqeqilsvdseeereegpprtpqaeqwkssnks
ENSMMUP00000035799  IFAHRIYLATSSS..KFYD.LFlmeceespnwsegacekekqsrdfqeqilsvdseeereegpprtpqaeqwkssnks
ENSMMUP00000035800  IFAHRIYLATSSS..KFYD.LFlmeceespnwsegacekekqsrdfqeqilsvdseeereegpprtpqaeqwkssnks
ENSMMUP00000020974  -------------..----.--........................................................
ENSMMUP00000005376  FPVHRAILAARCP..FFKT.LL........................................................
ENSMMUP00000014079  FPAHKYILAVRSD..FFQK.LF........................................................
ENSMMUP00000000229  ----RAFFCGRSD..YFRA.LL........................................................
ENSMMUP00000006589  FSVPRSKLSQFPD..SLLW.KE........................................................
ENSMMUP00000008168  -------------..----.--........................................................
ENSMMUP00000015228  -------------..-LAA.MF........................................................
ENSMMUP00000008698  ----RFVLAVGSA..VFDA.MF........................................................
ENSMMUP00000007840  -------------..--RA.LF........................................................
ENSMMUP00000040702  -------------..----.--........................................................
ENSMMUP00000003187  FPAHSLVLAGVSQ..QLGR.--........................................................
ENSMMUP00000002939  FKAHKAVLLARVP..DFYF.HT........................................................
ENSMMUP00000002937  FKAHKAVLLARVP..DFYF.HT........................................................
ENSMMUP00000003182  FPAHSLVLAGVSQ..QLGR.--........................................................
ENSMMUP00000026976  VQGHVAIVTARSR..WLRR.KItqarerlaqkleqeaasvpreapgvaagg...........................
ENSMMUP00000005455  -------------..----.--........................................................
ENSMMUP00000009000  --VHRAALACGSE..FFGA.ML........................................................
ENSMMUP00000000640  IYAHKGLLKIVCE..HVHS.LL........................................................
ENSMMUP00000009897  ---HKPLLISSCD..WMAA.MF........................................................
ENSMMUP00000034574  -------------..----.--........................................................
ENSMMUP00000002184  -------------..--RA.LL........................................................
ENSMMUP00000018874  FLAHRALA-----..----.--........................................................
ENSMMUP00000037084  -------------..----.--........................................................
ENSMMUP00000037086  -------------..----.--........................................................
ENSMMUP00000005376  LKAHKAVISARSP..FFRN.LL........................................................
ENSMMUP00000006589  -------------..----.--........................................................
ENSMMUP00000037085  -------------..----.--........................................................
ENSMMUP00000017126  WELHQPQL-FQSE..TLAK.LYlkalmqgttyplreleellraqspkktk............................
ENSMMUP00000023270  IYAHKVLLKIRVS..--QH.QS........................................................
ENSMMUP00000027867  VEAHKIVLCAVSH..VFML.LFnvksptdiqdssiirttqdlfainrdtafpgasqes....................
ENSMMUP00000001193  LPAQRAASATASP..FFRA.LL........................................................
ENSMMUP00000025835  FCGHTIILTANLE..A-QA.LW........................................................

d1buoa_               .......................................................H...RNSQH..............
ENSMMUP00000002434  .......................................................T...GGMKEsskdv.........
ENSMMUP00000002433  .......................................................T...GGMKEsskdv.........
ENSMMUP00000006823  .......................................................S...GPGQFaenetne.......
ENSMMUP00000022077  .......................................................T...GELAEsrqte.........
ENSMMUP00000000957  .......................................................T...GGMREasqdv.........
ENSMMUP00000023470  .......................................................T...SELSEkgkpy.........
ENSMMUP00000010575  .......................................................C...NDHREsreml.........
ENSMMUP00000022822  .......................................................T...GEMSEsrakr.........
ENSMMUP00000010571  .......................................................C...NDHREsreml.........
ENSMMUP00000010572  .......................................................C...NDHREsreml.........
ENSMMUP00000006555  .......................................................M...SGLSEskqth.........
ENSMMUP00000002090  .......................................................T...TNMLEsksfe.........
ENSMMUP00000026293  .......................................................S...GGLKEsqdse.........
ENSMMUP00000026389  .......................................................S...QNSKEtsqptt........
ENSMMUP00000010669  .......................................................A...GGLKEmeqee.........
ENSMMUP00000024681  .......................................................E...HEMEEskknr.........
ENSMMUP00000030222  .......................................................V...GQAEDenknv.........
ENSMMUP00000023260  .......................................................T...GNLSEkense.........
ENSMMUP00000036581  .......................................................V...GQAEDenknv.........
ENSMMUP00000027081  .......................................................T...ADMKEkfknk.........
ENSMMUP00000015644  .......................................................T...GDMSEskakk.........
ENSMMUP00000002087  .......................................................T...TNMLEsksfe.........
ENSMMUP00000003441  .......................................................E...HEMEEskknq.........
ENSMMUP00000025168  .......................................................C...SSFREkseak.........
ENSMMUP00000023910  .......................................................A...GQLREsraer.........
ENSMMUP00000020763  .......................................................T...QMSESrqth..........
ENSMMUP00000040638  .......................................................A...GQLREsraer.........
ENSMMUP00000008445  .......................................................-...-----..............
ENSMMUP00000026256  .......................................................T...SDVCEakqee.........
ENSMMUP00000010352  .......................................................T...GGMYEsqqts.........
ENSMMUP00000025120  .......................................................T...SGAVVdqqnv.........
ENSMMUP00000014737  .......................................................T...IGMREafqke.........
ENSMMUP00000022621  .......................................................-...-----..............
ENSMMUP00000014736  .......................................................T...IGMREafqke.........
ENSMMUP00000033332  .......................................................S...LCMVEsgade.........
ENSMMUP00000006749  .......................................................S...LCMVEsgade.........
ENSMMUP00000020619  .......................................................T...AGTLAsqpyv.........
ENSMMUP00000006378  .......................................................T...GGMYEsqqas.........
ENSMMUP00000003698  .......................................................T...NDVREarqee.........
ENSMMUP00000003699  .......................................................T...NDVREarqee.........
ENSMMUP00000003696  .......................................................T...NDVREarqee.........
ENSMMUP00000006059  .......................................................E...K---Effydadsg......
ENSMMUP00000025169  .......................................................C...SSFREkseak.........
ENSMMUP00000022998  .......................................................S...GKMPTkrdsqg........
ENSMMUP00000039544  .......................................................G...GDFPTardpqg........
ENSMMUP00000012059  .......................................................T...DQLKCnlsv..........
ENSMMUP00000003069  .......................................................T...GGMKEqdlmc.........
ENSMMUP00000005739  .......................................................T...SNLKEahnrv.........
ENSMMUP00000019026  .......................................................E...KEFFFnedtk.........
ENSMMUP00000019025  .......................................................E...KEFFFnedtk.........
ENSMMUP00000005742  .......................................................T...SNLKEahnrv.........
ENSMMUP00000030686  .......................................................Y...HPETQ..............
ENSMMUP00000018201  .......................................................T...ADMRErdqdk.........
ENSMMUP00000008491  .......................................................-...-----..............
ENSMMUP00000031952  .......................................................C...SSFREkseak.........
ENSMMUP00000014752  .......................................................S...HGLREsrddt.........
ENSMMUP00000002089  .......................................................T...TNMLEsksfe.........
ENSMMUP00000030019  .......................................................Sl..NEMST..............
ENSMMUP00000025170  .......................................................C...SSFREkseak.........
ENSMMUP00000023524  .......................................................SvaeG---Dqtmnm.........
ENSMMUP00000038958  .......................................................T...CGLLEcnqre.........
ENSMMUP00000030021  .......................................................Sl..NEMST..............
ENSMMUP00000018103  .......................................................-...-----..............
ENSMMUP00000010534  .......................................................V...DQKDV..............
ENSMMUP00000000204  .......................................................C...QGEELqsdrdetg......
ENSMMUP00000000205  .......................................................C...QGEELqsdrdetg......
ENSMMUP00000027009  .......................................................L...SEIDEakkke.........
ENSMMUP00000037617  .......................................................Sl..NEMST..............
ENSMMUP00000027263  .......................................................C...QVQKTseqatv........
ENSMMUP00000024327  .......................................................A...GDFAEsfsar.........
ENSMMUP00000014401  .......................................................E...VNMKErddgs.........
ENSMMUP00000036732  .......................................................E...VNMKErddgs.........
ENSMMUP00000029120  .......................................................C...NDLKEkyekr.........
ENSMMUP00000006905  .......................................................T...NGLREqgmev.........
ENSMMUP00000026033  .......................................................I...HYIQDsgrhst........
ENSMMUP00000017930  .......................................................A...LSTMSg.............
ENSMMUP00000027974  .......................................................L...AEPERage...........
ENSMMUP00000009849  .......................................................K...SHTQEsrarv.........
ENSMMUP00000027973  .......................................................L...AEPERage...........
ENSMMUP00000005452  .......................................................L...SKITEstqke.........
ENSMMUP00000006135  .......................................................-...-----..............
ENSMMUP00000033937  .......................................................S...PKRDTandlakdskg....
ENSMMUP00000035430  .......................................................Q...NSSSQksdv..........
ENSMMUP00000006134  .......................................................-...-----..............
ENSMMUP00000017929  .......................................................Ll..KNSRR..............
ENSMMUP00000005743  .......................................................T...SNLKEahnrv.........
ENSMMUP00000039027  .......................................................L...AEPERage...........
ENSMMUP00000013437  .......................................................-...-----..............
ENSMMUP00000023621  .......................................................N...NSRSAv.............
ENSMMUP00000020548  .......................................................K...DQLDKrdi...........
ENSMMUP00000021377  .......................................................R...GRAGVgvdv..........
ENSMMUP00000030798  .......................................................Q...NSSSQksdv..........
ENSMMUP00000030800  .......................................................Q...NSSSQksdv..........
ENSMMUP00000006106  .......................................................-...---KQ..............
ENSMMUP00000041295  .......................................................-...---KQ..............
ENSMMUP00000012739  .......................................................V...GQTKNdlv...........
ENSMMUP00000012740  .......................................................V...GQTKNdlv...........
ENSMMUP00000009286  .......................................................H...RNSQH..............
ENSMMUP00000014850  .......................................................-...---KQ..............
ENSMMUP00000000376  .......................................................S...GNSKNa.............
ENSMMUP00000038684  .......................................................R...STSENn.............
ENSMMUP00000009285  .......................................................H...RNSQH..............
ENSMMUP00000038685  .......................................................R...STSENn.............
ENSMMUP00000010727  .......................................................T...SPR-Ainn...........
ENSMMUP00000032065  .......................................................C...FSNKEspnqnnt.......
ENSMMUP00000011064  .......................................................C...FSNKEspnqnnt.......
ENSMMUP00000028802  .......................................................R...STSENn.............
ENSMMUP00000016597  .......................................................V...NGKILcpfdadg.......
ENSMMUP00000039147  .......................................................-...-----..............
ENSMMUP00000028804  .......................................................R...STSENn.............
ENSMMUP00000016234  .......................................................-...-----..............
ENSMMUP00000039149  .......................................................-...-----..............
ENSMMUP00000011063  .......................................................C...FSNKEspnqnnt.......
ENSMMUP00000016235  .......................................................-...-----..............
ENSMMUP00000016233  .......................................................-...-----..............
ENSMMUP00000010726  .......................................................T...SPR-Ainn...........
ENSMMUP00000018252  .......................................................N...SDSDPhgish.........
ENSMMUP00000024617  .......................................................-...-----..............
ENSMMUP00000000919  .......................................................-...-----..............
ENSMMUP00000037246  .......................................................L...HDNLIn.............
ENSMMUP00000013275  .......................................................K...DKGVWgnkqdhrg......
ENSMMUP00000018253  .......................................................N...SDSDPhgish.........
ENSMMUP00000005453  .......................................................F...TSGATestqke........
ENSMMUP00000023548  .......................................................S...PSSPRggarrrgelprdsr
ENSMMUP00000033751  .......................................................Y...GGMREsqpeae........
ENSMMUP00000033833  .......................................................L...LGDAPr.............
ENSMMUP00000024583  .......................................................-...-----..............
ENSMMUP00000025813  .......................................................S...GRMEVltdseg........
ENSMMUP00000001402  .......................................................R...DRPAGsrdtvr........
ENSMMUP00000002937  .......................................................S...GCWAEssqey.........
ENSMMUP00000000727  .......................................................-...----Ednr...........
ENSMMUP00000024588  .......................................................-...-----..............
ENSMMUP00000021084  .......................................................Q...RSVQDsgqggrekle....
ENSMMUP00000027790  .......................................................L...NTGLDaart..........
ENSMMUP00000007841  .......................................................S...GQFSEsrsgrvemrkw...
ENSMMUP00000016103  .......................................................-...-----..............
ENSMMUP00000029806  .......................................................L...SGRIStlrdetg.......
ENSMMUP00000018718  .......................................................Q...EFTQEpl............
ENSMMUP00000028260  .......................................................T...QQQPQelardskg......
ENSMMUP00000005173  .......................................................Ll..KGMTS..............
ENSMMUP00000014526  .......................................................V...GQADGeln...........
ENSMMUP00000021082  .......................................................Q...RSVQDsgqggrekle....
ENSMMUP00000004903  .......................................................A...EEGEIgqsi..........
ENSMMUP00000014525  .......................................................V...GQADGeln...........
ENSMMUP00000035588  .......................................................V...GQADGeln...........
ENSMMUP00000039976  .......................................................L...LGYSD..............
ENSMMUP00000008505  .......................................................T...NDMMEckqde.........
ENSMMUP00000037061  .......................................................-...-----..............
ENSMMUP00000027168  .......................................................L...LGYSD..............
ENSMMUP00000024883  .......................................................Y...GELAEdkde..........
ENSMMUP00000039977  .......................................................L...LGYSD..............
ENSMMUP00000025164  .......................................................S...GRMEVltdkeg........
ENSMMUP00000030139  .......................................................-...-----..............
ENSMMUP00000028983  .......................................................K...KLEVDsssv..........
ENSMMUP00000038906  .......................................................T...EGGGGavmgaggsgtatgg
ENSMMUP00000035151  .......................................................T...TNMLEsksfe.........
ENSMMUP00000005415  .......................................................T...EGGGGavmgaggsgtatgg
ENSMMUP00000040535  .......................................................D...NTDTIs.............
ENSMMUP00000040351  .......................................................-...-----..............
ENSMMUP00000019699  .......................................................N...YNPPKddgstyk.......
ENSMMUP00000019737  .......................................................I...EKGAVssheav........
ENSMMUP00000019796  .......................................................-...-----..............
ENSMMUP00000025467  .......................................................T...NDVLEakqee.........
ENSMMUP00000025466  .......................................................T...NDVLEakqee.........
ENSMMUP00000033334  .......................................................N...GGMATtsae..........
ENSMMUP00000031332  .......................................................K...KDPSTqr............
ENSMMUP00000017138  .......................................................E...DLGMDdegdddp.......
ENSMMUP00000014427  .......................................................N...GGMATtsae..........
ENSMMUP00000034103  .......................................................C...CQEDPeldsdkdetg....
ENSMMUP00000024981  .......................................................S...GRVEVltdagg........
ENSMMUP00000015290  .......................................................C...CQEDPeldsdkdetg....
ENSMMUP00000023727  .......................................................T...NKENEsqav..........
ENSMMUP00000035669  .......................................................T...NKENEsqav..........
ENSMMUP00000039489  .......................................................S...SNDMKttdelf........
ENSMMUP00000001343  .......................................................S...SSAKAsmdaeg........
ENSMMUP00000027673  .......................................................Q...SYWNEdmkev.........
ENSMMUP00000032869  .......................................................M...NHQHStaq...........
ENSMMUP00000029829  .......................................................K...DKGVWnkqdhrg.......
ENSMMUP00000024495  .......................................................D...NTDTIs.............
ENSMMUP00000039462  .......................................................F...DSMRN..............
ENSMMUP00000017362  .......................................................-...-----..............
ENSMMUP00000023496  .......................................................L...LGHSE..............
ENSMMUP00000024450  .......................................................-...---R-..............
ENSMMUP00000027867  .......................................................N...GNYMEaksvl.........
ENSMMUP00000015335  .......................................................L...LNPSSelq...........
ENSMMUP00000038535  .......................................................W...SHTICisshv.........
ENSMMUP00000000230  .......................................................D...TKWKGksvvv.........
ENSMMUP00000014300  .......................................................-...GRDQEfkmvgg........
ENSMMUP00000023912  .......................................................G...DGSGGs.............
ENSMMUP00000020387  .......................................................S...SKPTNdstc..........
ENSMMUP00000000230  .......................................................D...DHFREseepetsggppa..
ENSMMUP00000003775  .......................................................-...-----..............
ENSMMUP00000028507  .......................................................T...NKSEQdgdsskt.......
ENSMMUP00000021793  .......................................................S...SKPTNdstc..........
ENSMMUP00000000677  .......................................................L...LTQSKh.............
ENSMMUP00000006314  .......................................................I...HQTSEcik...........
ENSMMUP00000000676  .......................................................Ll..NDSRE..............
ENSMMUP00000039849  .......................................................Ll..NDSRE..............
ENSMMUP00000033224  .......................................................V...HQTSEcvr...........
ENSMMUP00000008762  .......................................................L...NEKSGdgtrtn........
ENSMMUP00000002939  .......................................................S...GCWAEssqey.........
ENSMMUP00000029460  .......................................................L...NEKSGdgtrtn........
ENSMMUP00000000342  .......................................................S...KNPSTdv............
ENSMMUP00000014504  .......................................................S...VAGQV..............
ENSMMUP00000031090  ...................................................sppaS...SPPRV..............
ENSMMUP00000035436  .......................................................V...HDNLLn.............
ENSMMUP00000026976  .......................................................R...SFMPEdgqvn.........
ENSMMUP00000010614  .......................................................S...GRFPLktdesg........
ENSMMUP00000035434  .......................................................V...HDNLLn.............
ENSMMUP00000038298  .......................................................S...GRISTlrdetg........
ENSMMUP00000027972  .......................................................T...QNKQLqrve..........
ENSMMUP00000014079  .......................................................S...SSWIEasscaa........
ENSMMUP00000028191  .......................................................G...GSFVEsanse.........
ENSMMUP00000035799  .......................................................G...GSFVEsanse.........
ENSMMUP00000035800  .......................................................G...GSFVEsanse.........
ENSMMUP00000003697  .......................................................T...NDVREarqee.........
ENSMMUP00000011066  .......................................................S...GSWKEssmniie.......
ENSMMUP00000001153  .......................................................S...GSWKEssmniie.......
ENSMMUP00000009897  eaggsgpaglrastsdgilrgngtgylpgrgrvlsswsrafvsiqeemaedpltyK...----Srlmvv.........
ENSMMUP00000014371  .......................................................T...GGMKEqdlmc.........
ENSMMUP00000006589  .......................................................-...-----..............
ENSMMUP00000019047  .......................................................F...GPGREynftrpnekgey..
ENSMMUP00000012684  .......................................................F...GSGREhnftrpnekgey..
ENSMMUP00000018177  .......................................................Y...GDLAEvkse..........
ENSMMUP00000028191  ..............lvealgleaegavpetqtladwskgfigmhremqvnpiskrV...GPVTV..............
ENSMMUP00000035799  ..............lvealgleaegavpetqtladwskgfigmhremqvnpiskrV...GPVTV..............
ENSMMUP00000035800  ..............lvealgleaegavpetqtladwskgfigmhremqvnpiskrV...GPVTV..............
ENSMMUP00000020974  .......................................................-...-----..............
ENSMMUP00000005376  .......................................................S...SSPEYgaeiimd.......
ENSMMUP00000014079  .......................................................L...SDGSTseftdiyrkdedsa
ENSMMUP00000000229  .......................................................D...DHFREseepetsggppa..
ENSMMUP00000006589  .......................................................A...SALTSsesq..........
ENSMMUP00000008168  .......................................................-...-----..............
ENSMMUP00000015228  .......................................................S...GRHYIptdseg........
ENSMMUP00000008698  .......................................................N...GGMATtste..........
ENSMMUP00000007840  .......................................................T...SGWNNtekkv.........
ENSMMUP00000040702  .......................................................-...----Qth............
ENSMMUP00000003187  .......................................................-...-RGQW..............
ENSMMUP00000002939  .......................................................L...GQTSNsltnqep.......
ENSMMUP00000002937  .......................................................L...GQTSNsltnqep.......
ENSMMUP00000003182  .......................................................-...-RGQW..............
ENSMMUP00000026976  .......................................................T...---RPpllh..........
ENSMMUP00000005455  .......................................................-...STQKE..............
ENSMMUP00000009000  .......................................................L...SGMREsqgte.........
ENSMMUP00000000640  .......................................................E...GNEDNi.............
ENSMMUP00000009897  .......................................................G...GPFVEsstre.........
ENSMMUP00000034574  .......................................................-...----Akr............
ENSMMUP00000002184  .......................................................Y...GGMREsqpeae........
ENSMMUP00000018874  .......................................................-...-----..............
ENSMMUP00000037084  .......................................................-...----E..............
ENSMMUP00000037086  .......................................................-...----E..............
ENSMMUP00000005376  .......................................................Q...RRIRTgeeitdrtlrtptr
ENSMMUP00000006589  .......................................................-...----Et.............
ENSMMUP00000037085  .......................................................-...-----..............
ENSMMUP00000017126  .......................................................E...----Kspakrmiis.....
ENSMMUP00000023270  .......................................................T...QRFTEd.............
ENSMMUP00000027867  .......................................................S...GNPPLr.............
ENSMMUP00000001193  .......................................................S...GSFAEaqmdl.........
ENSMMUP00000025835  .......................................................K...EPGSNvt............

                                 70         80                90                                    
                                  |          |                 |                                    
d1buoa_               .....YTLDF..LSPKTF.QQILEYAYTATLQ...A.....KAE.D................................
ENSMMUP00000002434  .....VPILG..IEAGIF.QILLDFVYTGIVN...I.....GVN.N................................
ENSMMUP00000002433  .....VPILG..IEAGIF.QILLDFVYTGIVN...I.....GVN.N................................
ENSMMUP00000006823  .....VNFRE..IPSHVLsKVCMYFTYKVRYT...N.....SST.Eipefpiapei......................
ENSMMUP00000022077  .....VVIRD..IDERAM.ELLIDFAYTSQIT...V.....EEG.N................................
ENSMMUP00000000957  .....IELKG..VSARGL.RHIIDFAYSAEVT...L.....DLD.C................................
ENSMMUP00000023470  .....VDIQG..LTASTM.EILLDFVYTETVH...V.....TVE.N................................
ENSMMUP00000010575  .....VEING..ILAEAM.ECFLQYVYTGKVK...I.....TTE.N................................
ENSMMUP00000022822  .....VRIKE..VDGWTL.RMLIDYVYTAEIQ...V.....TEE.N................................
ENSMMUP00000010571  .....VEING..ILAEAM.ECFLQYVYTGKVK...I.....TTE.N................................
ENSMMUP00000010572  .....VEING..ILAEAM.ECFLQYVYTGKVK...I.....TTE.N................................
ENSMMUP00000006555  .....VHLRN..VDAATL.QIIITYAYTGNLA...M.....NDS.T................................
ENSMMUP00000002090  .....VELKD..AEPDII.EQLVEFAYTARIS...V.....NSN.N................................
ENSMMUP00000026293  .....VNFDNs.IHPEVL.ELLLDYAYSSRVI...I.....NEE.N................................
ENSMMUP00000026389  .....ATFQA..FSPDTF.TVILDFVYSGKLS...L.....TGQ.N................................
ENSMMUP00000010669  .....VLIHG..VSYNAM.CQILHFIYTSELE...L.....SLS.N................................
ENSMMUP00000024681  .....VEIND..VEPEVF.KEMMCFIYTGKAP...N.....LDK.M................................
ENSMMUP00000030222  .....LDLHH..VTVTGF.IPLLEYAYTATLS...I.....NTE.N................................
ENSMMUP00000023260  .....VEFQC..IDETAL.QAIVEYAYTGTVF...I.....SQD.T................................
ENSMMUP00000036581  .....LDLHH..VTVTGF.IPLLEYAYTATLS...I.....NTE.N................................
ENSMMUP00000027081  .....IKLSG..IHHDIL.EGLVNYAYTSQIE...I.....TKR.N................................
ENSMMUP00000015644  .....IEIKD..VDGQTL.SKLIDYIYTAEIE...V.....TEE.N................................
ENSMMUP00000002087  .....VELKD..AEPDII.EQLVEFAYTARIS...V.....NSN.N................................
ENSMMUP00000003441  .....VEIND..LDPEVF.KEMMRFIYTGRAP...N.....LDK.M................................
ENSMMUP00000025168  .....VQLKG..IDPPTL.DQIVSYVYTGEAR...I.....DAD.N................................
ENSMMUP00000023910  .....VRLHG..VPPDML.QLLLDFSYTGRVA...V.....SGD.N................................
ENSMMUP00000020763  .....VTLHD..IDPQAL.DQLVQFAYTAEIV...V.....GEG.N................................
ENSMMUP00000040638  .....VRLHG..VPPDML.QLLLDFSYTGRVA...V.....SGD.N................................
ENSMMUP00000008445  .....--FFD..RHPGVF.AHILNYYRTGKLH...C.....PAD.V................................
ENSMMUP00000026256  .....IKMEG..IDPNAL.WDLVQFAYTGCLE...L.....KED.T................................
ENSMMUP00000010352  .....VTMHD..VDAESF.EVLVDYCYTGRVS...L.....SEA.N................................
ENSMMUP00000025120  .....YEIDF..VSAEAL.TALMDFAYTATLT...V.....STA.N................................
ENSMMUP00000014737  .....VELIG..ASYIGL.KAVVDFLYGGELV...L.....DGG.N................................
ENSMMUP00000022621  .....-YYFD..RNPSLF.RYVLNFYYTGKLH...V.....MEE.Lc...............................
ENSMMUP00000014736  .....VELIG..ASYIGL.KAVVDFLYGGELV...L.....DGG.N................................
ENSMMUP00000033332  .....VNLHG..VTSLGL.KQALEFAYTGQIL...L.....EPG.V................................
ENSMMUP00000006749  .....VNLHG..VTSLGL.KQALEFAYTGQIL...L.....EPG.V................................
ENSMMUP00000020619  .....YEIDF..VQPEAL.AAILEFAYTSTLT...I.....TAG.N................................
ENSMMUP00000006378  .....VTMHD..VDAESF.EVLVDYCYTGRVS...L.....SEA.N................................
ENSMMUP00000003698  .....IKMEG..VEPNSL.WSLIQYAYTGRLE...L.....KED.N................................
ENSMMUP00000003699  .....IKMEG..VEPNSL.WSLIQYAYTGRLE...L.....KED.N................................
ENSMMUP00000003696  .....IKMEG..VEPNSL.WSLIQYAYTGRLE...L.....KED.N................................
ENSMMUP00000006059  .....EYFFD..RDPDMF.RHVLNFYRTGRLH...C.....PRQ.E................................
ENSMMUP00000025169  .....VQLKG..IDPPTL.DQIVSYVYTGEAR...I.....DAD.N................................
ENSMMUP00000022998  .....NCFID..RDGKVF.RYILNFLRTSHLD...L.....PED.Fqe..............................
ENSMMUP00000039544  .....NYFID..RDGPLF.RYVLNFLRTSELTlp.L.....DFK.E................................
ENSMMUP00000012059  .....INLDPe.INPEGF.CILLDFMYTSRLN...L.....REG.N................................
ENSMMUP00000003069  .....IKLHG..VSKVGL.RKIIDFIYTAKLS...L.....NMD.N................................
ENSMMUP00000005739  .....IVLQD..VSESVF.QLLVDYIYHGTVK...L.....RAE.E................................
ENSMMUP00000019026  .....EYFFD..RDPEVF.RCVLNFYRTGKLH...Y.....PRY.E................................
ENSMMUP00000019025  .....EYFFD..RDPEVF.RCVLNFYRTGKLH...Y.....PRY.E................................
ENSMMUP00000005742  .....IVLQD..VSESVF.QLLVDYIYHGTVK...L.....RAE.E................................
ENSMMUP00000030686  .....QYFFD..RDPDIF.RHILNFYRTGKLH...Y.....PRH.E................................
ENSMMUP00000018201  .....IHLKG..LTATGF.SHVLQFMYYGTIE...L.....SMN.T................................
ENSMMUP00000008491  .....--FFD..RHPGAF.TSILNFYRTGRLH...M.....MEE.Mc...............................
ENSMMUP00000031952  .....VQLKG..IDPPTL.DQIVSYVYTGEAR...I.....DAD.N................................
ENSMMUP00000014752  .....VNFQDn.LHPEVL.ELLLDFAYSSRIA...I.....NEE.N................................
ENSMMUP00000002089  .....VELKD..AEPDII.EQLVEFAYTARIS...V.....NSN.N................................
ENSMMUP00000030019  .....VSISVi.KNPTVF.EQLLSFCYTGRIC...L.....QLA.D................................
ENSMMUP00000025170  .....VQLKG..IDPPTL.DQIVSYVYTGEAR...I.....DAD.N................................
ENSMMUP00000023524  .....IQLDSevVTAEAF.AALIDMMYTSTLM...L.....GES.N................................
ENSMMUP00000038958  .....VVLYD..ITAESV.LVLLNYMYNASLE...I.....NNA.N................................
ENSMMUP00000030021  .....VSISVi.KNPTVF.EQLLSFCYTGRIC...L.....QLA.D................................
ENSMMUP00000018103  .....EYFFD..RHPGAF.TSILNFYRTGKLH...M.....MEE.M................................
ENSMMUP00000010534  .....VHLDI..SNAAGL.GQVLEFMYTAKLS...L.....SPE.N................................
ENSMMUP00000000204  .....AYLID..RDPTYF.GPILNFLRHGKLV...L.....DKD.Ma...............................
ENSMMUP00000000205  .....AYLID..RDPTYF.GPILNFLRHGKLV...L.....DKD.Ma...............................
ENSMMUP00000027009  .....VVLDN..VDPAIL.DLIIKYLYSASID...L.....NDG.N................................
ENSMMUP00000037617  .....VSISVi.KNPTVF.EQLLSFCYTGRIC...L.....QLA.D................................
ENSMMUP00000027263  .....THLDI..VTAQGF.KAIIDFMYSAHLA...L.....TSR.N................................
ENSMMUP00000024327  .....VELRD..VEPAVV.GQLVDFVYTGRLT...I.....TQG.N................................
ENSMMUP00000014401  .....VTITN..LSSKAV.KAFLDYAYTGKTK...I.....TDD.N................................
ENSMMUP00000036732  .....VTITN..LSSKAV.KAFLDYAYTGKTK...I.....TDD.N................................
ENSMMUP00000029120  .....IIIKG..VDAETM.HTLLDYTYTSKAL...I.....TKQ.N................................
ENSMMUP00000006905  .....VSIEG..IHPKVM.ERLIEFAYTASIS...M.....GEK.C................................
ENSMMUP00000026033  .....ASLDI..VTSDAF.SIILDFLYSGKLD...L.....CGE.N................................
ENSMMUP00000017930  .....LSISVi.KNPNVF.EQLLSFCYTGRMS...L.....QLK.D................................
ENSMMUP00000027974  .....LHLEE..VSPDVV.AQVLHYLYTSEIA...L.....DEA.S................................
ENSMMUP00000009849  .....IHLHV..PSAAGL.QRLLDFIYTAWLS...L.....SMD.T................................
ENSMMUP00000027973  .....LHLEE..VSPDVV.AQVLHYLYTSEIA...L.....DEA.S................................
ENSMMUP00000005452  .....VRIVG..VEAESM.DLVLNYAYTSRVI...L.....TEA.N................................
ENSMMUP00000006135  .....---FD..RHPGVF.AYVLNYYRTGKLH...C.....PAD.V................................
ENSMMUP00000033937  .....RFFID..RDGFLF.RYILDYLRDRQVV...L.....PDH.Fpe..............................
ENSMMUP00000035430  .....FHLDV..KNVSGI.GQILDFMYTSHLD...L.....NQD.N................................
ENSMMUP00000006134  .....---FD..RHPGVF.AYVLNYYRTGKLH...C.....PAD.V................................
ENSMMUP00000017929  .....IVLPDv.MNPRVF.ENILLSSYTGRLV...M.....PAP.E................................
ENSMMUP00000005743  .....IVLQD..VSESVF.QLLVDYIYHGTVK...L.....RAE.E................................
ENSMMUP00000039027  .....LHLEE..VSPDVV.AQVLHYLYTSEIA...L.....DEA.S................................
ENSMMUP00000013437  .....-FYFD..RNPELF.PYVLHFYHTGKLH...V.....MAE.-................................
ENSMMUP00000023621  .....VELPAa.VQPQSF.QQILSFCYTGRLS...M.....NVG.D................................
ENSMMUP00000020548  .....VHLNSdiVTAPAF.ALLLEFMYEGKLQ...F.....KDL.P................................
ENSMMUP00000021377  .....LSLPGg.PEARGF.APLLDFMYTSRLR...L.....SPA.T................................
ENSMMUP00000030798  .....FHLDV..KNVSGI.GQILDFMYTSHLD...L.....NQD.N................................
ENSMMUP00000030800  .....FHLDV..KNVSGI.GQILDFMYTSHLD...L.....NQD.N................................
ENSMMUP00000006106  .....HYFID..RDGQMF.RYILNFLRTSKLL...I.....PDD.Fkd..............................
ENSMMUP00000041295  .....HYFID..RDGQMF.RYILNFLRTSKLL...I.....PDD.Fkd..............................
ENSMMUP00000012739  .....VSLPEe.VTARGF.GPLLQFAYTAKLL...L.....SRE.N................................
ENSMMUP00000012740  .....VSLPEe.VTARGF.GPLLQFAYTAKLL...L.....SRE.N................................
ENSMMUP00000009286  .....YTLDF..LSPKTF.QQILEYAYTATLQ...A.....KAE.D................................
ENSMMUP00000014850  .....HYFID..RDGEIF.RYVLSFLRTSKLL...L.....PDD.Fkd..............................
ENSMMUP00000000376  .....FELPGs.VPPACF.QQILSFCYTGRLT...M.....TAS.E................................
ENSMMUP00000038684  .....VFLDQsqVKADGF.QKLLEFIYTGTLN...L.....DSW.N................................
ENSMMUP00000009285  .....YTLDF..LSPKTF.QQILEYAYTATLQ...A.....KAE.D................................
ENSMMUP00000038685  .....VFLDQsqVKADGF.QKLLEFIYTGTLN...L.....DSW.N................................
ENSMMUP00000010727  .....LVLQG..CSSIGL.RLVLEYLYTANVT...L.....SLD.T................................
ENSMMUP00000032065  .....THLDI..AAVQGF.SVILDFLYSGNLV...L.....TSQ.N................................
ENSMMUP00000011064  .....THLDI..AAVQGF.SVILDFLYSGNLV...L.....TSQ.N................................
ENSMMUP00000028802  .....VFLDQsqVKADGF.QKLLEFIYTGTLN...L.....DSW.N................................
ENSMMUP00000016597  .....HYFID..RDGLLF.RHVLNFLRNGELL...L.....PEG.Fre..............................
ENSMMUP00000039147  .....---FD..RHPGVF.AYVLNYYRTGKLH...C.....PAD.V................................
ENSMMUP00000028804  .....VFLDQsqVKADGF.QKLLEFIYTGTLN...L.....DSW.N................................
ENSMMUP00000016234  .....---FD..RHPGVF.AYVLNYYRTGKLH...C.....PAD.V................................
ENSMMUP00000039149  .....---FD..RHPGVF.AYVLNYYRTGKLH...C.....PAD.V................................
ENSMMUP00000011063  .....THLDI..AAVQGF.SVILDFLYSGNLV...L.....TSQ.N................................
ENSMMUP00000016235  .....---FD..RHPGVF.AYVLNYYRTGKLH...C.....PAD.V................................
ENSMMUP00000016233  .....---FD..RHPGVF.AYVLNYYRTGKLH...C.....PAD.V................................
ENSMMUP00000010726  .....LVLQG..CSSIGL.RLVLEYLYTANVT...L.....SLD.T................................
ENSMMUP00000018252  .....VKFDD..LNPEAV.EVLLNYAYTAQLK...A.....DKE.L................................
ENSMMUP00000024617  .....-YFFD..RSSQAF.RYVLHYYRTGRLHv..M.....EQL.C................................
ENSMMUP00000000919  .....--FFD..RNPGAF.GTILTFLRAGKLR...L.....LRE.-................................
ENSMMUP00000037246  .....LDTDM..VSSTVF.QQILDFIYTGKLL...P.....SDQ.Paepn............................
ENSMMUP00000013275  .....AFLID..RSPEYF.EPILNYLRHGQLI...V.....NDGiN................................
ENSMMUP00000018253  .....VKFDD..LNPEAV.EVLLNYAYTAQLK...A.....DKE.L................................
ENSMMUP00000005453  .....VRIVG..VEAESM.DLVLNYAYTSRVI...L.....TEA.N................................
ENSMMUP00000023548  ....aRFFID..RDGFLF.RYVLDYLRDKQLA...L.....PEH.Fpe..............................
ENSMMUP00000033751  .....IPLQD..TTAEAF.TMLLKYIYTGRAT...L.....TDE.Keev.............................
ENSMMUP00000033833  .....LTLPSv.IEADAF.EGLLQLIYSGRLR...L.....PLD.A................................
ENSMMUP00000024583  .....-YFFD..RNRPSF.DAILYY-------...-.....---.-................................
ENSMMUP00000025813  .....WILID..RCGKHF.GTILNYLRDGAVP...L.....PES.Rre..............................
ENSMMUP00000001402  .....LNCDI..VTAPAF.GRLLDFMYEGRLD...L.....RSL.P................................
ENSMMUP00000002937  .....VTLQG..ISHVEL.NVMMHFIYGGTLD...I.....PDKtN................................
ENSMMUP00000000727  .....EFFFD..RSPSAF.GVIVSFLAAGKLV...L.....LQE.Mc...............................
ENSMMUP00000024588  .....----D..RNRPSF.DAILYY-------...-.....---.-................................
ENSMMUP00000021084  .....LVLSN..LQADVL.ELLLEFVYTGSLV...I.....DSA.N................................
ENSMMUP00000027790  .....YVVDF..ITPANF.EKVLSFVYTSELF...T.....DLI.N................................
ENSMMUP00000007841  .....SSEPG..PEPDTV.EAVIEYMYTGRIR...V.....STG.S................................
ENSMMUP00000016103  .....EYFFD..RNRPSF.DAILYYY------...-.....---.-................................
ENSMMUP00000029806  .....AIFID..RDPAAF.APILNFLRTKELD...L.....RGV.S................................
ENSMMUP00000018718  .....VEIEG..VSKMAF.RHLIEFTYTAKLM...Iq....GEE.E................................
ENSMMUP00000028260  .....RFFLD..RDGFLF.RYILDYLRDLQLV...L.....PDY.Fpe..............................
ENSMMUP00000005173  .....ISLPSv.MDPGAF.ETVLASAYTGRLS...M.....AAA.D................................
ENSMMUP00000014526  .....ITLPEe.VTVKGF.EPLIQFAYTAKLI...L.....SKE.N................................
ENSMMUP00000021082  .....LVLSN..LQADVL.ELLLEFVYTGSLV...I.....DSA.N................................
ENSMMUP00000004903  .....YMLEG..MVADTF.GILLEFIYTGYLH...A.....SEK.S................................
ENSMMUP00000014525  .....ITLPEe.VTVKGF.EPLIQFAYTAKLI...L.....SKE.N................................
ENSMMUP00000035588  .....ITLPEe.VTVKGF.EPLIQFAYTAKLI...L.....SKE.N................................
ENSMMUP00000039976  .....IEIPSv.VSVQSV.QKLIDFMYSGVLR...V.....SQS.E................................
ENSMMUP00000008505  .....IVMQG..MDPSAL.EALINFAYNGNLA...I.....DQQ.N................................
ENSMMUP00000037061  .....EYFFD..RNRPSF.DAILYY-------...-.....---.-................................
ENSMMUP00000027168  .....IEIPSv.VSVQSV.QKLIDFMYSGVLR...V.....SQS.E................................
ENSMMUP00000024883  .....IRIPD..VEPAAF.LAMLKYIYCDEID...L.....AAD.T................................
ENSMMUP00000039977  .....IEIPSv.VSVQSV.QKLIDFMYSGVLR...V.....SQS.E................................
ENSMMUP00000025164  .....WILID..RCGKHF.GTILNYLRDDTIT...L.....PQN.Rqe..............................
ENSMMUP00000030139  .....-----..R-----.-------------...-.....---.-................................
ENSMMUP00000028983  .....IEIDF..LRSDIF.EEVLNYMYTAKIS...V.....KKE.D................................
ENSMMUP00000038906  agagvCELDF..VGPEAL.GALLEFAYTATLT...T.....SSA.N................................
ENSMMUP00000035151  .....VELKD..AEPDII.EQLVEFAYTARIS...V.....NSN.N................................
ENSMMUP00000005415  agagvCELDF..VGPEAL.GALLEFAYTATLT...T.....SSA.N................................
ENSMMUP00000040535  .....IDASV..VSPEEF.ALLLEMMYTGKLP...V.....GKH.N................................
ENSMMUP00000040351  .....-YFFD..RNRPSF.DAILYYY------...-.....---.-................................
ENSMMUP00000019699  .....IELEG..ISVMVM.REILDYIFSGQIR...L.....NED.T................................
ENSMMUP00000019737  .....VDLSG..FCKASF.LPLLEFAYTSVLS...F.....DFC.S................................
ENSMMUP00000019796  .....EYFFD..RDPAVF.QLVYNFYLSGVLL...V.....LDE.-................................
ENSMMUP00000025467  .....VRMEG..VDPNAL.NSLVQYAYTGILQ...L.....KED.T................................
ENSMMUP00000025466  .....VRMEG..VDPNAL.NSLVQYAYTGILQ...L.....KED.T................................
ENSMMUP00000033334  .....IELPD..VEPAAF.LALLRFLYSDEVQ...I.....GPE.T................................
ENSMMUP00000031332  .....VDLND..ISPLGL.ATVIAYAYTGKLT...L.....SLY.T................................
ENSMMUP00000017138  .....VPLPN..VNAAIL.KKVIQWCTH----...-.....---.-................................
ENSMMUP00000014427  .....IELPD..VEPAAF.LALLRFLYSDEVQ...I.....GPE.T................................
ENSMMUP00000034103  .....AYLID..RDPTYF.GPILNYLRHGKLI...I.....TKE.L................................
ENSMMUP00000024981  .....WVLID..RSGRHF.GTILNYLRDGSVP...L.....PES.Tre..............................
ENSMMUP00000015290  .....AYLID..RDPTYF.GPILNYLRHGKLI...I.....TKE.L................................
ENSMMUP00000023727  .....FQLDF..CEPDAF.DNVLNYIYSSSLF...V.....EKS.S................................
ENSMMUP00000035669  .....FQLDF..CEPDAF.DNVLNYIYSSSLF...V.....EKS.S................................
ENSMMUP00000039489  .....ITIDSsyLSPVTV.DQLLDYFYSGKVV...I.....SEQ.N................................
ENSMMUP00000001343  .....RFFID..RPSTYF.RPILDYLRTGQVP...-.....-TQ.H................................
ENSMMUP00000027673  .....IEIDQ..FSYPVY.RAFLQYLYTDTVD...L.....PPE.D................................
ENSMMUP00000032869  .....LNLSNmkISAECF.DLILQFMYLGKIM...T.....APS.S................................
ENSMMUP00000029829  .....AFLID..QSPEYF.EPILNYLHHGQLV...V.....NDGiN................................
ENSMMUP00000024495  .....IDASV..VSPEEF.ALLLEMMYTGKLP...V.....GKH.N................................
ENSMMUP00000039462  .....EYFFD..RNRPSF.DGILY--------...-.....---.-................................
ENSMMUP00000017362  .....----D..RHPGFF.LGLLHFYRTGHLHv..L.....DEL.C................................
ENSMMUP00000023496  .....IRVPPv.VPAQTV.RQLVEFLYSGSLV...V.....AQG.E................................
ENSMMUP00000024450  .....-----..------.-------------...-.....---.-................................
ENSMMUP00000027867  .....IPVYG..VSKETF.LSFLEYLYTDSCCp..A.....GIF.Q................................
ENSMMUP00000015335  .....VSLM-..HSARIV.ADLLLSCYTGALE...F.....AVR.D................................
ENSMMUP00000038535  .....LELDD..LKAEVF.TEILNYIYSSTVV...Vk....RQE.T................................
ENSMMUP00000000230  .....L--RHplINPVAF.GALLQYLYTGRLD...I.....GVE.H................................
ENSMMUP00000014300  .....QIFVD..RDGVLF.SFILDFLRTHQLLlp.T.....DFS.D................................
ENSMMUP00000023912  .....VVLPA..GFAEIF.GLLLDFFYTGHLA...L.....TSG.N................................
ENSMMUP00000020387  .....IEIGY..VKYSIF.QLVMQYLYYGGPEsllI.....KNN.E................................
ENSMMUP00000000230  .....ITLHG..ISPDIF.THVLYYVYSDHTE...L.....SPE.A................................
ENSMMUP00000003775  .....---FD..RDPDAF.KCVIEVYYFGEVH...M.....KK-.-................................
ENSMMUP00000028507  .....IEISD..MKYHIF.QMMMQYLYYGGTEsmeI.....PTA.D................................
ENSMMUP00000021793  .....IEIGY..VKYSIF.QLVMQYLYYGGPEsllI.....KNN.E................................
ENSMMUP00000000677  .....VRITIl.QSAEVG.RKLLLSCYTGALE...V.....KRK.E................................
ENSMMUP00000006314  .....IQPTD..IQPDIF.SYLLHIMYTGK--...-.....---.-................................
ENSMMUP00000000676  .....VKISIl.QSSEVG.RQLLLSCYSGVLE...F.....PEM.E................................
ENSMMUP00000039849  .....VKISIl.QSSEVG.RQLLLSCYSGVLE...F.....PEM.E................................
ENSMMUP00000033224  .....LKPTD..IQPDIF.SYLLHLMYTGKMA...P.....QL-.-................................
ENSMMUP00000008762  .....VYLNE..VQVADF.ASFLEFVYTAKVQ...V.....EED.R................................
ENSMMUP00000002939  .....VTLQG..ISHVEL.NVMMHFIYGGTLD...I.....PDK.T................................
ENSMMUP00000029460  .....VYLNE..VQVADF.ASFLEFVYTAKVQ...V.....EED.R................................
ENSMMUP00000000342  .....VTLDH..VTHSVF.QHLLEFLYTSEFF...V.....YKY.E................................
ENSMMUP00000014504  .....VELSF..IRAEIF.AEILNYIYSSKIVr..V.....RSD.L................................
ENSMMUP00000031090  .....LELPG..VPAAAF.SDVLNFIYSARLA...L.....PGG.Ggdgaa...........................
ENSMMUP00000035436  .....LDHDM..VSPAVF.RLVLDFIYTGRLA...X.....P--.-................................
ENSMMUP00000026976  .....ISIGEmvPSRQAF.ESMLRYIYYGETV...F.....FWG.Gdscylfaapyyygfynnrlqayckqnlemnvt
ENSMMUP00000010614  .....ACVID..RDGRLF.KYLLDYLH-GEVQip.T.....DEQ.T................................
ENSMMUP00000035434  .....LDHDM..VSPAVF.RLVLDFIYTGRLA...P.....---.-................................
ENSMMUP00000038298  .....AIFID..RDPAAF.APILNFLRTKELD...L.....RGV.S................................
ENSMMUP00000027972  .....LSLEA..LAPGGL.QQILNFIYTSKLL...V.....NAA.N................................
ENSMMUP00000014079  .....LEMP-..IHSDIL.KVILDYLYTDEAV...VikesqNVD.F................................
ENSMMUP00000028191  .....VYLPN..INKISM.QAVLDYLYTKQLS...P.....NLD.Ld...............................
ENSMMUP00000035799  .....VYLPN..INKISM.QAVLDYLYTKQLS...P.....NLD.Ld...............................
ENSMMUP00000035800  .....VYLPN..INKISM.QAVLDYLYTKQLS...P.....NLD.Ld...............................
ENSMMUP00000003697  .....IKMEG..VEPNSL.WSLIQYAYTGRLE...L.....KED.N................................
ENSMMUP00000011066  .....LEIPDqnIDVEAL.QVAFGSLYRDDVL...I.....KPS.R................................
ENSMMUP00000001153  .....LEIPDqnIDVEAL.QVAFGSLYRDDVL...I.....KPS.R................................
ENSMMUP00000009897  .....VKMDNs.IQPGPF.RAVLKYLYTGELD...E.....NER.D................................
ENSMMUP00000014371  .....IKLHG..VNKVGL.KKIIDFIYTAKLS...L.....NMD.N................................
ENSMMUP00000006589  .....--LIH..GDGQMF.RHILNFLRLGKLF...L.....PSE.F................................
ENSMMUP00000019047  .....EIAEG..ISATVF.RTVLDYYKTGIIN...C.....PDG.Is...............................
ENSMMUP00000012684  .....EVAEG..IGSTVF.RAILDYYKTGIIR...C.....PDG.Is...............................
ENSMMUP00000018177  .....IHIPD..VEPAAF.LILLKYMYSDEID...L.....EAD.T................................
ENSMMUP00000028191  .....VRMDAs.VQPGPF.RTLLQFLYTGQLD...E.....KEK.D................................
ENSMMUP00000035799  .....VRMDAs.VQPGPF.RTLLQFLYTGQLD...E.....KEK.D................................
ENSMMUP00000035800  .....VRMDAs.VQPGPF.RTLLQFLYTGQLD...E.....KEK.D................................
ENSMMUP00000020974  .....-YLID..RDPTYF.GPVLNYLRHGKLV...I.....NKD.La...............................
ENSMMUP00000005376  .....INTAG..IDMPMF.SALLHYLYTGEFG...M.....EDS.R................................
ENSMMUP00000014079  .gchlFVVEK..VHPDMF.EYLLQFIYTDTCD...-.....---.-................................
ENSMMUP00000000229  .....ITLHG..ISPDIF.THVLYYVYSDHTE...L.....SPE.A................................
ENSMMUP00000006589  .....RLFID..RDGSTF.RHVHYYLYTSKLS...F.....SSC.A................................
ENSMMUP00000008168  .....--FID..RDGKAF.RHILNFLRLGRLD...L.....PRG.Yge..............................
ENSMMUP00000015228  .....RYFID..RDGTHF.GDVLNFLRSGDLP...-.....PRE.R................................
ENSMMUP00000008698  .....IELPD..VEPAAF.LALLKFLYSDEVQ...I.....GPE.T................................
ENSMMUP00000007840  .....YNIPG..ISPDMM.KLIIEYAYTRTVP...I.....TPD.N................................
ENSMMUP00000040702  .....VTLHD..IDPQAL.DQLVQFAYTAEIV...V.....GEG.N................................
ENSMMUP00000003187  .....ALGEG..ISPSTF.AQLLHFVYGESVE...L.....QPG.E................................
ENSMMUP00000002939  .....VAVEN..VEALEF.RTFLQIIYSSNRN...-.....---.-................................
ENSMMUP00000002937  .....VAVEN..VEALEF.RTFLQIIYSSNRN...-.....---.-................................
ENSMMUP00000003182  .....ALGEG..ISPSTF.AQLLHFVYGESVE...L.....QPG.E................................
ENSMMUP00000026976  .....VAIRE..AEARPF.EVLMQFLYTDKIK...Y.....PRK.Ghvedvll.........................
ENSMMUP00000005455  .....VRIVG..VEAESM.DLVLNYAYTSRVI...L.....TEA.N................................
ENSMMUP00000009000  .....VSLRT..ISTQDL.RLLVSFAYSGVVR...A.....RWP.G................................
ENSMMUP00000000640  .....VEMSE..FSYSAY.WAFLEFVYTNSTS...L.....SPE.Eavglldlvafykenqlnnqgicees.......
ENSMMUP00000009897  .....VVFPY..TSKSCM.RAVLEYLYTGMFTs..S.....PDL.D................................
ENSMMUP00000034574  .....VRIKE..VDGWTL.RMLIDYVYTAEIQ...V.....TEE.N................................
ENSMMUP00000002184  .....IPLQD..TTAEAF.TMLLKYIYTGRAT...L.....TDE.Keev.............................
ENSMMUP00000018874  .....-----..------.------------L...R.....GDT.P................................
ENSMMUP00000037084  .....LEMHT..ISSKVF.GDILDFAYTSRIV...V.....RLE.S................................
ENSMMUP00000037086  .....LEMHT..ISSKVF.GDILDFAYTSRIV...V.....RLE.S................................
ENSMMUP00000005376  .....IILDEsiIPKKYA.KVILHCMYTDVVD...L.....SVL.H................................
ENSMMUP00000006589  .....VALIE..CECSEF.RFIVNFLRSQKIL...Lpd...NFS.N................................
ENSMMUP00000037085  .....-----..ISSKVF.GDILDFAYTSRIV...V.....RLE.S................................
ENSMMUP00000017126  .....LKINDplVTKVAF.ATALKNLYVSEVE...I.....NLE.D................................
ENSMMUP00000023270  .....Y-IQ-..---NTV.RIISEWLS-EMLE...I.....TPP.Nkhif............................
ENSMMUP00000027867  .....VIVKDa.VFCSCL.SDILRFIYSGA--...-.....---.-................................
ENSMMUP00000001193  .....VPLRG..LSPGAA.WPILHHLHGCRGC...G.....AAL.Gpvpppgqpllgse...................
ENSMMUP00000025835  .....ISVDA..ECVPMV.RDFLRYFYSRRID...I.....ALS.S................................

                              100       110       120                                               
                                |         |         |                                               
d1buoa_               ...LDDLL.YAAEILEIEYLEEQCLKMLE---tiq...........................................
ENSMMUP00000002434  ...VQELI.VAADMLQLTEVVHLCCEFLK---g.............................................
ENSMMUP00000002433  ...VQELI.VAADMLQLTEVVHLCCEFLK---g.............................................
ENSMMUP00000006823  ...ALELL.MAANFLD----------------c.............................................
ENSMMUP00000022077  ...VQTLL.PAACLLQLAEIQEACCEFLK---r.............................................
ENSMMUP00000000957  ...VQDVL.GAAVFLQMLPVVELCEEFL----k.............................................
ENSMMUP00000023470  ...VQELL.PAACLLQLKGVKQACCEFLE---s.............................................
ENSMMUP00000010575  ...VQYLF.ETSSLFQISVLRDACAKFLE---e.............................................
ENSMMUP00000022822  ...VQVLL.PAAGLLQLQDVKKTCCEFLE---s.............................................
ENSMMUP00000010571  ...VQYLF.ETSSLFQISVLRDACAKFLE---e.............................................
ENSMMUP00000010572  ...VQYLF.ETSSLFQISVLRDACAKFLE---e.............................................
ENSMMUP00000006555  ...VEQLY.ETACFLQVEDVLQRCREYLIK--..............................................
ENSMMUP00000002090  ...VQSLL.DAANQYQIEPVKKMCVDFLKE--..............................................
ENSMMUP00000026293  ...AESLL.EAGDMLEFQDIRDACAEFLEK--..............................................
ENSMMUP00000026389  ...VIEVM.SAASFLQMTDVISVCKTFIK---s.............................................
ENSMMUP00000010669  ...VQETL.VAACQLQIPEIIHFCCDFLM---s.............................................
ENSMMUP00000024681  ...ADDLL.AAADKYALERLKVMCEDALCS--..............................................
ENSMMUP00000030222  ...IIDVL.AAASYMQMFSVASTCSEFMK---s.............................................
ENSMMUP00000023260  ...VESLL.PAANLLQIKLVLKECCAFLE---s.............................................
ENSMMUP00000036581  ...IIDVL.AAASYMQMFSVASTCSEFMK---s.............................................
ENSMMUP00000027081  ...VQSLL.EAADLLQFLSVKKACERFLV---r.............................................
ENSMMUP00000015644  ...VQVLL.PAASLLQLMDVRQNCCDFLQ---s.............................................
ENSMMUP00000002087  ...VQSLL.DAANQYQIEPVKKMCVDFLKE--..............................................
ENSMMUP00000003441  ...ADNLL.AAADKYALERLKVMCEEALCS--..............................................
ENSMMUP00000025168  ...VLPVM.EAASMLQFPKLFEACSSYLQ---s.............................................
ENSMMUP00000023910  ...AEPLL.RAADLLQFPAVKEACGAFLQ---q.............................................
ENSMMUP00000020763  ...VQTLL.PAASLLQLNGVRDACCKFLL---s.............................................
ENSMMUP00000040638  ...AEPLL.RAADLLQFPAVKEACGAFLQ---q.............................................
ENSMMUP00000008445  ...CG---.-----------------------plyeeelafwgidetdvepccwmtyrqh..................
ENSMMUP00000026256  ...IENLL.AAACLLQLPQVVEVCCHFLMK--..............................................
ENSMMUP00000010352  ...VERLY.AASDMLQLEYVREACASFLA---r.............................................
ENSMMUP00000025120  ...VGDIL.SAARLLEIPAVSHVCADLL----d.............................................
ENSMMUP00000014737  ...IDYVL.ETAHLLQIWTVVDFCCEYLE---q.............................................
ENSMMUP00000022621  ...VFSFC.QEIEYWGINEL------------fidsccsnryqerkeenh............................
ENSMMUP00000014736  ...IDYVL.ETAHLLQIWTVVDFCCEYLE---q.............................................
ENSMMUP00000033332  ...IQDVL.AAGSHLQLLELLNLCSHYLIQ--..............................................
ENSMMUP00000006749  ...IQDVL.AAGSHLQLLELLNLCSHYLIQ--..............................................
ENSMMUP00000020619  ...VKHIL.NAARMLEIQCIVNVCLEIM----..............................................
ENSMMUP00000006378  ...VQRLY.AASDMLQLEYVREACASFLA---r.............................................
ENSMMUP00000003698  ...IECLL.STACLLQLSQVVEACCKFLMK--..............................................
ENSMMUP00000003699  ...IECLL.STACLLQLSQVVEACCKFLMK--..............................................
ENSMMUP00000003696  ...IECLL.STACLLQLSQVVEACCKFLMK--..............................................
ENSMMUP00000006059  ...CI---.-----------------------qafdeelafyglvpelvgdccleeyrdrkkena.............
ENSMMUP00000025169  ...VLPVM.EAASMLQFPKLFEACSSYLQ---s.............................................
ENSMMUP00000022998  ...MGLLR.READFYQVQPLIEALQ-------ekevel........................................
ENSMMUP00000039544  ...FDLLR.KEADFYQIEPLIQ----------cln...........................................
ENSMMUP00000012059  ...IMAVM.ATAMYLQMEHVVDTCRKFI----k.............................................
ENSMMUP00000003069  ...LQDTL.EAASFLQILPVLDFCKVFLI---s.............................................
ENSMMUP00000005739  ...LQEIY.EVSDMYQLTSLFEECSRFL----a.............................................
ENSMMUP00000019026  ...CI---.-----------------------sayddelafygilpeiigdccyeeykdrkrena.............
ENSMMUP00000019025  ...CI---.-----------------------sayddelafygilpeiigdccyeeykdrkrena.............
ENSMMUP00000005742  ...LQEIY.EVSDMYQLTSLFEECSRFL----a.............................................
ENSMMUP00000030686  ...CIS--.-----------------------aydeelaffglipeiigdccyeeykdrrrena..............
ENSMMUP00000018201  ...VHEIL.QAAMYVQLIEVVKFCCSFL----l.............................................
ENSMMUP00000008491  ...AL---.-----------------------sfsqeldywgideiylesccqaryhqk...................
ENSMMUP00000031952  ...VLPVM.EAASMLQFPKLFEACSSYLQ---s.............................................
ENSMMUP00000014752  ...AESLL.EAGDMLQFHDVRDAAAEFLEK--..............................................
ENSMMUP00000002089  ...VQSLL.DAANQYQIEPVKKMCVDFLKE--..............................................
ENSMMUP00000030019  ...IISYL.TAASFLQMQHIIDKCTQIL----..............................................
ENSMMUP00000025170  ...VLPVM.EAASMLQFPKLFEACSSYLQ---s.............................................
ENSMMUP00000023524  ...VMDVL.LAASHLHLNSVVKACKHYL----t.............................................
ENSMMUP00000038958  ...VQTVA.MAAYFMQMEEVFSVCQKYMMD--..............................................
ENSMMUP00000030021  ...IISYL.TAASFLQMQHIIDKCTQIL----..............................................
ENSMMUP00000018103  ...-----.-----------------------calsfgqeldywgideiylesccqaryhqk................
ENSMMUP00000010534  ...VDDVL.AVATFLQMQDIITAC--------h.............................................
ENSMMUP00000000204  ...EEGVL.EEAEFYNIGPLIRIIKDRMEE--kd............................................
ENSMMUP00000000205  ...EEGVL.EEAEFYNIGPLIRIIKDRMEE--kd............................................
ENSMMUP00000027009  ...VQDIF.ALASRFQIPSVFTVCVSYLQK--..............................................
ENSMMUP00000037617  ...IISYL.TAASFLQMQHIIDKCTQIL----..............................................
ENSMMUP00000027263  ...VIEVM.SAASFLQMTDIVQACHDFI----k.............................................
ENSMMUP00000024327  ...VEALT.RTAARLHFPSVQKVCGRYLQ---q.............................................
ENSMMUP00000014401  ...VEMFF.QLSSFLQVSFLSKACSDFLIK--..............................................
ENSMMUP00000036732  ...VEMFF.QLSSFLQVSFLSKACSDFLIK--..............................................
ENSMMUP00000029120  ...VQRVL.EAANLFQFLRMVDACASFLT---e.............................................
ENSMMUP00000006905  ...VLHVM.NGAVMYQIDSVVRACSDFLV---q.............................................
ENSMMUP00000026033  ...VIEVM.SAASYLQMNDVVNFCKTYI----r.............................................
ENSMMUP00000017930  ...VVSFL.TAASFLQMQCVIDKCTQIL----e.............................................
ENSMMUP00000027974  ...VQDLF.AAAHRFQIPSIFTICVSFLQK--r.............................................
ENSMMUP00000009849  ...VEDTL.EAASYLQVTEALGLCGRYLE---r.............................................
ENSMMUP00000027973  ...VQDLF.AAAHRFQIPSIFTICVSFLQK--r.............................................
ENSMMUP00000005452  ...VQALF.TAASIFQIPSIQDQCAQYMI---s.............................................
ENSMMUP00000006135  ...C----.-----------------------gplfeeeltfwgidetdvepccwmtyrqh.................
ENSMMUP00000033937  ...KGRLK.REAEYFQLPDLVKL---------lt............................................
ENSMMUP00000035430  ...IQVML.DTAQCLQVQNVLSLCHTFLK---s.............................................
ENSMMUP00000006134  ...C----.-----------------------gplfeeeltfwgidetdvepccwmtyrqh.................
ENSMMUP00000017929  ...IVSYL.TAASFLQMWHVVDKCTEVL----e.............................................
ENSMMUP00000005743  ...LQEIY.EVSDMYQLTSLF-----------n.............................................
ENSMMUP00000039027  ...VQDLF.AAAHRFQIPSIFTICVSFLQK--r.............................................
ENSMMUP00000013437  ...-----.-----------------------lcvfsfsqeieywgineffidsccsysyhgrkve............
ENSMMUP00000023621  ...QFLLM.YTAGFLQIQEIMEKGTE------ff............................................
ENSMMUP00000020548  ...IEDVL.AAASYLHMYDIVKVCKKKLK---e.............................................
ENSMMUP00000021377  ...APAVL.AAATYLQMEHVVQACHRFI----q.............................................
ENSMMUP00000030798  ...IQVML.DTAQCLQVQNVLSLCHTFLK---s.............................................
ENSMMUP00000030800  ...IQVML.DTAQCLQVQNVLSLCHTFLK---s.............................................
ENSMMUP00000006106  ...YTLLY.EEAKYFQLQPMLL----------emerwkq.......................................
ENSMMUP00000041295  ...YTLLY.EEAKYFQLQPMLL----------emerwkq.......................................
ENSMMUP00000012739  ...IREVI.RCAEFLRMHNLEDSCFSFLQT--q.............................................
ENSMMUP00000012740  ...IREVI.RCAEFLRMHNLEDSCFSFLQT--q.............................................
ENSMMUP00000009286  ...LDDLL.YAAEILEIEYLEEQCLKIL----e.............................................
ENSMMUP00000014850  ...FSLLY.EEARYYQLQPMVRELER------wqqeqe........................................
ENSMMUP00000000376  ...QLVVM.YTAGFLQIQHIVERG--------tdlm..........................................
ENSMMUP00000038684  ...VKEIH.QAADYLKVEEVVTKC--------k.............................................
ENSMMUP00000009285  ...LDDLL.YAAEILEIEYLEEQCLKIL----e.............................................
ENSMMUP00000038685  ...VKEIH.QAADYLKVEEVVTKCKIK-----me............................................
ENSMMUP00000010727  ...VEEVL.SVSKILHIPQVTKLCVQFLNDQI..............................................
ENSMMUP00000032065  ...AIEVM.TVASYLQMSEVVQTCRNFIK---d.............................................
ENSMMUP00000011064  ...AIEVM.TVASYLQMSEVVQTCRNFIK---d.............................................
ENSMMUP00000028802  ...VKEIH.QAADYLKVEEVVTKC--------k.............................................
ENSMMUP00000016597  ...NQLLA.QEAEFFQLKGLAE----------evksrwek......................................
ENSMMUP00000039147  ...C----.-----------------------gplfeeelafwgidetdvepccwmtyrqhr................
ENSMMUP00000028804  ...VKEIH.QAADYLKVEEVVTKC--------k.............................................
ENSMMUP00000016234  ...C----.-----------------------gplfeeelafwgidetdvepccwmtyrqhr................
ENSMMUP00000039149  ...C----.-----------------------gplfeeelafwgidetdvepccwmtyrqhr................
ENSMMUP00000011063  ...AIEVM.TVASYLQMSEVVQTCRNFIK---d.............................................
ENSMMUP00000016235  ...C----.-----------------------gplfeeelafwgidetdvepccwmtyrqhr................
ENSMMUP00000016233  ...C----.-----------------------gplfeeelafwgidetdvepccwmtyrqhr................
ENSMMUP00000010726  ...VEEVL.SVSKILHIPQVTKLCVQFLNDQI..............................................
ENSMMUP00000018252  ...VKDVY.SAAKKLKMDRVKQVCGDYLL---s.............................................
ENSMMUP00000024617  ...ALSFL.QEIQYWGIDEL------------sidsccrdryfrr.................................
ENSMMUP00000000919  ...-----.-----------------------mcalsfqeellywgiaedhldgcckrrylqkieefa..........
ENSMMUP00000037246  ...FSTLL.TAASYLQLPELAALCRRKLK---r.............................................
ENSMMUP00000013275  ...LLGVL.EEARFFGIDSLIEHLEV------aik...........................................
ENSMMUP00000018253  ...VKDVY.SAAKKLKMDRVKQHLLYFCL---hs............................................
ENSMMUP00000005453  ...VQALF.TAASIFQIPSIQDQCAQYMI---s.............................................
ENSMMUP00000023548  ...KERLL.REAEYFQLTDLVKLLS-------pkvikq........................................
ENSMMUP00000033751  ...LLDFL.SLAHKYGFPELEDSTSEYLC---t.............................................
ENSMMUP00000033833  ...LPAHL.LVASGLQMWQVVDQCSEILR---e.............................................
ENSMMUP00000024583  ...-----.-----------------------yqsggrlrrpvnvpldifseeirfyelgeeamemfrede.......
ENSMMUP00000025813  ...IEELL.AEAKYYLVQGLVEECQ-------a.............................................
ENSMMUP00000001402  ...VEDVL.AAASYLHMYDIVKVCKGRLQ---e.............................................
ENSMMUP00000002937  ...VGQIL.NMADMYGLEGLKEVAIYIL----r.............................................
ENSMMUP00000000727  ...ALSF-.-----------------------qeelaywgieeahlercclrkllrkleele................
ENSMMUP00000024588  ...-----.-----------------------yqsggrirrpvnvpidifseeirfyqlgeeamekfrede.......
ENSMMUP00000021084  ...AKTLL.EAASKFQFHTFCKVCVSFLEK--..............................................
ENSMMUP00000027790  ...VGVIY.EVAERLGMEDLLQACH-------s.............................................
ENSMMUP00000007841  ...VHEVL.ELADRFLLIRLKEFCGEFLKK--..............................................
ENSMMUP00000016103  ...-----.-----------------------qsggrlrrpvnvpldmfseeikfyelgeeamekfrede........
ENSMMUP00000029806  ...INVLR.HEAEFYGITPLVRR---------lllce.........................................
ENSMMUP00000018718  ...ANDVW.KAAEFLQMLEAIK----------al............................................
ENSMMUP00000028260  ...RSRLQ.REAEYFELPELVR----------r.............................................
ENSMMUP00000005173  ...IVNFL.TVGSVLQMWHIVDKCTELLR---e.............................................
ENSMMUP00000014526  ...VDEVC.KCVEFLSVHNIEESCFQFL----k.............................................
ENSMMUP00000021082  ...AKTLL.EAASKFQFHTFCKVCVSFLEK--..............................................
ENSMMUP00000004903  ...TEQIL.ATAQFLKVYDLVKAYTDF-----..............................................
ENSMMUP00000014525  ...VDEVC.KCVEFLSVHNIEESCFQFL----k.............................................
ENSMMUP00000035588  ...VDEVC.KCVEFLSVHNIEESCFQFL----k.............................................
ENSMMUP00000039976  ...ALQIL.TAASILQIKTVIDECTRI-----vsq...........................................
ENSMMUP00000008505  ...VQSLL.MGASFLQLQSIKDACCTFLR---e.............................................
ENSMMUP00000037061  ...-----.-----------------------yqsggrlkrpvnvpfdifteevkfyqlgeeallkfred........
ENSMMUP00000027168  ...ALQIL.TAASILQIKTVIDECTRI-----vsq...........................................
ENSMMUP00000024883  ...VLATL.YAAKKYIVPHLARACVNFLE---ts............................................
ENSMMUP00000039977  ...ALQIL.TAASILQIKTVIDECTRI-----vsq...........................................
ENSMMUP00000025164  ...IKELM.AEAKYYLIQGLVNMCQ-------s.............................................
ENSMMUP00000030139  ...-----.-----------------------nrpsfdgilyyyqsggrlrrpvnvsldvfadeirfyqlgdeamerf
ENSMMUP00000028983  ...VNLMM.SSGQILGIRFLDKLCS-------q.............................................
ENSMMUP00000038906  ...MPAVL.QAARLLEIPCVIAACMEIL----q.............................................
ENSMMUP00000035151  ...VQSLL.DAANQYQIEPVKKMCVDFLKE--..............................................
ENSMMUP00000005415  ...MPAVL.QAARLLEIPCVIAACMEIL----q.............................................
ENSMMUP00000040535  ...FSKII.SLADSLQMFDVAVSCKNLL----t.............................................
ENSMMUP00000040351  ...-----.-----------------------qsggrlrrpvnvpldifleeirfyqlgdealaafred.........
ENSMMUP00000019699  ...IQDVV.QAADLLLLTDLKTLCCEFL----e.............................................
ENSMMUP00000019737  ...MADVA.ILARHLFMSEVLEICE-------s.............................................
ENSMMUP00000019796  ...-----.-----------------------lcprcfleelgywgvrlkytprccricfeerrdel...........
ENSMMUP00000025467  ...IESLL.AAACSL-----------------l.............................................
ENSMMUP00000025466  ...IESLL.AAACSL-----------------l.............................................
ENSMMUP00000033334  ...VMTTL.YTAKKYAVPALEAHCVEFLTKHL..............................................
ENSMMUP00000031332  ...IGSII.SAAVYLQIHTLVKMCSDFLI---r.............................................
ENSMMUP00000017138  ...-----.-----------------------hkddpp........................................
ENSMMUP00000014427  ...VMTTL.YTAKKYAVPALEAHCVEFLTKHL..............................................
ENSMMUP00000034103  ...AEEGKsTSSEFYNIASLVRLVKERIR---dne...........................................
ENSMMUP00000024981  ...LGELL.GEARYYLVQGLIEDCQLALQE--knkyk.........................................
ENSMMUP00000015290  ...AEEGKsTSSEFYNIASLVRLVKERIR---dne...........................................
ENSMMUP00000023727  ...LAAVQ.ELGYSLGISFLTN----------iv............................................
ENSMMUP00000035669  ...LAAVQ.ELGYSLGISFLTN----------iv............................................
ENSMMUP00000039489  ...VEELL.RGAQYFNTPRLRVHCNDFLIK--..............................................
ENSMMUP00000001343  ...IPEVY.REAQFYEIKPLVKLLED------mpqi..........................................
ENSMMUP00000027673  ...AIGLL.DLATSYCENRLKKLCQHIIK---r.............................................
ENSMMUP00000032869  ...FEQFK.VAMNYLQLYNVPD----------cle...........................................
ENSMMUP00000029829  ...LLGVL.EEARFFGIYSLIEHLEVAI----kn............................................
ENSMMUP00000024495  ...FSKII.SLADSLQMFDVAVSCKNLL----t.............................................
ENSMMUP00000039462  ...-----.-----------------------yyqsggkirrpanvpidifadeisfyelgseamdqfrede......
ENSMMUP00000017362  ...VFAFG.QEADYWGLGE-------------nalaaccraryler................................
ENSMMUP00000023496  ...ALQVL.TAASVLRIQTVIDECTQII----a.............................................
ENSMMUP00000024450  ...-----.-----------------------erneyffdrhseafgfillyvrghgklrfaprmcelsfynemiywg
ENSMMUP00000027867  ...AMCLL.ICAEMYQVSRLQHICELFIIT--q.............................................
ENSMMUP00000015335  ...IVNYL.TAASYLQMEHVVEKCRNAL----s.............................................
ENSMMUP00000038535  ...VTDLA.AAGKKLGISFLED----------l.............................................
ENSMMUP00000000230  ...VSDCE.RLAKQCQLWDL------------l.............................................
ENSMMUP00000014300  ...YLRLQ.REALFYELRSLVDL---------lnpy..........................................
ENSMMUP00000023912  ...RDQVL.LAARELRVPEAVELCQSF-----..............................................
ENSMMUP00000020387  ...IMELL.SAAKFFQLEALQRHCEIIC----aks...........................................
ENSMMUP00000000230  ...AYDVL.SIADMYLLPGLKRLCGRSLA---q.............................................
ENSMMUP00000003775  ...-----.-----------------------gicpicfknemdfwkvdlkflddcckshlsekreele.........
ENSMMUP00000028507  ...ILELL.SAASLFQLDALQRHCE-------ilc...........................................
ENSMMUP00000021793  ...IMELL.SAAKFFQLEALQRHCEIIC----aks...........................................
ENSMMUP00000000677  ...LLKYL.TAASYLQMVHIVEKCTEAL----s.............................................
ENSMMUP00000006314  ...-----.-----------------------gpkqi.........................................
ENSMMUP00000000676  ...LVNYL.TAASFLQMSHIVERCTQALWK--f.............................................
ENSMMUP00000039849  ...LVNYL.TAASFLQMSHIVERCTQALWK--f.............................................
ENSMMUP00000033224  ...-----.-----------------------idpvrleqg.....................................
ENSMMUP00000008762  ...VQRML.EMAEKLKCLDLSETCF-------q.............................................
ENSMMUP00000002939  ...NVGYV.-----------------------flfnnlkykrv...................................
ENSMMUP00000029460  ...VQRML.EMAEKLKCLDLSETCF-------q.............................................
ENSMMUP00000000342  ...IPLVL.EAAKFLDIIDAVK----------l.............................................
ENSMMUP00000014504  ...LDELI.KSGQLLGVK--------------fia...........................................
ENSMMUP00000031090  ...VAEIG.ALGRRLGISRL------------q.............................................
ENSMMUP00000035436  ...-----.-----------------------ps............................................
ENSMMUP00000026976  vqnVLQIL.EAADKTQALDMKRHCLHIIV---h.............................................
ENSMMUP00000010614  ...RIALQ.EEADYFGIP--------------ypys..........................................
ENSMMUP00000035434  ...-----.-----------------------sa............................................
ENSMMUP00000038298  ...INVLR.HEAEFYGITPLVRR---------lllcee........................................
ENSMMUP00000027972  ...VHEVL.SAASLLQMADIAASCQELL----..............................................
ENSMMUP00000014079  ...ICSVL.VVADQLLITRLKEICEVALT---e.............................................
ENSMMUP00000028191  ...PLELI.ALANRFCLPHLVALAEQ------h.............................................
ENSMMUP00000035799  ...PLELI.ALANRFCLPHLVALAEQ------h.............................................
ENSMMUP00000035800  ...PLELI.ALANRFCLPHLVALAEQ------h.............................................
ENSMMUP00000003697  ...IECLL.STACLLQLSQVVEACCKFLMK--..............................................
ENSMMUP00000011066  ...VVAIL.AAACMLQLDGLIQQCGETMK---e.............................................
ENSMMUP00000001153  ...VVAIL.AAACLLQLDGLIQQCGETMK---e.............................................
ENSMMUP00000009897  ...LMHIA.HIAELLEVFDLRMMVANILN---n.............................................
ENSMMUP00000014371  ...LQDTL.EAASFLQILPVLDFCKVFLI---s.............................................
ENSMMUP00000006589  ...-----.-----------------------kewplfcqeveeyhipslsealaqceaykswtqe............
ENSMMUP00000019047  ...IPDLR.DTCDYLCI---------------nfdfntircqdl..................................
ENSMMUP00000012684  ...IPELR.EACDYLCIS--------------feystikcrdl...................................
ENSMMUP00000018177  ...VLATL.YAAKKYIVPALAKACVNFLE---ts............................................
ENSMMUP00000028191  ...LVGLA.QIAEVLEMFDLRMMVENIMN---k.............................................
ENSMMUP00000035799  ...LVGLA.QIAEVLEMFDLRMMVENIMN---k.............................................
ENSMMUP00000035800  ...LVGLA.QIAEVLEMFDLRMMVENIMN---k.............................................
ENSMMUP00000020974  ...EEGVL.EEAEFYNITSLIKLVKDKIR---erdsk.........................................
ENSMMUP00000005376  ...FQ---.-----------------------nv............................................
ENSMMUP00000014079  ...-----.-----------------------f.............................................
ENSMMUP00000000229  ...AYDVL.SIADMYLLPGLKRLCGRSLA---q.............................................
ENSMMUP00000006589  ...ELNLL.-----------------------yeqalglqlmpllqtldnl...........................
ENSMMUP00000008168  ...TALLR.AEADFYQIRPLLDAL--------rel...........................................
ENSMMUP00000015228  ...VRAVY.KEAQYYAIGPLLEQLEN------m.............................................
ENSMMUP00000008698  ...VMTTL.YTAKKYAVPALEAHCVDF-----..............................................
ENSMMUP00000007840  ...VEKLL.AAADQFNIMGIVRGCCEFLK---s.............................................
ENSMMUP00000040702  ...VQTLL.PAASLLQLNGVRDACCKFLL---s.............................................
ENSMMUP00000003187  ...LRPLE.EAARALGVQSLEEACW-------r.............................................
ENSMMUP00000002939  ...-----.-----------------------ik............................................
ENSMMUP00000002937  ...-----.-----------------------ik............................................
ENSMMUP00000003182  ...LRPLE.EAARALGVQSLEEACW-------r.............................................
ENSMMUP00000026976  ...IMDVY.KLALSFQLCRLEQLCRQYI----..............................................
ENSMMUP00000005455  ...VQALF.TAASIFQIPSIQDQCAQYMI---s.............................................
ENSMMUP00000009000  ...LLRAA.QAALQYQSSSCLDLCQKGL----a.............................................
ENSMMUP00000000640  ...AVTLL.STAVKYDAWDLEEFCFRFCI---n.............................................
ENSMMUP00000009897  ...DMKLI.ILANRLCLPHLVALTEQY-----..............................................
ENSMMUP00000034574  ...VQVLL.PAAGLLQLQDVKKTCCEFLE---s.............................................
ENSMMUP00000002184  ...LLDFL.SLAHKYGFPELEDSTSEYLC---t.............................................
ENSMMUP00000018874  ...VEDVL.AAASYLHMNDIVKVCKRRL----q.............................................
ENSMMUP00000037084  ...FPELM.TAAKFLLMRSVIEICQEVIK---q.............................................
ENSMMUP00000037086  ...FPELM.TAAKFLLMRSVIEICQEVIK---q.............................................
ENSMMUP00000005376  ...-----.-----------------------cspsvgslsevqalvagkpnmtraeeamelyhi.............
ENSMMUP00000006589  ...IDVLE.AEVEILEIPALTE----------airwy.........................................
ENSMMUP00000037085  ...FPELM.TAAKFLLMRSVIEICQEVIK---q.............................................
ENSMMUP00000017126  ...VLGVL.ASAHILQFSGLFQRCVDVMI---t.............................................
ENSMMUP00000023270  ...PTGLL.DLATFYRENRLKKLCQQTIKQ--g.............................................
ENSMMUP00000027867  ...-----.-----------------------fq............................................
ENSMMUP00000001193  ...AEEAL.EAAGRFLLPGL------------eee...........................................
ENSMMUP00000025835  ...VKCFH.KLASAYGAKQLQGYCA-------s.............................................

d1buoa_               ...................
ENSMMUP00000002434  ...................
ENSMMUP00000002433  ...................
ENSMMUP00000006823  ...................
ENSMMUP00000022077  ...................
ENSMMUP00000000957  ...................
ENSMMUP00000023470  ...................
ENSMMUP00000010575  ...................
ENSMMUP00000022822  ...................
ENSMMUP00000010571  ...................
ENSMMUP00000010572  ...................
ENSMMUP00000006555  ...................
ENSMMUP00000002090  ...................
ENSMMUP00000026293  ...................
ENSMMUP00000026389  ...................
ENSMMUP00000010669  ...................
ENSMMUP00000024681  ...................
ENSMMUP00000030222  ...................
ENSMMUP00000023260  ...................
ENSMMUP00000036581  ...................
ENSMMUP00000027081  ...................
ENSMMUP00000015644  ...................
ENSMMUP00000002087  ...................
ENSMMUP00000003441  ...................
ENSMMUP00000025168  ...................
ENSMMUP00000023910  ...................
ENSMMUP00000020763  ...................
ENSMMUP00000040638  ...................
ENSMMUP00000008445  ...................
ENSMMUP00000026256  ...................
ENSMMUP00000010352  ...................
ENSMMUP00000025120  ...................
ENSMMUP00000014737  ...................
ENSMMUP00000022621  ...................
ENSMMUP00000014736  ...................
ENSMMUP00000033332  ...................
ENSMMUP00000006749  ...................
ENSMMUP00000020619  ...................
ENSMMUP00000006378  ...................
ENSMMUP00000003698  ...................
ENSMMUP00000003699  ...................
ENSMMUP00000003696  ...................
ENSMMUP00000006059  ...................
ENSMMUP00000025169  ...................
ENSMMUP00000022998  ...................
ENSMMUP00000039544  ...................
ENSMMUP00000012059  ...................
ENSMMUP00000003069  ...................
ENSMMUP00000005739  ...................
ENSMMUP00000019026  ...................
ENSMMUP00000019025  ...................
ENSMMUP00000005742  ...................
ENSMMUP00000030686  ...................
ENSMMUP00000018201  ...................
ENSMMUP00000008491  ...................
ENSMMUP00000031952  ...................
ENSMMUP00000014752  ...................
ENSMMUP00000002089  ...................
ENSMMUP00000030019  ...................
ENSMMUP00000025170  ...................
ENSMMUP00000023524  ...................
ENSMMUP00000038958  ...................
ENSMMUP00000030021  ...................
ENSMMUP00000018103  ...................
ENSMMUP00000010534  ...................
ENSMMUP00000000204  ...................
ENSMMUP00000000205  ...................
ENSMMUP00000027009  ...................
ENSMMUP00000037617  ...................
ENSMMUP00000027263  ...................
ENSMMUP00000024327  ...................
ENSMMUP00000014401  ...................
ENSMMUP00000036732  ...................
ENSMMUP00000029120  ...................
ENSMMUP00000006905  ...................
ENSMMUP00000026033  ...................
ENSMMUP00000017930  ...................
ENSMMUP00000027974  ...................
ENSMMUP00000009849  ...................
ENSMMUP00000027973  ...................
ENSMMUP00000005452  ...................
ENSMMUP00000006135  ...................
ENSMMUP00000033937  ...................
ENSMMUP00000035430  ...................
ENSMMUP00000006134  ...................
ENSMMUP00000017929  ...................
ENSMMUP00000005743  ...................
ENSMMUP00000039027  ...................
ENSMMUP00000013437  ...................
ENSMMUP00000023621  ...................
ENSMMUP00000020548  ...................
ENSMMUP00000021377  ...................
ENSMMUP00000030798  ...................
ENSMMUP00000030800  ...................
ENSMMUP00000006106  ...................
ENSMMUP00000041295  ...................
ENSMMUP00000012739  ...................
ENSMMUP00000012740  ...................
ENSMMUP00000009286  ...................
ENSMMUP00000014850  ...................
ENSMMUP00000000376  ...................
ENSMMUP00000038684  ...................
ENSMMUP00000009285  ...................
ENSMMUP00000038685  ...................
ENSMMUP00000010727  ...................
ENSMMUP00000032065  ...................
ENSMMUP00000011064  ...................
ENSMMUP00000028802  ...................
ENSMMUP00000016597  ...................
ENSMMUP00000039147  ...................
ENSMMUP00000028804  ...................
ENSMMUP00000016234  ...................
ENSMMUP00000039149  ...................
ENSMMUP00000011063  ...................
ENSMMUP00000016235  ...................
ENSMMUP00000016233  ...................
ENSMMUP00000010726  ...................
ENSMMUP00000018252  ...................
ENSMMUP00000024617  ...................
ENSMMUP00000000919  ...................
ENSMMUP00000037246  ...................
ENSMMUP00000013275  ...................
ENSMMUP00000018253  ...................
ENSMMUP00000005453  ...................
ENSMMUP00000023548  ...................
ENSMMUP00000033751  ...................
ENSMMUP00000033833  ...................
ENSMMUP00000024583  ...................
ENSMMUP00000025813  ...................
ENSMMUP00000001402  ...................
ENSMMUP00000002937  ...................
ENSMMUP00000000727  ...................
ENSMMUP00000024588  ...................
ENSMMUP00000021084  ...................
ENSMMUP00000027790  ...................
ENSMMUP00000007841  ...................
ENSMMUP00000016103  ...................
ENSMMUP00000029806  ...................
ENSMMUP00000018718  ...................
ENSMMUP00000028260  ...................
ENSMMUP00000005173  ...................
ENSMMUP00000014526  ...................
ENSMMUP00000021082  ...................
ENSMMUP00000004903  ...................
ENSMMUP00000014525  ...................
ENSMMUP00000035588  ...................
ENSMMUP00000039976  ...................
ENSMMUP00000008505  ...................
ENSMMUP00000037061  ...................
ENSMMUP00000027168  ...................
ENSMMUP00000024883  ...................
ENSMMUP00000039977  ...................
ENSMMUP00000025164  ...................
ENSMMUP00000030139  rede...............
ENSMMUP00000028983  ...................
ENSMMUP00000038906  ...................
ENSMMUP00000035151  ...................
ENSMMUP00000005415  ...................
ENSMMUP00000040535  ...................
ENSMMUP00000040351  ...................
ENSMMUP00000019699  ...................
ENSMMUP00000019737  ...................
ENSMMUP00000019796  ...................
ENSMMUP00000025467  ...................
ENSMMUP00000025466  ...................
ENSMMUP00000033334  ...................
ENSMMUP00000031332  ...................
ENSMMUP00000017138  ...................
ENSMMUP00000014427  ...................
ENSMMUP00000034103  ...................
ENSMMUP00000024981  ...................
ENSMMUP00000015290  ...................
ENSMMUP00000023727  ...................
ENSMMUP00000035669  ...................
ENSMMUP00000039489  ...................
ENSMMUP00000001343  ...................
ENSMMUP00000027673  ...................
ENSMMUP00000032869  ...................
ENSMMUP00000029829  ...................
ENSMMUP00000024495  ...................
ENSMMUP00000039462  ...................
ENSMMUP00000017362  ...................
ENSMMUP00000023496  ...................
ENSMMUP00000024450  legahleyccqrrlddrms
ENSMMUP00000027867  ...................
ENSMMUP00000015335  ...................
ENSMMUP00000038535  ...................
ENSMMUP00000000230  ...................
ENSMMUP00000014300  ...................
ENSMMUP00000023912  ...................
ENSMMUP00000020387  ...................
ENSMMUP00000000230  ...................
ENSMMUP00000003775  ...................
ENSMMUP00000028507  ...................
ENSMMUP00000021793  ...................
ENSMMUP00000000677  ...................
ENSMMUP00000006314  ...................
ENSMMUP00000000676  ...................
ENSMMUP00000039849  ...................
ENSMMUP00000033224  ...................
ENSMMUP00000008762  ...................
ENSMMUP00000002939  ...................
ENSMMUP00000029460  ...................
ENSMMUP00000000342  ...................
ENSMMUP00000014504  ...................
ENSMMUP00000031090  ...................
ENSMMUP00000035436  ...................
ENSMMUP00000026976  ...................
ENSMMUP00000010614  ...................
ENSMMUP00000035434  ...................
ENSMMUP00000038298  ...................
ENSMMUP00000027972  ...................
ENSMMUP00000014079  ...................
ENSMMUP00000028191  ...................
ENSMMUP00000035799  ...................
ENSMMUP00000035800  ...................
ENSMMUP00000003697  ...................
ENSMMUP00000011066  ...................
ENSMMUP00000001153  ...................
ENSMMUP00000009897  ...................
ENSMMUP00000014371  ...................
ENSMMUP00000006589  ...................
ENSMMUP00000019047  ...................
ENSMMUP00000012684  ...................
ENSMMUP00000018177  ...................
ENSMMUP00000028191  ...................
ENSMMUP00000035799  ...................
ENSMMUP00000035800  ...................
ENSMMUP00000020974  ...................
ENSMMUP00000005376  ...................
ENSMMUP00000014079  ...................
ENSMMUP00000000229  ...................
ENSMMUP00000006589  ...................
ENSMMUP00000008168  ...................
ENSMMUP00000015228  ...................
ENSMMUP00000008698  ...................
ENSMMUP00000007840  ...................
ENSMMUP00000040702  ...................
ENSMMUP00000003187  ...................
ENSMMUP00000002939  ...................
ENSMMUP00000002937  ...................
ENSMMUP00000003182  ...................
ENSMMUP00000026976  ...................
ENSMMUP00000005455  ...................
ENSMMUP00000009000  ...................
ENSMMUP00000000640  ...................
ENSMMUP00000009897  ...................
ENSMMUP00000034574  ...................
ENSMMUP00000002184  ...................
ENSMMUP00000018874  ...................
ENSMMUP00000037084  ...................
ENSMMUP00000037086  ...................
ENSMMUP00000005376  ...................
ENSMMUP00000006589  ...................
ENSMMUP00000037085  ...................
ENSMMUP00000017126  ...................
ENSMMUP00000023270  ...................
ENSMMUP00000027867  ...................
ENSMMUP00000001193  ...................
ENSMMUP00000025835  ...................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0035720 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]