SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

RNA-binding domain, RBD alignments in Heterocephalus glaber v1.7-2

These alignments are sequences aligned to the 0047197 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1hl6a_                ae...........................................................................
HGL_H00000361949-2   ftnvyiknfgeevddeslkelfsqfgktlsvkvmr..........................................
HGL_H00000255136     tniyvknlhvdmdeqglqdlffefgkmlsvkvm............................................
HGL_H00000271628-1   datvyvggldekvsepllwelflqagpvvnthmpk..........................................
HGL_H00000361949-2   maslyvgdlhsdvteamlyekfspagpvlsirvcrdmi.......................................
HGL_H00000308012     .............................................................................
HGL_H00000393248-2   slyvgdlhpevteamlyekfspagpilsiricrdki.........................................
HGL_H00000255136     sslyvgdlhpdvteamlyetfspvgpilsirvcrdva........................................
HGL_H00000358089     qprtlyvgnlsrdvtevlilqlfsqigpcksckmiteqpdsrrvnssvgfsvlqh......................
HGL_H00000408239     ftnvyiknfgddmdderlqgvfsrygktlsvkvmt..........................................
HGL_H00000271628-2   datvyvggldekvsepllwelflqarpvvnthmpk..........................................
HGL_H00000352612     anlyvsglpktmtqkeleqlfsqygriitsrilvdqvt.......................................
HGL_H00000416340-1   pe...........................................................................
HGL_H00000360886     anlyvsglpktmtqkeleqlfsqygriitsrilvdqvtgvsrgvgfirfdkrieaeeaikglngqkpsgatepitvk
HGL_H00000408239     slyvgdlhaeatedllfrkfsaagpvlsiricrdla.........................................
HGL_H00000352162     dsktn........................................................................
HGL_H00000264073-2   anlyisglprtmtqkdvedmfsrfgriinsrvlvdq.........................................
HGL_H00000389951     drklfigmvskkcnendirvmfspfgqieecrilrgpdglsrgcafvtfstramaqnaikamhqsqtmegcsspivv
HGL_H00000355089     psqdrklfvgmlnkqqseddvrrlfeafgnieectilrgpdgnskgcafvkysshaeaqaainalhgsqtmpgasss
HGL_H00000287202     drklfvgmlgkqqgeedvrrlfqpfghieectvlrspdgtskgcafvkfgsqgeaqaaiqglhgsqtmagassslvv
HGL_H00000313007-2   dderlkdlfrpalsvkvmt..........................................................
HGL_H00000308012     lyvgdldadvtedmlykkfrpagplrftricrdp...........................................
HGL_H00000414859-2   edrklfigmiskkctendirvmfssfgqieecrilrgpdglsrggcafvtfttramaqtaikamhqaqtmegcsspm
HGL_H00000313007-1   f............................................................................
HGL_H00000316042     lcklfigglnvqsglrghfeafgtltdcvvvvn............................................
HGL_H00000414859-1   drklfigmisekctendirvmfssfgqieeyrilrgpdglsrgcafvtfttrgmaqtaikamhqaqtmegcsspmvv
HGL_H00000414859-3   ikmfvgqvprtwsekdlrelfeqygavyeinvlrdrs........................................
HGL_H00000412831     de...........................................................................
HGL_H00000401336     d............................................................................
HGL_H00000373277     tnlyirglppgttdqdliklcqpygkivstkail...........................................
HGL_H00000402734     gcrvfigrlnpaarekdverffkgygrirdidl............................................
HGL_H00000343966     r............................................................................
HGL_H00000264073-1   n............................................................................
HGL_H00000362900     rvyigrlsyqarerdverffkgygkilevdlk.............................................
HGL_H00000326806     hfrgdnee.....................................................................
HGL_H00000229390-2   g............................................................................
HGL_H00000365950-3   ee...........................................................................
HGL_H00000416340-2   peq..........................................................................
HGL_H00000294172-1   gtsqdgasknwfkitipsgkkyekswllsmiqskcsipftpvefhyentraqf........................
HGL_H00000253363     m............................................................................
HGL_H00000349748-2   r............................................................................
HGL_H00000297071     ra...........................................................................
HGL_H00000276079     s............................................................................
HGL_H00000294172-2   gtsqdgtsknwfkisipfgkkyekswllgmiqskcsipftpvefhyentraqf........................
HGL_H00000393937     skytpeavlwerfspfgeiqdiwvvr...................................................
HGL_H00000376344     s............................................................................
HGL_H00000402114     kmeedtqdrrveswfkitipfgrkydkawlmnliqshcsvffspvd...............................
HGL_H00000276201-1   s............................................................................
HGL_H00000276201-2   s............................................................................
HGL_H00000359645-2   pg...........................................................................
HGL_H00000376290-4   an...........................................................................
HGL_H00000376290-3   rdyrrrhs.....................................................................
HGL_H00000341826     pe...........................................................................
HGL_D0073543         pegcnlfiyhlpqefgdteltqmflpfgniisskvfmdratnqsk................................
HGL_H00000383298-1   tdcvvmr......................................................................
HGL_H00000387996     pav..........................................................................
HGL_H00000309166-3   pr...........................................................................
HGL_H00000364912     a............................................................................
HGL_H00000393248-1   pavd.........................................................................
HGL_H00000332444     pam..........................................................................
HGL_H00000376290-2   ra...........................................................................
HGL_H00000313007-1   ldtm.........................................................................
HGL_H00000313890-1   t............................................................................
HGL_H00000376290-5   nra..........................................................................
HGL_H00000359645-1   g............................................................................
HGL_H00000318195     gspn.........................................................................
HGL_H00000401371     tqrs.........................................................................
HGL_H00000221448     mwdphn.......................................................................
HGL_H00000266529-8   vpeemsgg.....................................................................
HGL_H00000333001     ep...........................................................................
HGL_H00000364448     s............................................................................
HGL_H00000360886     tsngpstn.....................................................................
HGL_H00000281722     p............................................................................
HGL_H00000383298-6   pe...........................................................................
HGL_H00000352612     pvdsg........................................................................
HGL_H00000352956     gg...........................................................................
HGL_H00000293677     l............................................................................
HGL_H00000295470-1   e............................................................................
HGL_H00000322016     .............................................................................
HGL_H00000402503     d............................................................................
HGL_H00000233078     sd...........................................................................
HGL_H00000351108     amk..........................................................................
HGL_H00000253329     llemvgdl.....................................................................
HGL_H00000257552     fpr..........................................................................
HGL_H00000341826     ahlt.........................................................................
HGL_H00000243563-3   r............................................................................
HGL_H00000416340-3   pgahl........................................................................
HGL_H00000371212     rg...........................................................................
HGL_H00000307863     ds...........................................................................
HGL_H00000361924     t............................................................................
HGL_H00000266529-6   p............................................................................
HGL_H00000331817     tg...........................................................................
HGL_H00000266529-7   p............................................................................
HGL_H00000365950-2   g............................................................................
HGL_H00000376290-1   n............................................................................
HGL_H00000313199-1   ke...........................................................................
HGL_H00000233078     v............................................................................
HGL_H00000383298-2   pgahl........................................................................
HGL_H00000358799     .............................................................................
HGL_H00000264073-2   ig...........................................................................
HGL_H00000354021-2   hvt..........................................................................
HGL_H00000416340-3   pe...........................................................................
HGL_H00000376117     pvplnnptsg...................................................................
HGL_H00000416340-4   pkravsr......................................................................
HGL_H00000246071-1   p............................................................................
HGL_H00000285814-6   kqeqkkk......................................................................
HGL_H00000383298-8   k............................................................................
HGL_H00000216727-1   rmea.........................................................................
HGL_H00000313199-1   e............................................................................
HGL_H00000318195     e............................................................................
HGL_H00000362936     tvmsvkiirnrl.................................................................
HGL_H00000266529-9   p............................................................................
HGL_H00000320768     satiachldsr..................................................................
HGL_H00000413035     aqtdgq.......................................................................
HGL_H00000386226     ss...........................................................................
HGL_H00000309117     aptdgq.......................................................................
HGL_H00000266529-1   p............................................................................
HGL_H00000363105     dncrlfiggipktkkreeilsevkkvtegvvdvivypsaa.....................................
HGL_H00000223073     dkk..........................................................................
HGL_M00000038256     .............................................................................
HGL_H00000354021-2   qf...........................................................................
HGL_H00000401371     p............................................................................
HGL_H00000383298-2   ql...........................................................................
HGL_H00000333170     tqe..........................................................................
HGL_H00000351108     k............................................................................
HGL_H00000309166-1   a............................................................................
HGL_H00000363516     sdlptslfacsvheavfevqeqk......................................................
HGL_H00000294428     l............................................................................
HGL_H00000354719     vtgd.........................................................................
HGL_H00000253108     vppslrdgas...................................................................
HGL_H00000313890-2   rnlfignldhtvselelrrafgkhgkhg.................................................
HGL_H00000266529-10  lpeemsgg.....................................................................
HGL_H00000346120     dqrslinseagfvtmilrcsvempnisyawkelk...........................................
HGL_H00000365950-5   ee...........................................................................
HGL_H00000316950     igs..........................................................................
HGL_H00000295470-1   naskn........................................................................
HGL_H00000376344     es...........................................................................
HGL_H00000349428-2   agq..........................................................................
HGL_H00000290341     nklyignlnesvtpadlekvfaehkisysgpflvksgyafvdcpdehwamkaietfs....................
HGL_H00000362820-2   d............................................................................
HGL_H00000309558     ggs..........................................................................
HGL_H00000316950     ekk..........................................................................
HGL_H00000365950-4   ee...........................................................................
HGL_H00000262633     gsswedpsl....................................................................
HGL_H00000420195-3   .............................................................................
HGL_H00000325376     ark..........................................................................
HGL_H00000294904     pmapps.......................................................................
HGL_H00000265753-1   kel..........................................................................
HGL_H00000325905     ge...........................................................................
HGL_H00000364639-2   a............................................................................
HGL_H00000363105     rtgy.........................................................................
HGL_H00000358635-1   dpevm........................................................................
HGL_H00000316950     glmnlppsilnnpn...............................................................
HGL_H00000338477-2   ygdgeftv.....................................................................
HGL_H00000252542     ss...........................................................................
HGL_H00000243563-2   es...........................................................................
HGL_H00000401371     vsq..........................................................................
HGL_H00000354021-1   qf...........................................................................
HGL_H00000409315     lq...........................................................................
HGL_H00000313199-2   ew...........................................................................
HGL_H00000361927     ygdggss......................................................................
HGL_H00000327539     ygdggstf.....................................................................
HGL_H00000358089     vvnq.........................................................................
HGL_H00000338477-4   fgdgeftv.....................................................................
HGL_H00000361949-1   as...........................................................................
HGL_H00000228284     k............................................................................
HGL_H00000355089     shs..........................................................................
HGL_H00000362687     feprslitcdkgfvtmtlespeeiqdv..................................................
HGL_H00000250863     nstisreastq..................................................................
HGL_H00000365950-1   eehs.........................................................................
HGL_H00000377738     aqs..........................................................................
HGL_H00000322016     .............................................................................
HGL_H00000358635-1   gp...........................................................................
HGL_H00000414921     pgq..........................................................................
HGL_N10016780        de...........................................................................
HGL_H00000413303-1   dpevm........................................................................
HGL_H00000310471-3   v............................................................................
HGL_H00000338477-5   fgdgeftv.....................................................................
HGL_H00000325376     pgminippsilnnpni.............................................................
HGL_H00000352162     ga...........................................................................
HGL_H00000262031     qmap.........................................................................
HGL_H00000358635-2   vewadpv......................................................................
HGL_H00000292672     srgg.........................................................................
HGL_H00000218364     mrhervvilknmfhptdfeddplvlneir................................................
HGL_H00000313199-2   k............................................................................
HGL_H00000338477-1   sgpdsad......................................................................
HGL_H00000338477-5   sgpnsadt.....................................................................
HGL_H00000216727-2   erme.........................................................................
HGL_H00000285814-5   qkqeqknk.....................................................................
HGL_H00000349428-1   fkgdsr.......................................................................
HGL_H00000338477-3   ygdseft......................................................................
HGL_H00000338477-1   ygdgeftv.....................................................................
HGL_H00000309166-2   ka...........................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000327539     gpnspd.......................................................................
HGL_H00000265866-2   ggagdassgf...................................................................
HGL_H00000265866-2   gpn..........................................................................
HGL_H00000338477-2   sgpnsadt.....................................................................
HGL_H00000265997     y............................................................................
HGL_H00000361557     kipm.........................................................................
HGL_H00000311747     mn...........................................................................
HGL_H00000259997     .............................................................................
HGL_H00000352668     sph..........................................................................
HGL_H00000229390-1   iyvanlrqtcsrrtckcgriceielknrhgl..............................................
HGL_H00000338477-4   sgpnsadt.....................................................................
HGL_H00000349428-1   agq..........................................................................
HGL_H00000349428-2   fkgdsr.......................................................................
HGL_N10004544        rsgssst......................................................................
HGL_H00000240185     .............................................................................
HGL_H00000285814-4   .............................................................................
HGL_H00000376344     rkq..........................................................................
HGL_H00000383298-7   tavis........................................................................
HGL_H00000265085     r............................................................................
HGL_H00000404545-2   s............................................................................
HGL_H00000396578-3   srl..........................................................................
HGL_M00000078602     hdv..........................................................................
HGL_H00000352668     hitnipfsitkmdvlqflegipvdenavhvlvdnngqglgqalvqfkneddarksehlhrkklngreafvhvvtled
HGL_H00000383298-4   peq..........................................................................
HGL_H00000338095-2   tnktdp.......................................................................
HGL_H00000361927     pdtand.......................................................................
HGL_H00000366829     s............................................................................
HGL_H00000295470-3   ddg..........................................................................
HGL_R00000023552     tqvvlrcppprpkkeqleeqlsllpahdyfkvasvdhslyphlys................................
HGL_H00000285814-1   v............................................................................
HGL_N10004520        seq..........................................................................
HGL_H00000246194-3   iqtsnvtnk....................................................................
HGL_H00000414859-2   nsspvskk.....................................................................
HGL_H00000402503     pda..........................................................................
HGL_H00000199814-2   dp...........................................................................
HGL_H00000325376     tkr..........................................................................
HGL_H00000262031     qmakq........................................................................
HGL_H00000383298-5   phkadgravepkravsr............................................................
HGL_H00000390913     qv...........................................................................
HGL_H00000344950     rkkpl........................................................................
HGL_H00000334538     pqppl........................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000223073     l............................................................................
HGL_H00000310471-3   sk...........................................................................
HGL_H00000400142     sd...........................................................................
HGL_H00000294904     qmakq........................................................................
HGL_N10006621        pggltkeqleeqlrplpaqdyfqvpgadrllyphlys........................................
HGL_H00000310471-2   .............................................................................
HGL_M00000111283     .............................................................................
HGL_H00000369887-2   sgs..........................................................................
HGL_H00000362820-1   d............................................................................
HGL_H00000223073     psd..........................................................................
HGL_H00000383298-3   k............................................................................
HGL_H00000343054     rs...........................................................................
HGL_H00000364639-1   vaagea.......................................................................
HGL_H00000371212     dvme.........................................................................
HGL_H00000389951     hsd..........................................................................
HGL_H00000221419     eny..........................................................................
HGL_H00000379069     y............................................................................
HGL_H00000390625     gshhkv.......................................................................
HGL_H00000315859     ssassh.......................................................................
HGL_H00000393937     fteeqlfsifdivpgleycevqrdpysnyghgvvqyfnvasaiyakyklhgfqyppgnrigvsfiddgsnatdllrk
HGL_H00000414921     svllvtnlnpdlitphglfilfgvygdvhrvkimfnkkenalvqmadahqaqlamnhlsgqrlygkvlratlskhqt
HGL_H00000369887-1   sgs..........................................................................
HGL_H00000361927     teg..........................................................................
HGL_N10001384        pgv..........................................................................
HGL_H00000360425     gq...........................................................................
HGL_H00000240185     skq..........................................................................
HGL_H00000396578-2   srl..........................................................................
HGL_H00000376344     .............................................................................
HGL_H00000281722     eetmq........................................................................
HGL_H00000338095-1   tnktdph......................................................................
HGL_H00000238688-1   nft..........................................................................
HGL_H00000352956     phfre........................................................................
HGL_H00000413532     gkpdqkf......................................................................
HGL_H00000310471-2   .............................................................................
HGL_H00000338477-3   egg..........................................................................
HGL_N10024532        sr...........................................................................
HGL_H00000253363     rsrskerrrsrs.................................................................
HGL_H00000348578     h............................................................................
HGL_H00000377738     md...........................................................................
HGL_H00000338477-5   egg..........................................................................
HGL_H00000338477-4   egg..........................................................................
HGL_H00000310471-1   ka...........................................................................
HGL_H00000349428-2   ggag.........................................................................
HGL_H00000382239     ciyirnfpfdvtkvevqkffadfslaeddiyllyddkgvglgealvkfkseeqamkaerlnrrrflgtevllrlise
HGL_H00000377738     mpgvsa.......................................................................
HGL_H00000338477-3   hsspns.......................................................................
HGL_H00000318195     kk...........................................................................
HGL_H00000307863     .............................................................................
HGL_H00000356154     sgsrkrkh.....................................................................
HGL_H00000338477-2   erge.........................................................................
HGL_H00000416340-3   pgr..........................................................................
HGL_H00000414921     gdr..........................................................................
HGL_H00000414859-1   pdqp.........................................................................
HGL_H00000295470-4   naskn........................................................................
HGL_M00000094956     eqrdrd.......................................................................
HGL_H00000286835     srrsrhrr.....................................................................
HGL_H00000391432     srrelekgrisreemeslsvf........................................................
HGL_H00000266529-2   ps...........................................................................
HGL_H00000349428-1   lgaag........................................................................
HGL_H00000295470-2   efaegski.....................................................................
HGL_N10021125        .............................................................................
HGL_H00000257552     g............................................................................
HGL_H00000265866-1   gpnd.........................................................................
HGL_H00000358635-2   gq...........................................................................
HGL_H00000420270-2   mlptpvlrllnvldddyleneeeyedvv.................................................
HGL_H00000254799     psklgee......................................................................
HGL_H00000260956-8   deyk.........................................................................
HGL_H00000311747     .............................................................................
HGL_H00000358479     p............................................................................
HGL_H00000339090     .............................................................................
HGL_H00000291552-1   hydeffeev....................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000382296     nvtnkn.......................................................................
HGL_H00000376344     nqk..........................................................................
HGL_H00000405738     dntvvrarglpwqssdqdiarffkglniakggaalclnaqgrrngealvrfvseehrdlalqrhkhhmgtryievyk
HGL_H00000396578-4   k............................................................................
HGL_H00000261723-3   ysckvflggvpwditeaglvntfrvfgslsvewpgkdgkhprcppkgnmpkgyvylvfeleksvrallqacshdpls
HGL_H00000261723-2   ysckvflggvpwditeaglvntfrvfgslsvewpgkdgkhprcppkgnmpkgyvylvfeleksvrallqacshdpls
HGL_H00000358532     kga..........................................................................
HGL_H00000409088     spl..........................................................................
HGL_H00000405738     qfvpptnv.....................................................................
HGL_H00000267197     kele.........................................................................
HGL_H00000382239     sprr.........................................................................
HGL_H00000218364     eprkkgek.....................................................................
HGL_H00000312675     dn...........................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000254799     nivditfvmdyrgrrktgeayvqfeepemasqalmkhreeignryieifpsrrnevrthvgshkgrkvvssptakci
HGL_H00000369887-4   sgs..........................................................................
HGL_H00000260956-6   fs...........................................................................
HGL_H00000246194-1   qtsdvtnk.....................................................................
HGL_H00000352668     plpi.........................................................................
HGL_H00000260956-8   fs...........................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000415054     hcksctlfp....................................................................
HGL_H00000413532     kgrvetsrvvhimdfqrgknlr.......................................................
HGL_H00000293677     n............................................................................
HGL_H00000390625     ssymhg.......................................................................
HGL_H00000418748     grd..........................................................................
HGL_H00000221419     p............................................................................
HGL_H00000262563     vrvv.........................................................................
HGL_N10014200        .............................................................................
HGL_H00000260956-2   heyk.........................................................................
HGL_H00000386226     pvnqee.......................................................................
HGL_H00000260956-4   fs...........................................................................
HGL_H00000377738     pgs..........................................................................
HGL_H00000382239     prktr........................................................................
HGL_H00000396578-1   tgailp.......................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000199814-1   edktvttq.....................................................................
HGL_H00000397673-2   rhtllrhegieavsyatqslvvan.....................................................
HGL_H00000260956-3   deyk.........................................................................
HGL_H00000420195-2   trseds.......................................................................
HGL_H00000390625     ggnkvlllsiqnpl...............................................................
HGL_H00000349428-1   nfq..........................................................................
HGL_H00000349428-2   nfq..........................................................................
HGL_H00000418748     dvve.........................................................................
HGL_H00000345412-2   a............................................................................
HGL_H00000391432     lsrrc........................................................................
HGL_H00000303015     dfyh.........................................................................
HGL_H00000351723-2   n............................................................................
HGL_H00000371634     .............................................................................
HGL_H00000278070     sssssss......................................................................
HGL_H00000266529-5   sk...........................................................................
HGL_H00000327539     egg..........................................................................
HGL_H00000266679     .............................................................................
HGL_H00000340176     v............................................................................
HGL_H00000246071-2   pqv..........................................................................
HGL_H00000371321     .............................................................................
HGL_H00000369218     lrnmvgagevdedleiet...........................................................
HGL_H00000347792     vfqevssfqgpldatvvvnlqsptleeknefpedlr.........................................
HGL_H00000359965     lp...........................................................................
HGL_H00000395738     sei..........................................................................
HGL_H00000243563-2   ppa..........................................................................
HGL_M00000102130     emstvyagpvsrtynfrplkrllksfgpiqsmsfvletyqlesnkeeiliflqphlcvqyevleaaqlaieslngiv
HGL_H00000260956-4   deyk.........................................................................
HGL_H00000387911     pylnlegpdlq..................................................................
HGL_H00000417839     gl...........................................................................
HGL_H00000300069     v............................................................................
HGL_H00000295119-2   idgtrvtviwfpqasasy...........................................................
HGL_H00000221419     ilnpi........................................................................
HGL_H00000246194-2   .............................................................................
HGL_H00000318195     kvegt........................................................................
HGL_H00000383298-7   .............................................................................
HGL_N10007480        .............................................................................
HGL_N10009032        t............................................................................
HGL_H00000266529-3   p............................................................................
HGL_H00000260956-2   fs...........................................................................
HGL_H00000265271     yt...........................................................................
HGL_H00000369887-3   kgstss.......................................................................
HGL_H00000409667     niykevitvqgppdgtvlvsiksslqednffnd............................................
HGL_H00000285814-2   .............................................................................
HGL_H00000351723-1   n............................................................................
HGL_H00000228284     qkekaaalkrd..................................................................
HGL_H00000262519     rsknr........................................................................
HGL_R00000006780     .............................................................................
HGL_H00000343054     vqsvdy.......................................................................
HGL_H00000384357     .............................................................................
HGL_H00000419446-2   ee...........................................................................
HGL_H00000377694     qslr.........................................................................
HGL_H00000264867     kai..........................................................................
HGL_H00000223073     vs...........................................................................
HGL_H00000387531     e............................................................................
HGL_H00000285814-3   e............................................................................
HGL_H00000401946     .............................................................................
HGL_N10012356        .............................................................................
HGL_H00000379654     gad..........................................................................
HGL_H00000379144-1   anpkpss......................................................................
HGL_H00000334538     p............................................................................
HGL_N10012285        .............................................................................
HGL_H00000260956-6   .............................................................................
HGL_H00000316638     lkn..........................................................................
HGL_H00000379144-2   stsaws.......................................................................
HGL_H00000260956-5   d............................................................................
HGL_H00000358799     r............................................................................
HGL_H00000354021-1   k............................................................................
HGL_H00000377694     dpeantnki....................................................................
HGL_H00000295470-4   k............................................................................
HGL_H00000420195-1   rppntslfvrnvaddts............................................................
HGL_N10011773        .............................................................................
HGL_H00000262710     ddpvrta......................................................................
HGL_H00000382239     v............................................................................
HGL_H00000260956-1   .............................................................................
HGL_H00000344950     ppgpqflsgvivkitspeplpgr......................................................
HGL_H00000266022     daqrdl.......................................................................
HGL_H00000222956     vreds........................................................................
HGL_H00000284073     .............................................................................
HGL_H00000258729     lds..........................................................................
HGL_H00000418748     redq.........................................................................
HGL_H00000364912     rygrvesvkilpkrgseggvaafvdfvdiksaqkahnsvnkmgdrdlrtdynepgtipsaarglddtvsiasrsrev
HGL_H00000377694     ket..........................................................................
HGL_H00000294428     .............................................................................
HGL_H00000352668     v............................................................................
HGL_H00000387531     hrpraleisaftes...............................................................
HGL_H00000265866-1   .............................................................................
HGL_H00000384160     ec...........................................................................
HGL_H00000320401     .............................................................................
HGL_H00000321449-1   stw..........................................................................
HGL_H00000261723-1   ysckvllggvpwdsmeaglvstfcvfgslsvewpgkdgkhawc..................................
HGL_N10005061        krm..........................................................................
HGL_N10021697        pfat.........................................................................
HGL_H00000266022     emrq.........................................................................
HGL_H00000295119-1   msntgnwmh....................................................................
HGL_H00000291688     ai...........................................................................
HGL_H00000330813     slkedv.......................................................................
HGL_H00000274849     kravp........................................................................
HGL_N10021697        .............................................................................
HGL_H00000321449-2   stw..........................................................................
HGL_H00000265753-2   ssrnq........................................................................
HGL_H00000379654     h............................................................................
HGL_H00000419242     le...........................................................................
HGL_H00000324827-3   pc...........................................................................
HGL_N10014876        r............................................................................
HGL_H00000413303-2   .............................................................................
HGL_H00000413303-2   .............................................................................
HGL_H00000220496     .............................................................................
HGL_H00000415464-2   ekvrp........................................................................
HGL_H00000293273     d............................................................................
HGL_H00000243563-1   k............................................................................
HGL_H00000345412-1   psdd.........................................................................
HGL_H00000324827-2   kp...........................................................................
HGL_H00000299213     .............................................................................
HGL_H00000331211     ra...........................................................................
HGL_H00000326128     vrp..........................................................................
HGL_H00000314491     rplh.........................................................................
HGL_H00000260956-1   sd...........................................................................
HGL_H00000312649     .............................................................................
HGL_H00000292672     .............................................................................
HGL_H00000287202     .............................................................................
HGL_H00000238688-2   .............................................................................
HGL_H00000324827-1   ps...........................................................................
HGL_H00000221419     qaaknr.......................................................................


                                                                                                    
                                                                                                    
d1hl6a_                .............................................................................
HGL_H00000361949-2   .............................................................................
HGL_H00000255136     .............................................................................
HGL_H00000271628-1   .............................................................................
HGL_H00000361949-2   .............................................................................
HGL_H00000308012     .............................................................................
HGL_H00000393248-2   .............................................................................
HGL_H00000255136     .............................................................................
HGL_H00000358089     .............................................................................
HGL_H00000408239     .............................................................................
HGL_H00000271628-2   .............................................................................
HGL_H00000352612     .............................................................................
HGL_H00000416340-1   .............................................................................
HGL_H00000360886     fannpsqkssqallsqlyqspnrrypgplhhqaqrfrldnl....................................
HGL_H00000408239     .............................................................................
HGL_H00000352162     .............................................................................
HGL_H00000264073-2   .............................................................................
HGL_H00000389951     kfadtqkdkeqrrlqqqlaqqmqqlntatwgnltglggltpqylallqqatsssnlgafsgiqqmagmnalqlqnla
HGL_H00000355089     lvvkfadtdkertmrrmqqmagqmgmfnpmaipfgaygayaqalmqqqaalmasvaqggylnpmaafaaaqmqqmaa
HGL_H00000287202     kladtdreralrrmqqmagqlgalhpaplplgacgayttailqhqaallaaaqgpglgpvaavaaqmqhvaafslva
HGL_H00000313007-2   .............................................................................
HGL_H00000308012     .............................................................................
HGL_H00000414859-2   vvkfadtqkdkeqkrmaqqlqqqmqqisaasvwgnlaglntlgpqylalylqllqqtassgnlntlsslhpmgglna
HGL_H00000313007-1   .............................................................................
HGL_H00000316042     .............................................................................
HGL_H00000414859-1   kfadtqkdkeqkrmarqlqqqmqqisaasvwgnlaglntlrpqylallqqiassgtlntlsslhpmgelnamqlqnl
HGL_H00000414859-3   .............................................................................
HGL_H00000412831     .............................................................................
HGL_H00000401336     .............................................................................
HGL_H00000373277     .............................................................................
HGL_H00000402734     .............................................................................
HGL_H00000343966     .............................................................................
HGL_H00000264073-1   .............................................................................
HGL_H00000362900     .............................................................................
HGL_H00000326806     .............................................................................
HGL_H00000229390-2   .............................................................................
HGL_H00000365950-3   .............................................................................
HGL_H00000416340-2   .............................................................................
HGL_H00000294172-1   .............................................................................
HGL_H00000253363     .............................................................................
HGL_H00000349748-2   .............................................................................
HGL_H00000297071     .............................................................................
HGL_H00000276079     .............................................................................
HGL_H00000294172-2   .............................................................................
HGL_H00000393937     .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000402114     .............................................................................
HGL_H00000276201-1   .............................................................................
HGL_H00000276201-2   .............................................................................
HGL_H00000359645-2   .............................................................................
HGL_H00000376290-4   .............................................................................
HGL_H00000376290-3   .............................................................................
HGL_H00000341826     .............................................................................
HGL_D0073543         .............................................................................
HGL_H00000383298-1   .............................................................................
HGL_H00000387996     .............................................................................
HGL_H00000309166-3   .............................................................................
HGL_H00000364912     .............................................................................
HGL_H00000393248-1   .............................................................................
HGL_H00000332444     .............................................................................
HGL_H00000376290-2   .............................................................................
HGL_H00000313007-1   .............................................................................
HGL_H00000313890-1   .............................................................................
HGL_H00000376290-5   .............................................................................
HGL_H00000359645-1   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000221448     .............................................................................
HGL_H00000266529-8   .............................................................................
HGL_H00000333001     .............................................................................
HGL_H00000364448     .............................................................................
HGL_H00000360886     .............................................................................
HGL_H00000281722     .............................................................................
HGL_H00000383298-6   .............................................................................
HGL_H00000352612     .............................................................................
HGL_H00000352956     .............................................................................
HGL_H00000293677     .............................................................................
HGL_H00000295470-1   .............................................................................
HGL_H00000322016     .............................................................................
HGL_H00000402503     .............................................................................
HGL_H00000233078     .............................................................................
HGL_H00000351108     .............................................................................
HGL_H00000253329     .............................................................................
HGL_H00000257552     .............................................................................
HGL_H00000341826     .............................................................................
HGL_H00000243563-3   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000371212     .............................................................................
HGL_H00000307863     .............................................................................
HGL_H00000361924     .............................................................................
HGL_H00000266529-6   .............................................................................
HGL_H00000331817     .............................................................................
HGL_H00000266529-7   .............................................................................
HGL_H00000365950-2   .............................................................................
HGL_H00000376290-1   .............................................................................
HGL_H00000313199-1   .............................................................................
HGL_H00000233078     .............................................................................
HGL_H00000383298-2   .............................................................................
HGL_H00000358799     .............................................................................
HGL_H00000264073-2   .............................................................................
HGL_H00000354021-2   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000376117     .............................................................................
HGL_H00000416340-4   .............................................................................
HGL_H00000246071-1   .............................................................................
HGL_H00000285814-6   .............................................................................
HGL_H00000383298-8   .............................................................................
HGL_H00000216727-1   .............................................................................
HGL_H00000313199-1   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000362936     .............................................................................
HGL_H00000266529-9   .............................................................................
HGL_H00000320768     .............................................................................
HGL_H00000413035     .............................................................................
HGL_H00000386226     .............................................................................
HGL_H00000309117     .............................................................................
HGL_H00000266529-1   .............................................................................
HGL_H00000363105     .............................................................................
HGL_H00000223073     .............................................................................
HGL_M00000038256     .............................................................................
HGL_H00000354021-2   .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000383298-2   .............................................................................
HGL_H00000333170     .............................................................................
HGL_H00000351108     .............................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000363516     .............................................................................
HGL_H00000294428     .............................................................................
HGL_H00000354719     .............................................................................
HGL_H00000253108     .............................................................................
HGL_H00000313890-2   .............................................................................
HGL_H00000266529-10  .............................................................................
HGL_H00000346120     .............................................................................
HGL_H00000365950-5   .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000295470-1   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000290341     .............................................................................
HGL_H00000362820-2   .............................................................................
HGL_H00000309558     .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000365950-4   .............................................................................
HGL_H00000262633     .............................................................................
HGL_H00000420195-3   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000294904     .............................................................................
HGL_H00000265753-1   .............................................................................
HGL_H00000325905     .............................................................................
HGL_H00000364639-2   .............................................................................
HGL_H00000363105     .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000252542     .............................................................................
HGL_H00000243563-2   .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000354021-1   .............................................................................
HGL_H00000409315     .............................................................................
HGL_H00000313199-2   .............................................................................
HGL_H00000361927     .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000358089     .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000361949-1   .............................................................................
HGL_H00000228284     .............................................................................
HGL_H00000355089     .............................................................................
HGL_H00000362687     .............................................................................
HGL_H00000250863     .............................................................................
HGL_H00000365950-1   .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000322016     .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000414921     .............................................................................
HGL_N10016780        .............................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000310471-3   .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000352162     .............................................................................
HGL_H00000262031     .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000292672     .............................................................................
HGL_H00000218364     .............................................................................
HGL_H00000313199-2   .............................................................................
HGL_H00000338477-1   .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000216727-2   .............................................................................
HGL_H00000285814-5   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_H00000338477-1   .............................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000265866-2   .............................................................................
HGL_H00000265866-2   .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000265997     .............................................................................
HGL_H00000361557     .............................................................................
HGL_H00000311747     .............................................................................
HGL_H00000259997     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000229390-1   .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_N10004544        .............................................................................
HGL_H00000240185     .............................................................................
HGL_H00000285814-4   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000383298-7   .............................................................................
HGL_H00000265085     .............................................................................
HGL_H00000404545-2   .............................................................................
HGL_H00000396578-3   .............................................................................
HGL_M00000078602     .............................................................................
HGL_H00000352668     mreieknppaqgkkglkmpvpgnpavpgmxfgpplpppglggtfgdarpgmpsvgnsglpglglevpgfgggpnnlg
HGL_H00000383298-4   .............................................................................
HGL_H00000338095-2   .............................................................................
HGL_H00000361927     .............................................................................
HGL_H00000366829     .............................................................................
HGL_H00000295470-3   .............................................................................
HGL_R00000023552     .............................................................................
HGL_H00000285814-1   .............................................................................
HGL_N10004520        .............................................................................
HGL_H00000246194-3   .............................................................................
HGL_H00000414859-2   .............................................................................
HGL_H00000402503     .............................................................................
HGL_H00000199814-2   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000262031     .............................................................................
HGL_H00000383298-5   .............................................................................
HGL_H00000390913     .............................................................................
HGL_H00000344950     .............................................................................
HGL_H00000334538     .............................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000310471-3   .............................................................................
HGL_H00000400142     .............................................................................
HGL_H00000294904     .............................................................................
HGL_N10006621        .............................................................................
HGL_H00000310471-2   .............................................................................
HGL_M00000111283     .............................................................................
HGL_H00000369887-2   .............................................................................
HGL_H00000362820-1   .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000383298-3   .............................................................................
HGL_H00000343054     .............................................................................
HGL_H00000364639-1   .............................................................................
HGL_H00000371212     .............................................................................
HGL_H00000389951     .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000379069     .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000315859     .............................................................................
HGL_H00000393937     matqmvaaqlasvvwnnpsqqqflqfggssgsql...........................................
HGL_H00000414921     vqlpregqedq..................................................................
HGL_H00000369887-1   .............................................................................
HGL_H00000361927     .............................................................................
HGL_N10001384        .............................................................................
HGL_H00000360425     .............................................................................
HGL_H00000240185     .............................................................................
HGL_H00000396578-2   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000281722     .............................................................................
HGL_H00000338095-1   .............................................................................
HGL_H00000238688-1   .............................................................................
HGL_H00000352956     .............................................................................
HGL_H00000413532     .............................................................................
HGL_H00000310471-2   .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_N10024532        .............................................................................
HGL_H00000253363     .............................................................................
HGL_H00000348578     .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000382239     aqiqefgvnfplmstekmqarsqsrdrddhshlfdskdlsvysvgpsenlryeledlrqqdnfkhpqgyfrqpdrrp
HGL_H00000377738     .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000307863     .............................................................................
HGL_H00000356154     .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000414921     .............................................................................
HGL_H00000414859-1   .............................................................................
HGL_H00000295470-4   .............................................................................
HGL_M00000094956     .............................................................................
HGL_H00000286835     .............................................................................
HGL_H00000391432     .............................................................................
HGL_H00000266529-2   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000295470-2   .............................................................................
HGL_N10021125        .............................................................................
HGL_H00000257552     .............................................................................
HGL_H00000265866-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000420270-2   .............................................................................
HGL_H00000254799     .............................................................................
HGL_H00000260956-8   .............................................................................
HGL_H00000311747     .............................................................................
HGL_H00000358479     .............................................................................
HGL_H00000339090     .............................................................................
HGL_H00000291552-1   .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000382296     .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000405738     atgedf.......................................................................
HGL_H00000396578-4   .............................................................................
HGL_H00000261723-3   p............................................................................
HGL_H00000261723-2   pdglseyyfkmssrrmrck..........................................................
HGL_H00000358532     .............................................................................
HGL_H00000409088     .............................................................................
HGL_H00000405738     .............................................................................
HGL_H00000267197     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000218364     .............................................................................
HGL_H00000312675     .............................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000254799     tepdvvfeehevnedir............................................................
HGL_H00000369887-4   .............................................................................
HGL_H00000260956-6   .............................................................................
HGL_H00000246194-1   .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000260956-8   .............................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000415054     .............................................................................
HGL_H00000413532     .............................................................................
HGL_H00000293677     .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000262563     .............................................................................
HGL_N10014200        .............................................................................
HGL_H00000260956-2   .............................................................................
HGL_H00000386226     .............................................................................
HGL_H00000260956-4   .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000396578-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000199814-1   .............................................................................
HGL_H00000397673-2   .............................................................................
HGL_H00000260956-3   .............................................................................
HGL_H00000420195-2   .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000345412-2   .............................................................................
HGL_H00000391432     .............................................................................
HGL_H00000303015     .............................................................................
HGL_H00000351723-2   .............................................................................
HGL_H00000371634     .............................................................................
HGL_H00000278070     .............................................................................
HGL_H00000266529-5   .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000266679     .............................................................................
HGL_H00000340176     .............................................................................
HGL_H00000246071-2   .............................................................................
HGL_H00000371321     .............................................................................
HGL_H00000369218     .............................................................................
HGL_H00000347792     .............................................................................
HGL_H00000359965     .............................................................................
HGL_H00000395738     .............................................................................
HGL_H00000243563-2   .............................................................................
HGL_M00000102130     vegicikvqrpvteltldcdilmkele..................................................
HGL_H00000260956-4   .............................................................................
HGL_H00000387911     .............................................................................
HGL_H00000417839     .............................................................................
HGL_H00000300069     .............................................................................
HGL_H00000295119-2   .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000246194-2   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000383298-7   .............................................................................
HGL_N10007480        .............................................................................
HGL_N10009032        .............................................................................
HGL_H00000266529-3   .............................................................................
HGL_H00000260956-2   .............................................................................
HGL_H00000265271     .............................................................................
HGL_H00000369887-3   .............................................................................
HGL_H00000409667     .............................................................................
HGL_H00000285814-2   .............................................................................
HGL_H00000351723-1   .............................................................................
HGL_H00000228284     .............................................................................
HGL_H00000262519     .............................................................................
HGL_R00000006780     .............................................................................
HGL_H00000343054     .............................................................................
HGL_H00000384357     .............................................................................
HGL_H00000419446-2   .............................................................................
HGL_H00000377694     .............................................................................
HGL_H00000264867     .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000387531     .............................................................................
HGL_H00000285814-3   .............................................................................
HGL_H00000401946     .............................................................................
HGL_N10012356        .............................................................................
HGL_H00000379654     .............................................................................
HGL_H00000379144-1   .............................................................................
HGL_H00000334538     .............................................................................
HGL_N10012285        .............................................................................
HGL_H00000260956-6   .............................................................................
HGL_H00000316638     .............................................................................
HGL_H00000379144-2   .............................................................................
HGL_H00000260956-5   .............................................................................
HGL_H00000358799     .............................................................................
HGL_H00000354021-1   .............................................................................
HGL_H00000377694     .............................................................................
HGL_H00000295470-4   .............................................................................
HGL_H00000420195-1   .............................................................................
HGL_N10011773        .............................................................................
HGL_H00000262710     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000260956-1   .............................................................................
HGL_H00000344950     .............................................................................
HGL_H00000266022     .............................................................................
HGL_H00000222956     .............................................................................
HGL_H00000284073     .............................................................................
HGL_H00000258729     .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000364912     sgfrgggggpaygpppslharegryerrldgasdnrerayehsayghhergtgafdrtrhydqdyyrdprertlphg
HGL_H00000377694     .............................................................................
HGL_H00000294428     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000387531     .............................................................................
HGL_H00000265866-1   .............................................................................
HGL_H00000384160     .............................................................................
HGL_H00000320401     .............................................................................
HGL_H00000321449-1   .............................................................................
HGL_H00000261723-1   .............................................................................
HGL_N10005061        .............................................................................
HGL_N10021697        .............................................................................
HGL_H00000266022     .............................................................................
HGL_H00000295119-1   .............................................................................
HGL_H00000291688     .............................................................................
HGL_H00000330813     .............................................................................
HGL_H00000274849     .............................................................................
HGL_N10021697        .............................................................................
HGL_H00000321449-2   .............................................................................
HGL_H00000265753-2   .............................................................................
HGL_H00000379654     .............................................................................
HGL_H00000419242     .............................................................................
HGL_H00000324827-3   .............................................................................
HGL_N10014876        .............................................................................
HGL_H00000413303-2   .............................................................................
HGL_H00000413303-2   .............................................................................
HGL_H00000220496     .............................................................................
HGL_H00000415464-2   .............................................................................
HGL_H00000293273     .............................................................................
HGL_H00000243563-1   .............................................................................
HGL_H00000345412-1   .............................................................................
HGL_H00000324827-2   .............................................................................
HGL_H00000299213     .............................................................................
HGL_H00000331211     .............................................................................
HGL_H00000326128     .............................................................................
HGL_H00000314491     .............................................................................
HGL_H00000260956-1   .............................................................................
HGL_H00000312649     .............................................................................
HGL_H00000292672     .............................................................................
HGL_H00000287202     .............................................................................
HGL_H00000238688-2   .............................................................................
HGL_H00000324827-1   .............................................................................
HGL_H00000221419     .............................................................................


                                                                                                    
                                                                                                    
d1hl6a_                .............................................................................
HGL_H00000361949-2   .............................................................................
HGL_H00000255136     .............................................................................
HGL_H00000271628-1   .............................................................................
HGL_H00000361949-2   .............................................................................
HGL_H00000308012     .............................................................................
HGL_H00000393248-2   .............................................................................
HGL_H00000255136     .............................................................................
HGL_H00000358089     .............................................................................
HGL_H00000408239     .............................................................................
HGL_H00000271628-2   .............................................................................
HGL_H00000352612     .............................................................................
HGL_H00000416340-1   .............................................................................
HGL_H00000360886     .............................................................................
HGL_H00000408239     .............................................................................
HGL_H00000352162     .............................................................................
HGL_H00000264073-2   .............................................................................
HGL_H00000389951     tlaaaaaaaqtsatstnanplsttssalgaltspvaastpnstagaamnsltslgtlqglagatvglnninalavaq
HGL_H00000355089     lnmnglaaapmtptsggstppgitapavpsipspigvngftglppqangqpaaeavfangihpypaqsptaadplqq
HGL_H00000287202     apllpaaansppgggpgtlsgfpgpigvngfgpltaqtngqpgsdtlynnglspypaqspgvadplqqayagmhhya
HGL_H00000313007-2   .............................................................................
HGL_H00000308012     .............................................................................
HGL_H00000414859-2   mqlqnlaalaaaasaaqntpsgtnalttsssplsvltssgsspsssssnsvnpiaslgalqtlagataglnvgslag
HGL_H00000313007-1   .............................................................................
HGL_H00000316042     .............................................................................
HGL_H00000414859-1   aalaaaasaaqntpsgtnalatsssplsilassgsspsssssnsvnpiaslgalqtlagataglnvgslagmaalng
HGL_H00000414859-3   .............................................................................
HGL_H00000412831     .............................................................................
HGL_H00000401336     .............................................................................
HGL_H00000373277     .............................................................................
HGL_H00000402734     .............................................................................
HGL_H00000343966     .............................................................................
HGL_H00000264073-1   .............................................................................
HGL_H00000362900     .............................................................................
HGL_H00000326806     .............................................................................
HGL_H00000229390-2   .............................................................................
HGL_H00000365950-3   .............................................................................
HGL_H00000416340-2   .............................................................................
HGL_H00000294172-1   .............................................................................
HGL_H00000253363     .............................................................................
HGL_H00000349748-2   .............................................................................
HGL_H00000297071     .............................................................................
HGL_H00000276079     .............................................................................
HGL_H00000294172-2   .............................................................................
HGL_H00000393937     .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000402114     .............................................................................
HGL_H00000276201-1   .............................................................................
HGL_H00000276201-2   .............................................................................
HGL_H00000359645-2   .............................................................................
HGL_H00000376290-4   .............................................................................
HGL_H00000376290-3   .............................................................................
HGL_H00000341826     .............................................................................
HGL_D0073543         .............................................................................
HGL_H00000383298-1   .............................................................................
HGL_H00000387996     .............................................................................
HGL_H00000309166-3   .............................................................................
HGL_H00000364912     .............................................................................
HGL_H00000393248-1   .............................................................................
HGL_H00000332444     .............................................................................
HGL_H00000376290-2   .............................................................................
HGL_H00000313007-1   .............................................................................
HGL_H00000313890-1   .............................................................................
HGL_H00000376290-5   .............................................................................
HGL_H00000359645-1   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000221448     .............................................................................
HGL_H00000266529-8   .............................................................................
HGL_H00000333001     .............................................................................
HGL_H00000364448     .............................................................................
HGL_H00000360886     .............................................................................
HGL_H00000281722     .............................................................................
HGL_H00000383298-6   .............................................................................
HGL_H00000352612     .............................................................................
HGL_H00000352956     .............................................................................
HGL_H00000293677     .............................................................................
HGL_H00000295470-1   .............................................................................
HGL_H00000322016     .............................................................................
HGL_H00000402503     .............................................................................
HGL_H00000233078     .............................................................................
HGL_H00000351108     .............................................................................
HGL_H00000253329     .............................................................................
HGL_H00000257552     .............................................................................
HGL_H00000341826     .............................................................................
HGL_H00000243563-3   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000371212     .............................................................................
HGL_H00000307863     .............................................................................
HGL_H00000361924     .............................................................................
HGL_H00000266529-6   .............................................................................
HGL_H00000331817     .............................................................................
HGL_H00000266529-7   .............................................................................
HGL_H00000365950-2   .............................................................................
HGL_H00000376290-1   .............................................................................
HGL_H00000313199-1   .............................................................................
HGL_H00000233078     .............................................................................
HGL_H00000383298-2   .............................................................................
HGL_H00000358799     .............................................................................
HGL_H00000264073-2   .............................................................................
HGL_H00000354021-2   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000376117     .............................................................................
HGL_H00000416340-4   .............................................................................
HGL_H00000246071-1   .............................................................................
HGL_H00000285814-6   .............................................................................
HGL_H00000383298-8   .............................................................................
HGL_H00000216727-1   .............................................................................
HGL_H00000313199-1   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000362936     .............................................................................
HGL_H00000266529-9   .............................................................................
HGL_H00000320768     .............................................................................
HGL_H00000413035     .............................................................................
HGL_H00000386226     .............................................................................
HGL_H00000309117     .............................................................................
HGL_H00000266529-1   .............................................................................
HGL_H00000363105     .............................................................................
HGL_H00000223073     .............................................................................
HGL_M00000038256     .............................................................................
HGL_H00000354021-2   .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000383298-2   .............................................................................
HGL_H00000333170     .............................................................................
HGL_H00000351108     .............................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000363516     .............................................................................
HGL_H00000294428     .............................................................................
HGL_H00000354719     .............................................................................
HGL_H00000253108     .............................................................................
HGL_H00000313890-2   .............................................................................
HGL_H00000266529-10  .............................................................................
HGL_H00000346120     .............................................................................
HGL_H00000365950-5   .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000295470-1   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000290341     .............................................................................
HGL_H00000362820-2   .............................................................................
HGL_H00000309558     .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000365950-4   .............................................................................
HGL_H00000262633     .............................................................................
HGL_H00000420195-3   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000294904     .............................................................................
HGL_H00000265753-1   .............................................................................
HGL_H00000325905     .............................................................................
HGL_H00000364639-2   .............................................................................
HGL_H00000363105     .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000252542     .............................................................................
HGL_H00000243563-2   .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000354021-1   .............................................................................
HGL_H00000409315     .............................................................................
HGL_H00000313199-2   .............................................................................
HGL_H00000361927     .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000358089     .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000361949-1   .............................................................................
HGL_H00000228284     .............................................................................
HGL_H00000355089     .............................................................................
HGL_H00000362687     .............................................................................
HGL_H00000250863     .............................................................................
HGL_H00000365950-1   .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000322016     .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000414921     .............................................................................
HGL_N10016780        .............................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000310471-3   .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000352162     .............................................................................
HGL_H00000262031     .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000292672     .............................................................................
HGL_H00000218364     .............................................................................
HGL_H00000313199-2   .............................................................................
HGL_H00000338477-1   .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000216727-2   .............................................................................
HGL_H00000285814-5   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_H00000338477-1   .............................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000265866-2   .............................................................................
HGL_H00000265866-2   .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000265997     .............................................................................
HGL_H00000361557     .............................................................................
HGL_H00000311747     .............................................................................
HGL_H00000259997     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000229390-1   .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_N10004544        .............................................................................
HGL_H00000240185     .............................................................................
HGL_H00000285814-4   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000383298-7   .............................................................................
HGL_H00000265085     .............................................................................
HGL_H00000404545-2   .............................................................................
HGL_H00000396578-3   .............................................................................
HGL_M00000078602     .............................................................................
HGL_H00000352668     gpsgfpggpqnfgngpgtlggppgfgsgppgl.............................................
HGL_H00000383298-4   .............................................................................
HGL_H00000338095-2   .............................................................................
HGL_H00000361927     .............................................................................
HGL_H00000366829     .............................................................................
HGL_H00000295470-3   .............................................................................
HGL_R00000023552     .............................................................................
HGL_H00000285814-1   .............................................................................
HGL_N10004520        .............................................................................
HGL_H00000246194-3   .............................................................................
HGL_H00000414859-2   .............................................................................
HGL_H00000402503     .............................................................................
HGL_H00000199814-2   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000262031     .............................................................................
HGL_H00000383298-5   .............................................................................
HGL_H00000390913     .............................................................................
HGL_H00000344950     .............................................................................
HGL_H00000334538     .............................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000310471-3   .............................................................................
HGL_H00000400142     .............................................................................
HGL_H00000294904     .............................................................................
HGL_N10006621        .............................................................................
HGL_H00000310471-2   .............................................................................
HGL_M00000111283     .............................................................................
HGL_H00000369887-2   .............................................................................
HGL_H00000362820-1   .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000383298-3   .............................................................................
HGL_H00000343054     .............................................................................
HGL_H00000364639-1   .............................................................................
HGL_H00000371212     .............................................................................
HGL_H00000389951     .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000379069     .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000315859     .............................................................................
HGL_H00000393937     .............................................................................
HGL_H00000414921     .............................................................................
HGL_H00000369887-1   .............................................................................
HGL_H00000361927     .............................................................................
HGL_N10001384        .............................................................................
HGL_H00000360425     .............................................................................
HGL_H00000240185     .............................................................................
HGL_H00000396578-2   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000281722     .............................................................................
HGL_H00000338095-1   .............................................................................
HGL_H00000238688-1   .............................................................................
HGL_H00000352956     .............................................................................
HGL_H00000413532     .............................................................................
HGL_H00000310471-2   .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_N10024532        .............................................................................
HGL_H00000253363     .............................................................................
HGL_H00000348578     .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000382239     pedfrhspedfrfspedfrrspeifrhprekhfrrppeedfrrpreddwrrpledwrwpleedfrqppeedfrrsle
HGL_H00000377738     .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000307863     .............................................................................
HGL_H00000356154     .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000414921     .............................................................................
HGL_H00000414859-1   .............................................................................
HGL_H00000295470-4   .............................................................................
HGL_M00000094956     .............................................................................
HGL_H00000286835     .............................................................................
HGL_H00000391432     .............................................................................
HGL_H00000266529-2   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000295470-2   .............................................................................
HGL_N10021125        .............................................................................
HGL_H00000257552     .............................................................................
HGL_H00000265866-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000420270-2   .............................................................................
HGL_H00000254799     .............................................................................
HGL_H00000260956-8   .............................................................................
HGL_H00000311747     .............................................................................
HGL_H00000358479     .............................................................................
HGL_H00000339090     .............................................................................
HGL_H00000291552-1   .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000382296     .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000405738     .............................................................................
HGL_H00000396578-4   .............................................................................
HGL_H00000261723-3   .............................................................................
HGL_H00000261723-2   .............................................................................
HGL_H00000358532     .............................................................................
HGL_H00000409088     .............................................................................
HGL_H00000405738     .............................................................................
HGL_H00000267197     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000218364     .............................................................................
HGL_H00000312675     .............................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000254799     .............................................................................
HGL_H00000369887-4   .............................................................................
HGL_H00000260956-6   .............................................................................
HGL_H00000246194-1   .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000260956-8   .............................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000415054     .............................................................................
HGL_H00000413532     .............................................................................
HGL_H00000293677     .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000262563     .............................................................................
HGL_N10014200        .............................................................................
HGL_H00000260956-2   .............................................................................
HGL_H00000386226     .............................................................................
HGL_H00000260956-4   .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000396578-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000199814-1   .............................................................................
HGL_H00000397673-2   .............................................................................
HGL_H00000260956-3   .............................................................................
HGL_H00000420195-2   .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000345412-2   .............................................................................
HGL_H00000391432     .............................................................................
HGL_H00000303015     .............................................................................
HGL_H00000351723-2   .............................................................................
HGL_H00000371634     .............................................................................
HGL_H00000278070     .............................................................................
HGL_H00000266529-5   .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000266679     .............................................................................
HGL_H00000340176     .............................................................................
HGL_H00000246071-2   .............................................................................
HGL_H00000371321     .............................................................................
HGL_H00000369218     .............................................................................
HGL_H00000347792     .............................................................................
HGL_H00000359965     .............................................................................
HGL_H00000395738     .............................................................................
HGL_H00000243563-2   .............................................................................
HGL_M00000102130     .............................................................................
HGL_H00000260956-4   .............................................................................
HGL_H00000387911     .............................................................................
HGL_H00000417839     .............................................................................
HGL_H00000300069     .............................................................................
HGL_H00000295119-2   .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000246194-2   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000383298-7   .............................................................................
HGL_N10007480        .............................................................................
HGL_N10009032        .............................................................................
HGL_H00000266529-3   .............................................................................
HGL_H00000260956-2   .............................................................................
HGL_H00000265271     .............................................................................
HGL_H00000369887-3   .............................................................................
HGL_H00000409667     .............................................................................
HGL_H00000285814-2   .............................................................................
HGL_H00000351723-1   .............................................................................
HGL_H00000228284     .............................................................................
HGL_H00000262519     .............................................................................
HGL_R00000006780     .............................................................................
HGL_H00000343054     .............................................................................
HGL_H00000384357     .............................................................................
HGL_H00000419446-2   .............................................................................
HGL_H00000377694     .............................................................................
HGL_H00000264867     .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000387531     .............................................................................
HGL_H00000285814-3   .............................................................................
HGL_H00000401946     .............................................................................
HGL_N10012356        .............................................................................
HGL_H00000379654     .............................................................................
HGL_H00000379144-1   .............................................................................
HGL_H00000334538     .............................................................................
HGL_N10012285        .............................................................................
HGL_H00000260956-6   .............................................................................
HGL_H00000316638     .............................................................................
HGL_H00000379144-2   .............................................................................
HGL_H00000260956-5   .............................................................................
HGL_H00000358799     .............................................................................
HGL_H00000354021-1   .............................................................................
HGL_H00000377694     .............................................................................
HGL_H00000295470-4   .............................................................................
HGL_H00000420195-1   .............................................................................
HGL_N10011773        .............................................................................
HGL_H00000262710     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000260956-1   .............................................................................
HGL_H00000344950     .............................................................................
HGL_H00000266022     .............................................................................
HGL_H00000222956     .............................................................................
HGL_H00000284073     .............................................................................
HGL_H00000258729     .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000364912     lyytsprsrspnrfdahdpryeprareqftlpsvvhrdiyrdditreklkfegqgfssvvpclprkckvlslipgyp
HGL_H00000377694     .............................................................................
HGL_H00000294428     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000387531     .............................................................................
HGL_H00000265866-1   .............................................................................
HGL_H00000384160     .............................................................................
HGL_H00000320401     .............................................................................
HGL_H00000321449-1   .............................................................................
HGL_H00000261723-1   .............................................................................
HGL_N10005061        .............................................................................
HGL_N10021697        .............................................................................
HGL_H00000266022     .............................................................................
HGL_H00000295119-1   .............................................................................
HGL_H00000291688     .............................................................................
HGL_H00000330813     .............................................................................
HGL_H00000274849     .............................................................................
HGL_N10021697        .............................................................................
HGL_H00000321449-2   .............................................................................
HGL_H00000265753-2   .............................................................................
HGL_H00000379654     .............................................................................
HGL_H00000419242     .............................................................................
HGL_H00000324827-3   .............................................................................
HGL_N10014876        .............................................................................
HGL_H00000413303-2   .............................................................................
HGL_H00000413303-2   .............................................................................
HGL_H00000220496     .............................................................................
HGL_H00000415464-2   .............................................................................
HGL_H00000293273     .............................................................................
HGL_H00000243563-1   .............................................................................
HGL_H00000345412-1   .............................................................................
HGL_H00000324827-2   .............................................................................
HGL_H00000299213     .............................................................................
HGL_H00000331211     .............................................................................
HGL_H00000326128     .............................................................................
HGL_H00000314491     .............................................................................
HGL_H00000260956-1   .............................................................................
HGL_H00000312649     .............................................................................
HGL_H00000292672     .............................................................................
HGL_H00000287202     .............................................................................
HGL_H00000238688-2   .............................................................................
HGL_H00000324827-1   .............................................................................
HGL_H00000221419     .............................................................................


                                                                                                    
                                                                                                    
d1hl6a_                .............................................................................
HGL_H00000361949-2   .............................................................................
HGL_H00000255136     .............................................................................
HGL_H00000271628-1   .............................................................................
HGL_H00000361949-2   .............................................................................
HGL_H00000308012     .............................................................................
HGL_H00000393248-2   .............................................................................
HGL_H00000255136     .............................................................................
HGL_H00000358089     .............................................................................
HGL_H00000408239     .............................................................................
HGL_H00000271628-2   .............................................................................
HGL_H00000352612     .............................................................................
HGL_H00000416340-1   .............................................................................
HGL_H00000360886     .............................................................................
HGL_H00000408239     .............................................................................
HGL_H00000352162     .............................................................................
HGL_H00000264073-2   .............................................................................
HGL_H00000389951     mlsgmaalngglgatgltngtagtmdaltqaysgiqqyaaaalptlysqsll.........................
HGL_H00000355089     ayagvqqyagpaaypaa............................................................
HGL_H00000287202     aayp.........................................................................
HGL_H00000313007-2   .............................................................................
HGL_H00000308012     .............................................................................
HGL_H00000414859-2   maalngglgssglsngtgstmealtqaysgiqqyaaaalptlynqn...............................
HGL_H00000313007-1   .............................................................................
HGL_H00000316042     .............................................................................
HGL_H00000414859-1   glgnsglsngtsstmealtqaysgiqqytaaalptlynq......................................
HGL_H00000414859-3   .............................................................................
HGL_H00000412831     .............................................................................
HGL_H00000401336     .............................................................................
HGL_H00000373277     .............................................................................
HGL_H00000402734     .............................................................................
HGL_H00000343966     .............................................................................
HGL_H00000264073-1   .............................................................................
HGL_H00000362900     .............................................................................
HGL_H00000326806     .............................................................................
HGL_H00000229390-2   .............................................................................
HGL_H00000365950-3   .............................................................................
HGL_H00000416340-2   .............................................................................
HGL_H00000294172-1   .............................................................................
HGL_H00000253363     .............................................................................
HGL_H00000349748-2   .............................................................................
HGL_H00000297071     .............................................................................
HGL_H00000276079     .............................................................................
HGL_H00000294172-2   .............................................................................
HGL_H00000393937     .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000402114     .............................................................................
HGL_H00000276201-1   .............................................................................
HGL_H00000276201-2   .............................................................................
HGL_H00000359645-2   .............................................................................
HGL_H00000376290-4   .............................................................................
HGL_H00000376290-3   .............................................................................
HGL_H00000341826     .............................................................................
HGL_D0073543         .............................................................................
HGL_H00000383298-1   .............................................................................
HGL_H00000387996     .............................................................................
HGL_H00000309166-3   .............................................................................
HGL_H00000364912     .............................................................................
HGL_H00000393248-1   .............................................................................
HGL_H00000332444     .............................................................................
HGL_H00000376290-2   .............................................................................
HGL_H00000313007-1   .............................................................................
HGL_H00000313890-1   .............................................................................
HGL_H00000376290-5   .............................................................................
HGL_H00000359645-1   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000221448     .............................................................................
HGL_H00000266529-8   .............................................................................
HGL_H00000333001     .............................................................................
HGL_H00000364448     .............................................................................
HGL_H00000360886     .............................................................................
HGL_H00000281722     .............................................................................
HGL_H00000383298-6   .............................................................................
HGL_H00000352612     .............................................................................
HGL_H00000352956     .............................................................................
HGL_H00000293677     .............................................................................
HGL_H00000295470-1   .............................................................................
HGL_H00000322016     .............................................................................
HGL_H00000402503     .............................................................................
HGL_H00000233078     .............................................................................
HGL_H00000351108     .............................................................................
HGL_H00000253329     .............................................................................
HGL_H00000257552     .............................................................................
HGL_H00000341826     .............................................................................
HGL_H00000243563-3   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000371212     .............................................................................
HGL_H00000307863     .............................................................................
HGL_H00000361924     .............................................................................
HGL_H00000266529-6   .............................................................................
HGL_H00000331817     .............................................................................
HGL_H00000266529-7   .............................................................................
HGL_H00000365950-2   .............................................................................
HGL_H00000376290-1   .............................................................................
HGL_H00000313199-1   .............................................................................
HGL_H00000233078     .............................................................................
HGL_H00000383298-2   .............................................................................
HGL_H00000358799     .............................................................................
HGL_H00000264073-2   .............................................................................
HGL_H00000354021-2   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000376117     .............................................................................
HGL_H00000416340-4   .............................................................................
HGL_H00000246071-1   .............................................................................
HGL_H00000285814-6   .............................................................................
HGL_H00000383298-8   .............................................................................
HGL_H00000216727-1   .............................................................................
HGL_H00000313199-1   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000362936     .............................................................................
HGL_H00000266529-9   .............................................................................
HGL_H00000320768     .............................................................................
HGL_H00000413035     .............................................................................
HGL_H00000386226     .............................................................................
HGL_H00000309117     .............................................................................
HGL_H00000266529-1   .............................................................................
HGL_H00000363105     .............................................................................
HGL_H00000223073     .............................................................................
HGL_M00000038256     .............................................................................
HGL_H00000354021-2   .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000383298-2   .............................................................................
HGL_H00000333170     .............................................................................
HGL_H00000351108     .............................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000363516     .............................................................................
HGL_H00000294428     .............................................................................
HGL_H00000354719     .............................................................................
HGL_H00000253108     .............................................................................
HGL_H00000313890-2   .............................................................................
HGL_H00000266529-10  .............................................................................
HGL_H00000346120     .............................................................................
HGL_H00000365950-5   .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000295470-1   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000290341     .............................................................................
HGL_H00000362820-2   .............................................................................
HGL_H00000309558     .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000365950-4   .............................................................................
HGL_H00000262633     .............................................................................
HGL_H00000420195-3   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000294904     .............................................................................
HGL_H00000265753-1   .............................................................................
HGL_H00000325905     .............................................................................
HGL_H00000364639-2   .............................................................................
HGL_H00000363105     .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000252542     .............................................................................
HGL_H00000243563-2   .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000354021-1   .............................................................................
HGL_H00000409315     .............................................................................
HGL_H00000313199-2   .............................................................................
HGL_H00000361927     .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000358089     .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000361949-1   .............................................................................
HGL_H00000228284     .............................................................................
HGL_H00000355089     .............................................................................
HGL_H00000362687     .............................................................................
HGL_H00000250863     .............................................................................
HGL_H00000365950-1   .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000322016     .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000414921     .............................................................................
HGL_N10016780        .............................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000310471-3   .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000352162     .............................................................................
HGL_H00000262031     .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000292672     .............................................................................
HGL_H00000218364     .............................................................................
HGL_H00000313199-2   .............................................................................
HGL_H00000338477-1   .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000216727-2   .............................................................................
HGL_H00000285814-5   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_H00000338477-1   .............................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000265866-2   .............................................................................
HGL_H00000265866-2   .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000265997     .............................................................................
HGL_H00000361557     .............................................................................
HGL_H00000311747     .............................................................................
HGL_H00000259997     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000229390-1   .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_N10004544        .............................................................................
HGL_H00000240185     .............................................................................
HGL_H00000285814-4   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000383298-7   .............................................................................
HGL_H00000265085     .............................................................................
HGL_H00000404545-2   .............................................................................
HGL_H00000396578-3   .............................................................................
HGL_M00000078602     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000383298-4   .............................................................................
HGL_H00000338095-2   .............................................................................
HGL_H00000361927     .............................................................................
HGL_H00000366829     .............................................................................
HGL_H00000295470-3   .............................................................................
HGL_R00000023552     .............................................................................
HGL_H00000285814-1   .............................................................................
HGL_N10004520        .............................................................................
HGL_H00000246194-3   .............................................................................
HGL_H00000414859-2   .............................................................................
HGL_H00000402503     .............................................................................
HGL_H00000199814-2   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000262031     .............................................................................
HGL_H00000383298-5   .............................................................................
HGL_H00000390913     .............................................................................
HGL_H00000344950     .............................................................................
HGL_H00000334538     .............................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000310471-3   .............................................................................
HGL_H00000400142     .............................................................................
HGL_H00000294904     .............................................................................
HGL_N10006621        .............................................................................
HGL_H00000310471-2   .............................................................................
HGL_M00000111283     .............................................................................
HGL_H00000369887-2   .............................................................................
HGL_H00000362820-1   .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000383298-3   .............................................................................
HGL_H00000343054     .............................................................................
HGL_H00000364639-1   .............................................................................
HGL_H00000371212     .............................................................................
HGL_H00000389951     .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000379069     .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000315859     .............................................................................
HGL_H00000393937     .............................................................................
HGL_H00000414921     .............................................................................
HGL_H00000369887-1   .............................................................................
HGL_H00000361927     .............................................................................
HGL_N10001384        .............................................................................
HGL_H00000360425     .............................................................................
HGL_H00000240185     .............................................................................
HGL_H00000396578-2   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000281722     .............................................................................
HGL_H00000338095-1   .............................................................................
HGL_H00000238688-1   .............................................................................
HGL_H00000352956     .............................................................................
HGL_H00000413532     .............................................................................
HGL_H00000310471-2   .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_N10024532        .............................................................................
HGL_H00000253363     .............................................................................
HGL_H00000348578     .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000382239     gdfrrppeedfrrpwkedfrcppdddfrhpreedfrkptqedfrhspeddfrrspmehirrlpqdhfrrppsehlrr
HGL_H00000377738     .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000307863     .............................................................................
HGL_H00000356154     .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000414921     .............................................................................
HGL_H00000414859-1   .............................................................................
HGL_H00000295470-4   .............................................................................
HGL_M00000094956     .............................................................................
HGL_H00000286835     .............................................................................
HGL_H00000391432     .............................................................................
HGL_H00000266529-2   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000295470-2   .............................................................................
HGL_N10021125        .............................................................................
HGL_H00000257552     .............................................................................
HGL_H00000265866-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000420270-2   .............................................................................
HGL_H00000254799     .............................................................................
HGL_H00000260956-8   .............................................................................
HGL_H00000311747     .............................................................................
HGL_H00000358479     .............................................................................
HGL_H00000339090     .............................................................................
HGL_H00000291552-1   .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000382296     .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000405738     .............................................................................
HGL_H00000396578-4   .............................................................................
HGL_H00000261723-3   .............................................................................
HGL_H00000261723-2   .............................................................................
HGL_H00000358532     .............................................................................
HGL_H00000409088     .............................................................................
HGL_H00000405738     .............................................................................
HGL_H00000267197     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000218364     .............................................................................
HGL_H00000312675     .............................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000254799     .............................................................................
HGL_H00000369887-4   .............................................................................
HGL_H00000260956-6   .............................................................................
HGL_H00000246194-1   .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000260956-8   .............................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000415054     .............................................................................
HGL_H00000413532     .............................................................................
HGL_H00000293677     .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000262563     .............................................................................
HGL_N10014200        .............................................................................
HGL_H00000260956-2   .............................................................................
HGL_H00000386226     .............................................................................
HGL_H00000260956-4   .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000396578-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000199814-1   .............................................................................
HGL_H00000397673-2   .............................................................................
HGL_H00000260956-3   .............................................................................
HGL_H00000420195-2   .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000345412-2   .............................................................................
HGL_H00000391432     .............................................................................
HGL_H00000303015     .............................................................................
HGL_H00000351723-2   .............................................................................
HGL_H00000371634     .............................................................................
HGL_H00000278070     .............................................................................
HGL_H00000266529-5   .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000266679     .............................................................................
HGL_H00000340176     .............................................................................
HGL_H00000246071-2   .............................................................................
HGL_H00000371321     .............................................................................
HGL_H00000369218     .............................................................................
HGL_H00000347792     .............................................................................
HGL_H00000359965     .............................................................................
HGL_H00000395738     .............................................................................
HGL_H00000243563-2   .............................................................................
HGL_M00000102130     .............................................................................
HGL_H00000260956-4   .............................................................................
HGL_H00000387911     .............................................................................
HGL_H00000417839     .............................................................................
HGL_H00000300069     .............................................................................
HGL_H00000295119-2   .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000246194-2   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000383298-7   .............................................................................
HGL_N10007480        .............................................................................
HGL_N10009032        .............................................................................
HGL_H00000266529-3   .............................................................................
HGL_H00000260956-2   .............................................................................
HGL_H00000265271     .............................................................................
HGL_H00000369887-3   .............................................................................
HGL_H00000409667     .............................................................................
HGL_H00000285814-2   .............................................................................
HGL_H00000351723-1   .............................................................................
HGL_H00000228284     .............................................................................
HGL_H00000262519     .............................................................................
HGL_R00000006780     .............................................................................
HGL_H00000343054     .............................................................................
HGL_H00000384357     .............................................................................
HGL_H00000419446-2   .............................................................................
HGL_H00000377694     .............................................................................
HGL_H00000264867     .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000387531     .............................................................................
HGL_H00000285814-3   .............................................................................
HGL_H00000401946     .............................................................................
HGL_N10012356        .............................................................................
HGL_H00000379654     .............................................................................
HGL_H00000379144-1   .............................................................................
HGL_H00000334538     .............................................................................
HGL_N10012285        .............................................................................
HGL_H00000260956-6   .............................................................................
HGL_H00000316638     .............................................................................
HGL_H00000379144-2   .............................................................................
HGL_H00000260956-5   .............................................................................
HGL_H00000358799     .............................................................................
HGL_H00000354021-1   .............................................................................
HGL_H00000377694     .............................................................................
HGL_H00000295470-4   .............................................................................
HGL_H00000420195-1   .............................................................................
HGL_N10011773        .............................................................................
HGL_H00000262710     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000260956-1   .............................................................................
HGL_H00000344950     .............................................................................
HGL_H00000266022     .............................................................................
HGL_H00000222956     .............................................................................
HGL_H00000284073     .............................................................................
HGL_H00000258729     .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000364912     spklklerlllpyyclaasqhdtslk...................................................
HGL_H00000377694     .............................................................................
HGL_H00000294428     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000387531     .............................................................................
HGL_H00000265866-1   .............................................................................
HGL_H00000384160     .............................................................................
HGL_H00000320401     .............................................................................
HGL_H00000321449-1   .............................................................................
HGL_H00000261723-1   .............................................................................
HGL_N10005061        .............................................................................
HGL_N10021697        .............................................................................
HGL_H00000266022     .............................................................................
HGL_H00000295119-1   .............................................................................
HGL_H00000291688     .............................................................................
HGL_H00000330813     .............................................................................
HGL_H00000274849     .............................................................................
HGL_N10021697        .............................................................................
HGL_H00000321449-2   .............................................................................
HGL_H00000265753-2   .............................................................................
HGL_H00000379654     .............................................................................
HGL_H00000419242     .............................................................................
HGL_H00000324827-3   .............................................................................
HGL_N10014876        .............................................................................
HGL_H00000413303-2   .............................................................................
HGL_H00000413303-2   .............................................................................
HGL_H00000220496     .............................................................................
HGL_H00000415464-2   .............................................................................
HGL_H00000293273     .............................................................................
HGL_H00000243563-1   .............................................................................
HGL_H00000345412-1   .............................................................................
HGL_H00000324827-2   .............................................................................
HGL_H00000299213     .............................................................................
HGL_H00000331211     .............................................................................
HGL_H00000326128     .............................................................................
HGL_H00000314491     .............................................................................
HGL_H00000260956-1   .............................................................................
HGL_H00000312649     .............................................................................
HGL_H00000292672     .............................................................................
HGL_H00000287202     .............................................................................
HGL_H00000238688-2   .............................................................................
HGL_H00000324827-1   .............................................................................
HGL_H00000221419     .............................................................................


                                                                                                    
                                                                                                    
d1hl6a_                .............................................................................
HGL_H00000361949-2   .............................................................................
HGL_H00000255136     .............................................................................
HGL_H00000271628-1   .............................................................................
HGL_H00000361949-2   .............................................................................
HGL_H00000308012     .............................................................................
HGL_H00000393248-2   .............................................................................
HGL_H00000255136     .............................................................................
HGL_H00000358089     .............................................................................
HGL_H00000408239     .............................................................................
HGL_H00000271628-2   .............................................................................
HGL_H00000352612     .............................................................................
HGL_H00000416340-1   .............................................................................
HGL_H00000360886     .............................................................................
HGL_H00000408239     .............................................................................
HGL_H00000352162     .............................................................................
HGL_H00000264073-2   .............................................................................
HGL_H00000389951     .............................................................................
HGL_H00000355089     .............................................................................
HGL_H00000287202     .............................................................................
HGL_H00000313007-2   .............................................................................
HGL_H00000308012     .............................................................................
HGL_H00000414859-2   .............................................................................
HGL_H00000313007-1   .............................................................................
HGL_H00000316042     .............................................................................
HGL_H00000414859-1   .............................................................................
HGL_H00000414859-3   .............................................................................
HGL_H00000412831     .............................................................................
HGL_H00000401336     .............................................................................
HGL_H00000373277     .............................................................................
HGL_H00000402734     .............................................................................
HGL_H00000343966     .............................................................................
HGL_H00000264073-1   .............................................................................
HGL_H00000362900     .............................................................................
HGL_H00000326806     .............................................................................
HGL_H00000229390-2   .............................................................................
HGL_H00000365950-3   .............................................................................
HGL_H00000416340-2   .............................................................................
HGL_H00000294172-1   .............................................................................
HGL_H00000253363     .............................................................................
HGL_H00000349748-2   .............................................................................
HGL_H00000297071     .............................................................................
HGL_H00000276079     .............................................................................
HGL_H00000294172-2   .............................................................................
HGL_H00000393937     .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000402114     .............................................................................
HGL_H00000276201-1   .............................................................................
HGL_H00000276201-2   .............................................................................
HGL_H00000359645-2   .............................................................................
HGL_H00000376290-4   .............................................................................
HGL_H00000376290-3   .............................................................................
HGL_H00000341826     .............................................................................
HGL_D0073543         .............................................................................
HGL_H00000383298-1   .............................................................................
HGL_H00000387996     .............................................................................
HGL_H00000309166-3   .............................................................................
HGL_H00000364912     .............................................................................
HGL_H00000393248-1   .............................................................................
HGL_H00000332444     .............................................................................
HGL_H00000376290-2   .............................................................................
HGL_H00000313007-1   .............................................................................
HGL_H00000313890-1   .............................................................................
HGL_H00000376290-5   .............................................................................
HGL_H00000359645-1   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000221448     .............................................................................
HGL_H00000266529-8   .............................................................................
HGL_H00000333001     .............................................................................
HGL_H00000364448     .............................................................................
HGL_H00000360886     .............................................................................
HGL_H00000281722     .............................................................................
HGL_H00000383298-6   .............................................................................
HGL_H00000352612     .............................................................................
HGL_H00000352956     .............................................................................
HGL_H00000293677     .............................................................................
HGL_H00000295470-1   .............................................................................
HGL_H00000322016     .............................................................................
HGL_H00000402503     .............................................................................
HGL_H00000233078     .............................................................................
HGL_H00000351108     .............................................................................
HGL_H00000253329     .............................................................................
HGL_H00000257552     .............................................................................
HGL_H00000341826     .............................................................................
HGL_H00000243563-3   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000371212     .............................................................................
HGL_H00000307863     .............................................................................
HGL_H00000361924     .............................................................................
HGL_H00000266529-6   .............................................................................
HGL_H00000331817     .............................................................................
HGL_H00000266529-7   .............................................................................
HGL_H00000365950-2   .............................................................................
HGL_H00000376290-1   .............................................................................
HGL_H00000313199-1   .............................................................................
HGL_H00000233078     .............................................................................
HGL_H00000383298-2   .............................................................................
HGL_H00000358799     .............................................................................
HGL_H00000264073-2   .............................................................................
HGL_H00000354021-2   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000376117     .............................................................................
HGL_H00000416340-4   .............................................................................
HGL_H00000246071-1   .............................................................................
HGL_H00000285814-6   .............................................................................
HGL_H00000383298-8   .............................................................................
HGL_H00000216727-1   .............................................................................
HGL_H00000313199-1   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000362936     .............................................................................
HGL_H00000266529-9   .............................................................................
HGL_H00000320768     .............................................................................
HGL_H00000413035     .............................................................................
HGL_H00000386226     .............................................................................
HGL_H00000309117     .............................................................................
HGL_H00000266529-1   .............................................................................
HGL_H00000363105     .............................................................................
HGL_H00000223073     .............................................................................
HGL_M00000038256     .............................................................................
HGL_H00000354021-2   .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000383298-2   .............................................................................
HGL_H00000333170     .............................................................................
HGL_H00000351108     .............................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000363516     .............................................................................
HGL_H00000294428     .............................................................................
HGL_H00000354719     .............................................................................
HGL_H00000253108     .............................................................................
HGL_H00000313890-2   .............................................................................
HGL_H00000266529-10  .............................................................................
HGL_H00000346120     .............................................................................
HGL_H00000365950-5   .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000295470-1   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000290341     .............................................................................
HGL_H00000362820-2   .............................................................................
HGL_H00000309558     .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000365950-4   .............................................................................
HGL_H00000262633     .............................................................................
HGL_H00000420195-3   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000294904     .............................................................................
HGL_H00000265753-1   .............................................................................
HGL_H00000325905     .............................................................................
HGL_H00000364639-2   .............................................................................
HGL_H00000363105     .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000252542     .............................................................................
HGL_H00000243563-2   .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000354021-1   .............................................................................
HGL_H00000409315     .............................................................................
HGL_H00000313199-2   .............................................................................
HGL_H00000361927     .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000358089     .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000361949-1   .............................................................................
HGL_H00000228284     .............................................................................
HGL_H00000355089     .............................................................................
HGL_H00000362687     .............................................................................
HGL_H00000250863     .............................................................................
HGL_H00000365950-1   .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000322016     .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000414921     .............................................................................
HGL_N10016780        .............................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000310471-3   .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000352162     .............................................................................
HGL_H00000262031     .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000292672     .............................................................................
HGL_H00000218364     .............................................................................
HGL_H00000313199-2   .............................................................................
HGL_H00000338477-1   .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000216727-2   .............................................................................
HGL_H00000285814-5   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_H00000338477-1   .............................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000265866-2   .............................................................................
HGL_H00000265866-2   .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000265997     .............................................................................
HGL_H00000361557     .............................................................................
HGL_H00000311747     .............................................................................
HGL_H00000259997     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000229390-1   .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_N10004544        .............................................................................
HGL_H00000240185     .............................................................................
HGL_H00000285814-4   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000383298-7   .............................................................................
HGL_H00000265085     .............................................................................
HGL_H00000404545-2   .............................................................................
HGL_H00000396578-3   .............................................................................
HGL_M00000078602     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000383298-4   .............................................................................
HGL_H00000338095-2   .............................................................................
HGL_H00000361927     .............................................................................
HGL_H00000366829     .............................................................................
HGL_H00000295470-3   .............................................................................
HGL_R00000023552     .............................................................................
HGL_H00000285814-1   .............................................................................
HGL_N10004520        .............................................................................
HGL_H00000246194-3   .............................................................................
HGL_H00000414859-2   .............................................................................
HGL_H00000402503     .............................................................................
HGL_H00000199814-2   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000262031     .............................................................................
HGL_H00000383298-5   .............................................................................
HGL_H00000390913     .............................................................................
HGL_H00000344950     .............................................................................
HGL_H00000334538     .............................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000310471-3   .............................................................................
HGL_H00000400142     .............................................................................
HGL_H00000294904     .............................................................................
HGL_N10006621        .............................................................................
HGL_H00000310471-2   .............................................................................
HGL_M00000111283     .............................................................................
HGL_H00000369887-2   .............................................................................
HGL_H00000362820-1   .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000383298-3   .............................................................................
HGL_H00000343054     .............................................................................
HGL_H00000364639-1   .............................................................................
HGL_H00000371212     .............................................................................
HGL_H00000389951     .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000379069     .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000315859     .............................................................................
HGL_H00000393937     .............................................................................
HGL_H00000414921     .............................................................................
HGL_H00000369887-1   .............................................................................
HGL_H00000361927     .............................................................................
HGL_N10001384        .............................................................................
HGL_H00000360425     .............................................................................
HGL_H00000240185     .............................................................................
HGL_H00000396578-2   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000281722     .............................................................................
HGL_H00000338095-1   .............................................................................
HGL_H00000238688-1   .............................................................................
HGL_H00000352956     .............................................................................
HGL_H00000413532     .............................................................................
HGL_H00000310471-2   .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_N10024532        .............................................................................
HGL_H00000253363     .............................................................................
HGL_H00000348578     .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000382239     pppehfrqpppehfrrppqehfrrppqehfrrppqehfrrsreddfrhmpdedfrgppdedfrgppdedfrhlpded
HGL_H00000377738     .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000307863     .............................................................................
HGL_H00000356154     .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000414921     .............................................................................
HGL_H00000414859-1   .............................................................................
HGL_H00000295470-4   .............................................................................
HGL_M00000094956     .............................................................................
HGL_H00000286835     .............................................................................
HGL_H00000391432     .............................................................................
HGL_H00000266529-2   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000295470-2   .............................................................................
HGL_N10021125        .............................................................................
HGL_H00000257552     .............................................................................
HGL_H00000265866-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000420270-2   .............................................................................
HGL_H00000254799     .............................................................................
HGL_H00000260956-8   .............................................................................
HGL_H00000311747     .............................................................................
HGL_H00000358479     .............................................................................
HGL_H00000339090     .............................................................................
HGL_H00000291552-1   .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000382296     .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000405738     .............................................................................
HGL_H00000396578-4   .............................................................................
HGL_H00000261723-3   .............................................................................
HGL_H00000261723-2   .............................................................................
HGL_H00000358532     .............................................................................
HGL_H00000409088     .............................................................................
HGL_H00000405738     .............................................................................
HGL_H00000267197     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000218364     .............................................................................
HGL_H00000312675     .............................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000254799     .............................................................................
HGL_H00000369887-4   .............................................................................
HGL_H00000260956-6   .............................................................................
HGL_H00000246194-1   .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000260956-8   .............................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000415054     .............................................................................
HGL_H00000413532     .............................................................................
HGL_H00000293677     .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000262563     .............................................................................
HGL_N10014200        .............................................................................
HGL_H00000260956-2   .............................................................................
HGL_H00000386226     .............................................................................
HGL_H00000260956-4   .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000396578-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000199814-1   .............................................................................
HGL_H00000397673-2   .............................................................................
HGL_H00000260956-3   .............................................................................
HGL_H00000420195-2   .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000345412-2   .............................................................................
HGL_H00000391432     .............................................................................
HGL_H00000303015     .............................................................................
HGL_H00000351723-2   .............................................................................
HGL_H00000371634     .............................................................................
HGL_H00000278070     .............................................................................
HGL_H00000266529-5   .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000266679     .............................................................................
HGL_H00000340176     .............................................................................
HGL_H00000246071-2   .............................................................................
HGL_H00000371321     .............................................................................
HGL_H00000369218     .............................................................................
HGL_H00000347792     .............................................................................
HGL_H00000359965     .............................................................................
HGL_H00000395738     .............................................................................
HGL_H00000243563-2   .............................................................................
HGL_M00000102130     .............................................................................
HGL_H00000260956-4   .............................................................................
HGL_H00000387911     .............................................................................
HGL_H00000417839     .............................................................................
HGL_H00000300069     .............................................................................
HGL_H00000295119-2   .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000246194-2   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000383298-7   .............................................................................
HGL_N10007480        .............................................................................
HGL_N10009032        .............................................................................
HGL_H00000266529-3   .............................................................................
HGL_H00000260956-2   .............................................................................
HGL_H00000265271     .............................................................................
HGL_H00000369887-3   .............................................................................
HGL_H00000409667     .............................................................................
HGL_H00000285814-2   .............................................................................
HGL_H00000351723-1   .............................................................................
HGL_H00000228284     .............................................................................
HGL_H00000262519     .............................................................................
HGL_R00000006780     .............................................................................
HGL_H00000343054     .............................................................................
HGL_H00000384357     .............................................................................
HGL_H00000419446-2   .............................................................................
HGL_H00000377694     .............................................................................
HGL_H00000264867     .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000387531     .............................................................................
HGL_H00000285814-3   .............................................................................
HGL_H00000401946     .............................................................................
HGL_N10012356        .............................................................................
HGL_H00000379654     .............................................................................
HGL_H00000379144-1   .............................................................................
HGL_H00000334538     .............................................................................
HGL_N10012285        .............................................................................
HGL_H00000260956-6   .............................................................................
HGL_H00000316638     .............................................................................
HGL_H00000379144-2   .............................................................................
HGL_H00000260956-5   .............................................................................
HGL_H00000358799     .............................................................................
HGL_H00000354021-1   .............................................................................
HGL_H00000377694     .............................................................................
HGL_H00000295470-4   .............................................................................
HGL_H00000420195-1   .............................................................................
HGL_N10011773        .............................................................................
HGL_H00000262710     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000260956-1   .............................................................................
HGL_H00000344950     .............................................................................
HGL_H00000266022     .............................................................................
HGL_H00000222956     .............................................................................
HGL_H00000284073     .............................................................................
HGL_H00000258729     .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000364912     .............................................................................
HGL_H00000377694     .............................................................................
HGL_H00000294428     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000387531     .............................................................................
HGL_H00000265866-1   .............................................................................
HGL_H00000384160     .............................................................................
HGL_H00000320401     .............................................................................
HGL_H00000321449-1   .............................................................................
HGL_H00000261723-1   .............................................................................
HGL_N10005061        .............................................................................
HGL_N10021697        .............................................................................
HGL_H00000266022     .............................................................................
HGL_H00000295119-1   .............................................................................
HGL_H00000291688     .............................................................................
HGL_H00000330813     .............................................................................
HGL_H00000274849     .............................................................................
HGL_N10021697        .............................................................................
HGL_H00000321449-2   .............................................................................
HGL_H00000265753-2   .............................................................................
HGL_H00000379654     .............................................................................
HGL_H00000419242     .............................................................................
HGL_H00000324827-3   .............................................................................
HGL_N10014876        .............................................................................
HGL_H00000413303-2   .............................................................................
HGL_H00000413303-2   .............................................................................
HGL_H00000220496     .............................................................................
HGL_H00000415464-2   .............................................................................
HGL_H00000293273     .............................................................................
HGL_H00000243563-1   .............................................................................
HGL_H00000345412-1   .............................................................................
HGL_H00000324827-2   .............................................................................
HGL_H00000299213     .............................................................................
HGL_H00000331211     .............................................................................
HGL_H00000326128     .............................................................................
HGL_H00000314491     .............................................................................
HGL_H00000260956-1   .............................................................................
HGL_H00000312649     .............................................................................
HGL_H00000292672     .............................................................................
HGL_H00000287202     .............................................................................
HGL_H00000238688-2   .............................................................................
HGL_H00000324827-1   .............................................................................
HGL_H00000221419     .............................................................................


                                                                          10         20         30  
                                                                           |          |          |  
d1hl6a_                ...........................................--EFEVDEDGDQGIVRLK.EKAKHRK.GRGFGSD
HGL_H00000361949-2   ...........................................------DPSGKSKGFGFV.SYEKH--.-EDANKA
HGL_H00000255136     ...........................................-----RDNSGHSRGFGFV.NFEKH--.-EEAQKA
HGL_H00000271628-1   ...........................................-----DRVTGQHQGYGFV.EFLSE--.-EDADYA
HGL_H00000361949-2   ...........................................--------TRRSLGYAYV.NFQQP--.-ADAERA
HGL_H00000308012     ...........................................------------------.-------.-------
HGL_H00000393248-2   ...........................................--------TRRSLGYAYV.NYQQP--.-VDAKRA
HGL_H00000255136     ...........................................--------TRRSLGYAYI.NFQQP--.-ADAERA
HGL_H00000358089     ...........................................---------TSNDPYCFV.EFYEH--.-RDAAAA
HGL_H00000408239     ...........................................------DSSGKSKGFGFV.SFESH--.-EAAKRA
HGL_H00000271628-2   ...........................................-----DRVTGQHQGYGFV.EFLSE--.-EDADYD
HGL_H00000352612     ...........................................---------GISRGVGFI.RFDKR--.-IEAEEA
HGL_H00000416340-1   ...........................................------------------.-------.-------
HGL_H00000360886     ...........................................------------------.-------.-------
HGL_H00000408239     ...........................................--------TRQPLGYAYV.NFLQL--.-ADAQRA
HGL_H00000352162     ...........................................------------------.-------.-------
HGL_H00000264073-2   ...........................................-------TTGLSRGVAFI.RFDKR--.-SEAEEA
HGL_H00000389951     ...........................................------------------.-------.-------
HGL_H00000355089     ...........................................------------------.-------.-------
HGL_H00000287202     ...........................................------------------.-------.-------
HGL_H00000313007-2   ...........................................------DESGKSKGFRFV.SFERH--.-EDAQKA
HGL_H00000308012     ...........................................-------VTRSPLGYGYV.NFRFP--.-ADAEWA
HGL_H00000414859-2   ...........................................------------------.-------.-------
HGL_H00000313007-1   ...........................................------------------.-------.-------
HGL_H00000316042     ...........................................------PQTKRSRCFGFV.TYSNV--.-EEADAA
HGL_H00000414859-1   ...........................................------------------.-------.-------
HGL_H00000414859-3   ...........................................------QNPPQSKGCCSV.TFYTR--.-KAALEA
HGL_H00000412831     ...........................................------------------.-------.-------
HGL_H00000401336     ...........................................------------------.-------.-------
HGL_H00000373277     ...........................................-----DKNTNQCKGYGFV.DFDSP--.-AAAQKA
HGL_H00000402734     ...........................................-----------KRGFGFV.EFEDPRD.AD---DA
HGL_H00000343966     ...........................................------------------.-------.-------
HGL_H00000264073-1   ...........................................------------------.-------.-------
HGL_H00000362900     ...........................................------------NGYGFV.EFDDL--.-RDADDA
HGL_H00000326806     ...........................................------------------.-------.-------
HGL_H00000229390-2   ...........................................------------------.-------.-------
HGL_H00000365950-3   ...........................................------------------.-------.-------
HGL_H00000416340-2   ...........................................------------------.-------.-------
HGL_H00000294172-1   ...........................................------------------.-------.-------
HGL_H00000253363     ...........................................------------------.-------.-------
HGL_H00000349748-2   ...........................................------------------.-------.-------
HGL_H00000297071     ...........................................------------------.-------.-------
HGL_H00000276079     ...........................................------------------.-------.-------
HGL_H00000294172-2   ...........................................------------------.-------.-------
HGL_H00000393937     ...........................................-----DKHTKESKGIAFI.KFARS--.-SQACRA
HGL_H00000376344     ...........................................------------------.-------.-------
HGL_H00000402114     ...........................................------------------.-------.-------
HGL_H00000276201-1   ...........................................------------------.-------.-------
HGL_H00000276201-2   ...........................................------------------.-------.-------
HGL_H00000359645-2   ...........................................------------------.-------.-------
HGL_H00000376290-4   ...........................................------------------.-------.-------
HGL_H00000376290-3   ...........................................------------------.-------.-------
HGL_H00000341826     ...........................................------------------.-------.-------
HGL_D0073543         ...........................................------------------.-------.-------
HGL_H00000383298-1   ...........................................-----DPNTKRSRGFGFV.TYATVEE.VDAGSHE
HGL_H00000387996     ...........................................------------------.-------.-------
HGL_H00000309166-3   ...........................................------------------.-------.-------
HGL_H00000364912     ...........................................------------------.-------.-------
HGL_H00000393248-1   ...........................................------------------.-------.-------
HGL_H00000332444     ...........................................------------------.-------.-------
HGL_H00000376290-2   ...........................................------------------.-------.-------
HGL_H00000313007-1   ...........................................------------------.-------.-------
HGL_H00000313890-1   ...........................................------------------.-------.-------
HGL_H00000376290-5   ...........................................------------------.-------.-------
HGL_H00000359645-1   ...........................................------------------.-------.-------
HGL_H00000318195     ...........................................------------------.-------.-------
HGL_H00000401371     ...........................................------------------.-------.-------
HGL_H00000221448     ...........................................------------------.-------.-------
HGL_H00000266529-8   ...........................................------------------.-------.-------
HGL_H00000333001     ...........................................------------------.-------.-------
HGL_H00000364448     ...........................................------------------.-------.-------
HGL_H00000360886     ...........................................------------------.-------.-------
HGL_H00000281722     ...........................................------------------.-------.-------
HGL_H00000383298-6   ...........................................------------------.-------.-------
HGL_H00000352612     ...........................................------------------.-------.-------
HGL_H00000352956     ...........................................------------------.-------.-------
HGL_H00000293677     ...........................................------------------.-------.-------
HGL_H00000295470-1   ...........................................------------------.-------.-------
HGL_H00000322016     ...........................................------------------.-------.-------
HGL_H00000402503     ...........................................------------------.-------.-------
HGL_H00000233078     ...........................................------------------.-------.-------
HGL_H00000351108     ...........................................------------------.-------.-------
HGL_H00000253329     ...........................................------------------.-------.-------
HGL_H00000257552     ...........................................------------------.-------.-------
HGL_H00000341826     ...........................................------------------.-------.-------
HGL_H00000243563-3   ...........................................------------------.-------.-------
HGL_H00000416340-3   ...........................................------------------.-------.-------
HGL_H00000371212     ...........................................------------------.-------.-------
HGL_H00000307863     ...........................................------------------.-------.-------
HGL_H00000361924     ...........................................------------------.-------.-------
HGL_H00000266529-6   ...........................................------------------.-------.-------
HGL_H00000331817     ...........................................------------------.-------.-------
HGL_H00000266529-7   ...........................................------------------.-------.-------
HGL_H00000365950-2   ...........................................------------------.-------.-------
HGL_H00000376290-1   ...........................................------------------.-------.-------
HGL_H00000313199-1   ...........................................------------------.-------.-------
HGL_H00000233078     ...........................................------------------.-------.-------
HGL_H00000383298-2   ...........................................------------------.-------.-------
HGL_H00000358799     ...........................................------------------.-------.-------
HGL_H00000264073-2   ...........................................------------------.-------.-------
HGL_H00000354021-2   ...........................................------------------.-------.-------
HGL_H00000416340-3   ...........................................------------------.-------.-------
HGL_H00000376117     ...........................................------------------.-------.-------
HGL_H00000416340-4   ...........................................------------------.-------.-------
HGL_H00000246071-1   ...........................................------------------.-------.-------
HGL_H00000285814-6   ...........................................------------------.-------.-------
HGL_H00000383298-8   ...........................................------------------.-------.-------
HGL_H00000216727-1   ...........................................------------------.-------.-------
HGL_H00000313199-1   ...........................................------------------.-------.-------
HGL_H00000318195     ...........................................------------------.-------.-------
HGL_H00000362936     ...........................................--------TGIPAGYCFV.EFADL--.-ATAEKC
HGL_H00000266529-9   ...........................................------------------.-------.-------
HGL_H00000320768     ...........................................------------------.-------.-------
HGL_H00000413035     ...........................................------------------.-------.-------
HGL_H00000386226     ...........................................------------------.-------.-------
HGL_H00000309117     ...........................................------------------.-------.-------
HGL_H00000266529-1   ...........................................------------------.-------.-------
HGL_H00000363105     ...........................................-------DKTKNRGFAFV.EYESHRAaAMARRKL
HGL_H00000223073     ...........................................------------------.-------.-------
HGL_M00000038256     ...........................................------------------.-------.-------
HGL_H00000354021-2   ...........................................------------------.-------.-------
HGL_H00000401371     ...........................................------------------.-------.-------
HGL_H00000383298-2   ...........................................------------------.-------.-------
HGL_H00000333170     ...........................................------------------.-------.-------
HGL_H00000351108     ...........................................------------------.-------.-------
HGL_H00000309166-1   ...........................................------------------.-------.-------
HGL_H00000363516     ...........................................------------------.-------.-------
HGL_H00000294428     ...........................................------------------.-------.-------
HGL_H00000354719     ...........................................------------------.-------.-------
HGL_H00000253108     ...........................................------------------.-------.-------
HGL_H00000313890-2   ...........................................------------------.-------.-------
HGL_H00000266529-10  ...........................................------------------.-------.-------
HGL_H00000346120     ...........................................------------------.-------.-------
HGL_H00000365950-5   ...........................................------------------.-------.-------
HGL_H00000316950     ...........................................------------------.-------.-------
HGL_H00000295470-1   ...........................................------------------.-------.-------
HGL_H00000376344     ...........................................------------------.-------.-------
HGL_H00000349428-2   ...........................................------------------.-------.-------
HGL_H00000290341     ...........................................------------------.-------.-------
HGL_H00000362820-2   ...........................................------------------.-------.-------
HGL_H00000309558     ...........................................----------QGGGRGRG.GYDKDGR.GPMTGSS
HGL_H00000316950     ...........................................------------------.-------.-------
HGL_H00000365950-4   ...........................................------------------.-------.-------
HGL_H00000262633     ...........................................------------------.-------.-------
HGL_H00000420195-3   ...........................................------------------.-------.-------
HGL_H00000325376     ...........................................------------------.-------.-------
HGL_H00000294904     ...........................................------------------.-------.-------
HGL_H00000265753-1   ...........................................------------------.-------.-------
HGL_H00000325905     ...........................................------------------.-------.-------
HGL_H00000364639-2   ...........................................------------------.-------.-------
HGL_H00000363105     ...........................................------------------.-------.-------
HGL_H00000358635-1   ...........................................------------------.-------.-------
HGL_H00000316950     ...........................................------------------.-------.-------
HGL_H00000338477-2   ...........................................------------------.-------.-------
HGL_H00000252542     ...........................................------------------.-------.-------
HGL_H00000243563-2   ...........................................------------------.-------.-------
HGL_H00000401371     ...........................................------------------.-------.-------
HGL_H00000354021-1   ...........................................------------------.-------.-------
HGL_H00000409315     ...........................................------------------.-------.-------
HGL_H00000313199-2   ...........................................------------------.-------.-------
HGL_H00000361927     ...........................................------------------.-------.-------
HGL_H00000327539     ...........................................------------------.-------.-------
HGL_H00000358089     ...........................................------------------.-------.-------
HGL_H00000338477-4   ...........................................------------------.-------.-------
HGL_H00000361949-1   ...........................................------------------.-------.-------
HGL_H00000228284     ...........................................------------------.-------.-------
HGL_H00000355089     ...........................................------------------.-------.-------
HGL_H00000362687     ...........................................------------------.-------.-------
HGL_H00000250863     ...........................................------------------.-------.-------
HGL_H00000365950-1   ...........................................------------------.-------.-------
HGL_H00000377738     ...........................................------------------.-------.-------
HGL_H00000322016     ...........................................------------------.-------.-------
HGL_H00000358635-1   ...........................................------------------.-------.-------
HGL_H00000414921     ...........................................------------------.-------.-------
HGL_N10016780        ...........................................------------------.-------.-------
HGL_H00000413303-1   ...........................................------------------.-------.-------
HGL_H00000310471-3   ...........................................------------------.-------.-------
HGL_H00000338477-5   ...........................................------------------.-------.-------
HGL_H00000325376     ...........................................------------------.-------.-------
HGL_H00000352162     ...........................................------------------.-------.-------
HGL_H00000262031     ...........................................------------------.-------.-------
HGL_H00000358635-2   ...........................................------------------.-------.-------
HGL_H00000292672     ...........................................------------------.-------.-------
HGL_H00000218364     ...........................................------------------.-------.-------
HGL_H00000313199-2   ...........................................------------------.-------.-------
HGL_H00000338477-1   ...........................................------------------.-------.-------
HGL_H00000338477-5   ...........................................------------------.-------.-------
HGL_H00000216727-2   ...........................................------------------.-------.-------
HGL_H00000285814-5   ...........................................------------------.-------.-------
HGL_H00000349428-1   ...........................................------------------.-------.-------
HGL_H00000338477-3   ...........................................------------------.-------.-------
HGL_H00000338477-1   ...........................................------------------.-------.-------
HGL_H00000309166-2   ...........................................------------------.-------.-------
HGL_H00000309166-1   ...........................................------------------.-------.-------
HGL_H00000327539     ...........................................------------------.-------.-------
HGL_H00000265866-2   ...........................................------------------.-------.-------
HGL_H00000265866-2   ...........................................------------------.-------.-------
HGL_H00000338477-2   ...........................................------------------.-------.-------
HGL_H00000265997     ...........................................------------------.-------.-------
HGL_H00000361557     ...........................................------------------.-------.-------
HGL_H00000311747     ...........................................------------------.-------.-------
HGL_H00000259997     ...........................................------------------.-------.-------
HGL_H00000352668     ...........................................------------------.-------.-------
HGL_H00000229390-1   ...........................................------------VPFAFV.RFKDP--.-RDAEDA
HGL_H00000338477-4   ...........................................------------------.-------.-------
HGL_H00000349428-1   ...........................................------------------.-------.-------
HGL_H00000349428-2   ...........................................------------------.-------.-------
HGL_N10004544        ...........................................--------------SRSS.SSSSSSG.SPSPSRR
HGL_H00000240185     ...........................................------------------.-------.-------
HGL_H00000285814-4   ...........................................------------------.-------.-------
HGL_H00000376344     ...........................................------------------.-------.-------
HGL_H00000383298-7   ...........................................------------------.-------.-------
HGL_H00000265085     ...........................................------------------.-------.-------
HGL_H00000404545-2   ...........................................------------------.-------.-------
HGL_H00000396578-3   ...........................................------------------.-------.-------
HGL_M00000078602     ...........................................------------------.-------.-------
HGL_H00000352668     ...........................................------------------.----GSA.PGHLSGP
HGL_H00000383298-4   ...........................................------------------.-------.-------
HGL_H00000338095-2   ...........................................------------------.-------.-------
HGL_H00000361927     ...........................................------------------.-------.-------
HGL_H00000366829     ...........................................------------------.-------.-------
HGL_H00000295470-3   ...........................................------------------.-------.-------
HGL_R00000023552     ...........................................------------------.-------.-------
HGL_H00000285814-1   ...........................................------------------.-------.-------
HGL_N10004520        ...........................................------------------.-------.-------
HGL_H00000246194-3   ...........................................------------------.-------.-------
HGL_H00000414859-2   ...........................................------------------.-------.-------
HGL_H00000402503     ...........................................------------------.-------.-------
HGL_H00000199814-2   ...........................................------------------.-------.-------
HGL_H00000325376     ...........................................------------------.-------.-------
HGL_H00000262031     ...........................................------------------.-------.-------
HGL_H00000383298-5   ...........................................------------------.-------.-------
HGL_H00000390913     ...........................................------------------.-------.-------
HGL_H00000344950     ...........................................------------------.-------.-------
HGL_H00000334538     ...........................................------------------.-------.-------
HGL_H00000310471-1   ...........................................------------------.-------.-------
HGL_H00000223073     ...........................................------------------.-------.-------
HGL_H00000310471-3   ...........................................------------------.-------.-------
HGL_H00000400142     ...........................................------------------.-------.-------
HGL_H00000294904     ...........................................------------------.-------.-------
HGL_N10006621        ...........................................------------------.-------.-------
HGL_H00000310471-2   ...........................................------------------.-------.-------
HGL_M00000111283     ...........................................------------------.-------.-------
HGL_H00000369887-2   ...........................................------------------.-------.-------
HGL_H00000362820-1   ...........................................------------------.-------.-------
HGL_H00000223073     ...........................................------------------.-------.-------
HGL_H00000383298-3   ...........................................------------------.-------.-------
HGL_H00000343054     ...........................................--------SDDRRGDRYD.DYRDYDS.PERERER
HGL_H00000364639-1   ...........................................------------------.-------.-------
HGL_H00000371212     ...........................................------------------.-------.-------
HGL_H00000389951     ...........................................------------------.-------.-------
HGL_H00000221419     ...........................................------------------.-------.-------
HGL_H00000379069     ...........................................------------------.-------.-------
HGL_H00000390625     ...........................................------------------.-------.-------
HGL_H00000315859     ...........................................--------------SGSS.SPSRSSS.SSSFSGS
HGL_H00000393937     ...........................................------------------.-------.-------
HGL_H00000414921     ...........................................------------------.-------.-------
HGL_H00000369887-1   ...........................................------------------.-------.-------
HGL_H00000361927     ...........................................------------------.-------.-------
HGL_N10001384        ...........................................------------------.-------.-------
HGL_H00000360425     ...........................................------------------.-------.-------
HGL_H00000240185     ...........................................------------------.-------.-------
HGL_H00000396578-2   ...........................................------------------.-------.-------
HGL_H00000376344     ...........................................------------------.-------.-------
HGL_H00000281722     ...........................................------------------.-------.-------
HGL_H00000338095-1   ...........................................------------------.-------.-------
HGL_H00000238688-1   ...........................................------------------.-------.-------
HGL_H00000352956     ...........................................------------------.-------.-------
HGL_H00000413532     ...........................................------------------.-------.-------
HGL_H00000310471-2   ...........................................------------------.-------.-------
HGL_H00000338477-3   ...........................................------------------.-------.-------
HGL_N10024532        ...........................................--------SGSSSTSRSS.SFSSSSG.SPSPLRR
HGL_H00000253363     ...........................................----------RSRDRRFRgRYRSPYS.GPKFNSA
HGL_H00000348578     ...........................................------------------.-------.-------
HGL_H00000377738     ...........................................------------------.-------.-------
HGL_H00000338477-5   ...........................................------------------.-------.-------
HGL_H00000338477-4   ...........................................------------------.-------.-------
HGL_H00000310471-1   ...........................................------------------.-------.-------
HGL_H00000349428-2   ...........................................------------------.-------.-------
HGL_H00000382239     frspqeedfrcpsdedfrqlpeedlrevpeedprlpdfrpged------------------.---SRNP.PEDFRSH
HGL_H00000377738     ...........................................------------------.-------.-------
HGL_H00000338477-3   ...........................................------------------.-------.-------
HGL_H00000318195     ...........................................------------------.-------.-------
HGL_H00000307863     ...........................................------------------.-------.-------
HGL_H00000356154     ...........................................--------------RKRS.RSRSRER.KRKSSRS
HGL_H00000338477-2   ...........................................------------------.-------.-------
HGL_H00000416340-3   ...........................................------------------.-------.-------
HGL_H00000414921     ...........................................------------------.-------.-------
HGL_H00000414859-1   ...........................................------------------.-------.-------
HGL_H00000295470-4   ...........................................------------------.-------.-------
HGL_M00000094956     ...........................................------------------.-------.-REQRDR
HGL_H00000286835     ...........................................-----------------S.RSRSRDR.RRHSPRS
HGL_H00000391432     ...........................................------------------.-------.-------
HGL_H00000266529-2   ...........................................------------------.-------.-------
HGL_H00000349428-1   ...........................................------------------.-------.-------
HGL_H00000295470-2   ...........................................------------------.-------.-------
HGL_N10021125        ...........................................------------------.-------.-------
HGL_H00000257552     ...........................................------------------.-------.-------
HGL_H00000265866-1   ...........................................------------------.-------.-------
HGL_H00000358635-2   ...........................................------------------.-------.-------
HGL_H00000420270-2   ...........................................------------------.-------.-------
HGL_H00000254799     ...........................................------------------.-------.-------
HGL_H00000260956-8   ...........................................------------------.-------.-------
HGL_H00000311747     ...........................................------------------.-------.-------
HGL_H00000358479     ...........................................------------------.-------.-------
HGL_H00000339090     ...........................................------------------.-------.-------
HGL_H00000291552-1   ...........................................------------------.-------.-------
HGL_H00000358635-1   ...........................................------------------.-------.-------
HGL_H00000358635-2   ...........................................------------------.-------.-------
HGL_H00000382296     ...........................................------------------.-------.-------
HGL_H00000376344     ...........................................------------------.-------.-------
HGL_H00000405738     ...........................................------------------.-------.-------
HGL_H00000396578-4   ...........................................------------------.-------.-------
HGL_H00000261723-3   ...........................................------------------.-------.-------
HGL_H00000261723-2   ...........................................------------------.-------.-------
HGL_H00000358532     ...........................................------------------.-------.-------
HGL_H00000409088     ...........................................------------------.-------.-------
HGL_H00000405738     ...........................................------------------.-------.-------
HGL_H00000267197     ...........................................------------------.-------.-------
HGL_H00000382239     ...........................................------------------.-------.-------
HGL_H00000218364     ...........................................------------------.-------.-------
HGL_H00000312675     ...........................................------------------.-------.-------
HGL_H00000413303-1   ...........................................------------------.-------.-------
HGL_H00000254799     ...........................................------------------.-------.-------
HGL_H00000369887-4   ...........................................------------------.-------.-------
HGL_H00000260956-6   ...........................................------------------.-------.-------
HGL_H00000246194-1   ...........................................------------------.-------.-------
HGL_H00000352668     ...........................................------------------.-------.-------
HGL_H00000260956-8   ...........................................------------------.-------.-------
HGL_H00000309166-2   ...........................................------------------.-------.-------
HGL_H00000415054     ...........................................------------------.-------.-------
HGL_H00000413532     ...........................................------------------.-------.-------
HGL_H00000293677     ...........................................------------------.-------.-------
HGL_H00000390625     ...........................................------------------.-------.-------
HGL_H00000418748     ...........................................------------------.-------.-------
HGL_H00000221419     ...........................................------------------.-------.-------
HGL_H00000262563     ...........................................------------------.-------.-------
HGL_N10014200        ...........................................------------------.-------.-------
HGL_H00000260956-2   ...........................................------------------.-------.-------
HGL_H00000386226     ...........................................------------------.-------.-------
HGL_H00000260956-4   ...........................................------------------.-------.-------
HGL_H00000377738     ...........................................------------------.-------.-------
HGL_H00000382239     ...........................................------------------.-------.-------
HGL_H00000396578-1   ...........................................------------------.-------.-------
HGL_H00000358635-2   ...........................................------------------.-------.-------
HGL_H00000199814-1   ...........................................------------------.-------.-------
HGL_H00000397673-2   ...........................................------------------.-------.-------
HGL_H00000260956-3   ...........................................------------------.-------.-------
HGL_H00000420195-2   ...........................................------------------.-------.-------
HGL_H00000390625     ...........................................------------------.-------.-------
HGL_H00000349428-1   ...........................................------------------.-------.-------
HGL_H00000349428-2   ...........................................------------------.-------.-------
HGL_H00000418748     ...........................................------------------.-------.-------
HGL_H00000345412-2   ...........................................------------------.-------.-------
HGL_H00000391432     ...........................................------------------.-------.-------
HGL_H00000303015     ...........................................------------------.-------.-------
HGL_H00000351723-2   ...........................................------------------.-------.-------
HGL_H00000371634     ...........................................------------------.-------.-------
HGL_H00000278070     ...........................................------------------.SSRSRSR.SPSPRRR
HGL_H00000266529-5   ...........................................------------------.-------.-------
HGL_H00000327539     ...........................................------------------.-------.-------
HGL_H00000266679     ...........................................------------------.-------.-------
HGL_H00000340176     ...........................................------------------.-------.-------
HGL_H00000246071-2   ...........................................------------------.-------.-------
HGL_H00000371321     ...........................................------------------.-------.-------
HGL_H00000369218     ...........................................------------------.-------.-------
HGL_H00000347792     ...........................................------------------.-------.-------
HGL_H00000359965     ...........................................------------------.-------.-------
HGL_H00000395738     ...........................................------------------.-------.-------
HGL_H00000243563-2   ...........................................------------------.-------.-------
HGL_M00000102130     ...........................................------------------.-------.-------
HGL_H00000260956-4   ...........................................------------------.-------.-------
HGL_H00000387911     ...........................................------------------.-------.-------
HGL_H00000417839     ...........................................------------------.-------.-------
HGL_H00000300069     ...........................................------------------.-------.-------
HGL_H00000295119-2   ...........................................------------------.-------.-------
HGL_H00000221419     ...........................................------------------.-------.-------
HGL_H00000246194-2   ...........................................------------------.-------.-------
HGL_H00000318195     ...........................................------------------.-------.-------
HGL_H00000383298-7   ...........................................------------------.-------.-------
HGL_N10007480        ...........................................------------------.-------.-------
HGL_N10009032        ...........................................------------------.-------.-------
HGL_H00000266529-3   ...........................................------------------.-------.-------
HGL_H00000260956-2   ...........................................------------------.-------.-------
HGL_H00000265271     ...........................................------------------.-------.-------
HGL_H00000369887-3   ...........................................------------------.-------.-------
HGL_H00000409667     ...........................................------------------.-------.-------
HGL_H00000285814-2   ...........................................------------------.-------.-------
HGL_H00000351723-1   ...........................................------------------.-------.-------
HGL_H00000228284     ...........................................------------------.-------.-------
HGL_H00000262519     ...........................................------------------.-------.-------
HGL_R00000006780     ...........................................------------------.-------.-------
HGL_H00000343054     ...........................................------------------.-------.-------
HGL_H00000384357     ...........................................------------------.-------.-------
HGL_H00000419446-2   ...........................................------------------.-------.--SMKKA
HGL_H00000377694     ...........................................------------------.-------.-------
HGL_H00000264867     ...........................................------------------.-------.-------
HGL_H00000223073     ...........................................------------------.-------.-------
HGL_H00000387531     ...........................................------------------.-------.-------
HGL_H00000285814-3   ...........................................------------------.-------.-------
HGL_H00000401946     ...........................................------------------.-------.-------
HGL_N10012356        ...........................................------------------.-------.-------
HGL_H00000379654     ...........................................------------------.-------.-------
HGL_H00000379144-1   ...........................................------------------.-------.-------
HGL_H00000334538     ...........................................------------------.-------.-------
HGL_N10012285        ...........................................------------------.-------.-------
HGL_H00000260956-6   ...........................................------------------.-------.-------
HGL_H00000316638     ...........................................------------------.-------.-------
HGL_H00000379144-2   ...........................................------------------.-------.------S
HGL_H00000260956-5   ...........................................------------------.-------.-------
HGL_H00000358799     ...........................................----EYDTGGGSSSSRLH.SYSSPST.KNSSGGG
HGL_H00000354021-1   ...........................................------------------.-------.-------
HGL_H00000377694     ...........................................------------------.-------.-------
HGL_H00000295470-4   ...........................................------------------.-------.-------
HGL_H00000420195-1   ...........................................------------------.-------.-------
HGL_N10011773        ...........................................------------------.-------.-------
HGL_H00000262710     ...........................................------------------.-------.-------
HGL_H00000382239     ...........................................------------------.-------.-------
HGL_H00000260956-1   ...........................................------------------.-------.-------
HGL_H00000344950     ...........................................------------------.-------.-------
HGL_H00000266022     ...........................................------------------.-------.-------
HGL_H00000222956     ...........................................------------------.-------.-------
HGL_H00000284073     ...........................................------------------.-------.-------
HGL_H00000258729     ...........................................------------------.-------.-------
HGL_H00000418748     ...........................................------------------.-------.-------
HGL_H00000364912     ...........................................------------------.-------.-------
HGL_H00000377694     ...........................................------------------.-------.-------
HGL_H00000294428     ...........................................------------------.-------.-------
HGL_H00000352668     ...........................................------------------.-------.-------
HGL_H00000387531     ...........................................------------------.-------.-------
HGL_H00000265866-1   ...........................................------------------.-------.-------
HGL_H00000384160     ...........................................------------------.-------.-------
HGL_H00000320401     ...........................................------------------.-------.-------
HGL_H00000321449-1   ...........................................------------------.-------.-------
HGL_H00000261723-1   ...........................................------------------.-------.-------
HGL_N10005061        ...........................................------------------.-------.-------
HGL_N10021697        ...........................................------------------.-------.-------
HGL_H00000266022     ...........................................------------------.-------.-------
HGL_H00000295119-1   ...........................................------------------.-------.-------
HGL_H00000291688     ...........................................------------------.-------.-------
HGL_H00000330813     ...........................................------------------.-------.-------
HGL_H00000274849     ...........................................------------------.-------.-------
HGL_N10021697        ...........................................------------------.-------.-------
HGL_H00000321449-2   ...........................................------------------.-------.-------
HGL_H00000265753-2   ...........................................------------------.-------.-------
HGL_H00000379654     ...........................................------------------.-------.-------
HGL_H00000419242     ...........................................------------------.-------.-------
HGL_H00000324827-3   ...........................................------------------.-------.-------
HGL_N10014876        ...........................................------------------.-------.-------
HGL_H00000413303-2   ...........................................------------------.-------.-------
HGL_H00000413303-2   ...........................................------------------.-------.-------
HGL_H00000220496     ...........................................------------------.-------.-------
HGL_H00000415464-2   ...........................................------------------.-------.-------
HGL_H00000293273     ...........................................------------------.-------.-------
HGL_H00000243563-1   ...........................................------------------.-------.-------
HGL_H00000345412-1   ...........................................------------------.-------.-RSSSAE
HGL_H00000324827-2   ...........................................------------------.-------.-------
HGL_H00000299213     ...........................................------------------.-------.-------
HGL_H00000331211     ...........................................------------------.-------.-------
HGL_H00000326128     ...........................................------------------.-------.-------
HGL_H00000314491     ...........................................------------------.-------.-------
HGL_H00000260956-1   ...........................................------------------.-------.-------
HGL_H00000312649     ...........................................------------------.-------.-------
HGL_H00000292672     ...........................................------------------.-------.-------
HGL_H00000287202     ...........................................------------------.-------.-------
HGL_H00000238688-2   ...........................................------------------.-------.-------
HGL_H00000324827-1   ...........................................------------------.-------.-------
HGL_H00000221419     ...........................................------------------.-------.-------


                             40          50                                                         
                              |           |                                                         
d1hl6a_                SNTREAIHSYER.VRNED.DDELEPGP..................................................
HGL_H00000361949-2   VEEMNGKEISGK.VIFVG.RAQKKVERqaelkrkfeqlkqer...................................
HGL_H00000255136     VDHMNGKEVSGQ.QLYVG.RAQKRGERqnelkrrfeqmkqdr...................................
HGL_H00000271628-1   IKIMNMIKLYGK.PIRVN.KASAHNKN..................................................
HGL_H00000361949-2   LDTMNFDVIKGK.PIRIM.WSQRDPSL..................................................
HGL_H00000308012     ------------.-----.--------..................................................
HGL_H00000393248-2   LETLNFDVIKGR.PVRIM.WSQRDPSL..................................................
HGL_H00000255136     LDTMNFEVIKGQ.PIRIM.WSQRDPGL..................................................
HGL_H00000358089     LAAMNGRKILGK.EVKVN.WATTPSSQk.................................................
HGL_H00000408239     VEEMNGKDMNGQ.LVFVG.RAQKKVERqaelkhmfeqmkker...................................
HGL_H00000271628-2   IKIMNMIKLYGK.PIRVN.KASAHNKN..................................................
HGL_H00000352612     IKGLNGQKPPGA.TEPIT.VKFANNPSqktnqailsqlyqspnrrypgplaqqaqrfrldnllnmaygvkrfspmti
HGL_H00000416340-1   ------------.-----.--------..................................................
HGL_H00000360886     ------------.-----.-------Lnmaygvkrlmsgpvppsacpprfspitidgmtslvgmnip..........
HGL_H00000408239     LDTMNFDVIKGR.PIRLM.WSQRDACL..................................................
HGL_H00000352162     ------------.-----.--------..................................................
HGL_H00000264073-2   ITSFNGHKPPGS.SEPIT.VKFAANPNqnknvallsqlyhsparrfggpvhhqaqrfrfspmgvdhmsglsgvnvp.
HGL_H00000389951     ------------.-----.-------Qqqsaagsq..........................................
HGL_H00000355089     ------YGQISQ.AFPQP.PPMIPQQQ..................................................
HGL_H00000287202     ----SAYAPVST.TFPQQ.PSALPQQQ..................................................
HGL_H00000313007-2   VDEMNGKELNGK.QIYVG.RAQKKVEPqtepkhkfeqmkqdt...................................
HGL_H00000308012     LNTMNFDLINGK.PFRLM.WSQPDDRL..................................................
HGL_H00000414859-2   ------------.LLTQQ.SIGAAGSQ..................................................
HGL_H00000313007-1   ------------.-----.--------..................................................
HGL_H00000316042     MAASPHAVDGNTvELKRA.VSREDSARp.................................................
HGL_H00000414859-1   -----------N.LLTQQ.SIGAAGSQ..................................................
HGL_H00000414859-3   QNALHNMKVLPG.MHHPI.QMKPADSEk.................................................
HGL_H00000412831     ------------.-----.--------..................................................
HGL_H00000401336     ------------.-----.--------..................................................
HGL_H00000373277     VAS---------.-LKAN.GVQAQMAK..................................................
HGL_H00000402734     VYELDGKELCSE.RVTIE.HARARSRGgrgrgrysdrfssrrprndrrsa...........................
HGL_H00000343966     ------------.-----.--------..................................................
HGL_H00000264073-1   ------------.-----.--------..................................................
HGL_H00000362900     VYELNGKDLCGE.RVIVE.HARGPRRDgsygsgrsgygyrrsgrdkyg.............................
HGL_H00000326806     ------------.-----.------QE..................................................
HGL_H00000229390-2   ------------.-----.--------..................................................
HGL_H00000365950-3   ------------.-----.--------..................................................
HGL_H00000416340-2   ------------.-----.--------..................................................
HGL_H00000294172-1   ------------.-----.--------..................................................
HGL_H00000253363     ------------.-----.--------..................................................
HGL_H00000349748-2   ------------.-----.--------..................................................
HGL_H00000297071     ------------.-----.--------..................................................
HGL_H00000276079     ------------.-----.--------..................................................
HGL_H00000294172-2   ------------.-----.--------..................................................
HGL_H00000393937     MEEMHGQCLEPN.NTKPI.KVFIAQSRssgshrd...........................................
HGL_H00000376344     ------------.-----.--------..................................................
HGL_H00000402114     ------------.-----.--------..................................................
HGL_H00000276201-1   ------------.-----.--------..................................................
HGL_H00000276201-2   ------------.-----.--------..................................................
HGL_H00000359645-2   ------------.-----.--------..................................................
HGL_H00000376290-4   ------------.-----.--------..................................................
HGL_H00000376290-3   ---------HSH.SPMST.RRRHVGNR..................................................
HGL_H00000341826     ------------.-----.--------..................................................
HGL_D0073543         ------------.-----.--------..................................................
HGL_H00000383298-1   RKATQVMDGGVV.EPKRTvSREDSQRP..................................................
HGL_H00000387996     ------------.-----.--------..................................................
HGL_H00000309166-3   ------------.-----.--------..................................................
HGL_H00000364912     ------------.-----.--------..................................................
HGL_H00000393248-1   ------------.-----.--------..................................................
HGL_H00000332444     ------------.-----.--------..................................................
HGL_H00000376290-2   ------------.-----.--------..................................................
HGL_H00000313007-1   ----NFDVIKGK.PVRIM.WSQRDPSL..................................................
HGL_H00000313890-1   ------------.-----.--------..................................................
HGL_H00000376290-5   ------------.-----.--------..................................................
HGL_H00000359645-1   ------------.-----.--------..................................................
HGL_H00000318195     ------------.-----.--------..................................................
HGL_H00000401371     ------------.-----.--------..................................................
HGL_H00000221448     ------------.-----.-----DPN..................................................
HGL_H00000266529-8   ------------.-----.--------..................................................
HGL_H00000333001     ------------.-----.------GP..................................................
HGL_H00000364448     ------------.-----.--------..................................................
HGL_H00000360886     ------------.-NRNC.PSPMQTGA..................................................
HGL_H00000281722     ------------.-----.--------..................................................
HGL_H00000383298-6   ------------.-----.--------..................................................
HGL_H00000352612     ------------.-----.--------..................................................
HGL_H00000352956     ------------.-----.--------..................................................
HGL_H00000293677     ------------.-----.--------..................................................
HGL_H00000295470-1   ------------.-----.--------..................................................
HGL_H00000322016     ------------.-----.--------..................................................
HGL_H00000402503     ------------.-----.--------..................................................
HGL_H00000233078     ------------.-----.--------..................................................
HGL_H00000351108     ------------.-----.--------..................................................
HGL_H00000253329     ------------.-----.-----PDA..................................................
HGL_H00000257552     ------------.-----.----RAQP..................................................
HGL_H00000341826     ------------.-----.--------..................................................
HGL_H00000243563-3   ------------.-----.--------..................................................
HGL_H00000416340-3   ------------.-----.--------..................................................
HGL_H00000371212     ------------.-----.--------..................................................
HGL_H00000307863     ------------.-----.--------..................................................
HGL_H00000361924     ------------.-----.--------..................................................
HGL_H00000266529-6   ------------.-----.--------..................................................
HGL_H00000331817     ------------.-----.--------..................................................
HGL_H00000266529-7   ------------.-----.--------..................................................
HGL_H00000365950-2   ------------.-----.--------..................................................
HGL_H00000376290-1   ------------.-----.--------..................................................
HGL_H00000313199-1   ------------.-----.--------..................................................
HGL_H00000233078     ------------.-----.--------..................................................
HGL_H00000383298-2   ------------.-----.--------..................................................
HGL_H00000358799     ------------.-----.--------..................................................
HGL_H00000264073-2   ------------.-----.--------..................................................
HGL_H00000354021-2   ------------.-----.--------..................................................
HGL_H00000416340-3   ------------.-----.--------..................................................
HGL_H00000376117     ------------.-----.------PR..................................................
HGL_H00000416340-4   ------------.-----.--KDSVKP..................................................
HGL_H00000246071-1   ------------.-----.--------..................................................
HGL_H00000285814-6   ------------.-----.--------..................................................
HGL_H00000383298-8   ------------.-----.--------..................................................
HGL_H00000216727-1   ------------.-----.--------..................................................
HGL_H00000313199-1   ------------.-----.--------..................................................
HGL_H00000318195     ------------.-----.--------..................................................
HGL_H00000362936     LHKINGKPLPGA.TPAKR.FKLNYATYgkq...............................................
HGL_H00000266529-9   ------------.-----.--------..................................................
HGL_H00000320768     ------------.-----.--------..................................................
HGL_H00000413035     ------------.---QS.QTQSSENS..................................................
HGL_H00000386226     ------------.-----.--------..................................................
HGL_H00000309117     ------------.----P.QTQPSENT..................................................
HGL_H00000266529-1   ------------.-----.--------..................................................
HGL_H00000363105     LPGRIQLWGHPI.AVDWA.EPEVEVDE..................................................
HGL_H00000223073     ------------.-----.--------..................................................
HGL_M00000038256     ------------.-----.--------..................................................
HGL_H00000354021-2   ------------.-----.--------..................................................
HGL_H00000401371     ------------.-----.--------..................................................
HGL_H00000383298-2   ------------.-----.--------..................................................
HGL_H00000333170     ------------.-----.--------..................................................
HGL_H00000351108     ------------.-----.--------..................................................
HGL_H00000309166-1   ------------.-----.--------..................................................
HGL_H00000363516     ------------.-----.--------..................................................
HGL_H00000294428     ------------.-----.--------..................................................
HGL_H00000354719     ------------.-----.--------..................................................
HGL_H00000253108     ------------.----R.RGEAMPPN..................................................
HGL_H00000313890-2   ------------.-----.--------..................................................
HGL_H00000266529-10  ------------.-----.--------..................................................
HGL_H00000346120     ------------.-----.--------..................................................
HGL_H00000365950-5   ------------.-----.--------..................................................
HGL_H00000316950     ------------.-----.--------..................................................
HGL_H00000295470-1   ------------.-----.--------..................................................
HGL_H00000376344     ------------.-----.--------..................................................
HGL_H00000349428-2   ------------.-----.--------..................................................
HGL_H00000290341     ---------GKV.ELQGR.RLEIEHSV..................................................
HGL_H00000362820-2   ------------.-----.--------..................................................
HGL_H00000309558     GGDRGGFKNFGG.HRDYG.PRPDADSE..................................................
HGL_H00000316950     ------------.-----.--------..................................................
HGL_H00000365950-4   ------------.-----.--------..................................................
HGL_H00000262633     ------------.-----.-------L..................................................
HGL_H00000420195-3   ------------.-----.--------..................................................
HGL_H00000325376     ------------.-----.--------..................................................
HGL_H00000294904     --------PSTT.SSNNN.SSSSSNSG..................................................
HGL_H00000265753-1   ------------.-----.--------..................................................
HGL_H00000325905     ------------.-----.--------..................................................
HGL_H00000364639-2   ------------.-----.--------..................................................
HGL_H00000363105     -----SLVQENG.QRKYG.GPPPGWDA..................................................
HGL_H00000358635-1   ------------.-----.--------..................................................
HGL_H00000316950     ------------.----I.PPEVISNL..................................................
HGL_H00000338477-2   ------------.-----.--------..................................................
HGL_H00000252542     ------------.-----.--------..................................................
HGL_H00000243563-2   ------------.-----.--------..................................................
HGL_H00000401371     ------------.-----.--------..................................................
HGL_H00000354021-1   ------------.-----.--------..................................................
HGL_H00000409315     ------------.-----.--------..................................................
HGL_H00000313199-2   ------------.-----.--------..................................................
HGL_H00000361927     ------------.-----.--------..................................................
HGL_H00000327539     ------------.-----.--------..................................................
HGL_H00000358089     ------------.-----.--------..................................................
HGL_H00000338477-4   ------------.-----.--------..................................................
HGL_H00000361949-1   ------------.-----.--------..................................................
HGL_H00000228284     ------------.-----.--------..................................................
HGL_H00000355089     ------------.-----.PGNPSTIP..................................................
HGL_H00000362687     ------------.-----.--------..................................................
HGL_H00000250863     ------------.SSSAS.TSQGYVLP..................................................
HGL_H00000365950-1   ------------.-----.--------..................................................
HGL_H00000377738     ------------.-----.--------..................................................
HGL_H00000322016     ------------.-----.--------..................................................
HGL_H00000358635-1   ------------.-----.PPDSIYSG..................................................
HGL_H00000414921     ------------.-----.--------..................................................
HGL_N10016780        ------------.-----.--------..................................................
HGL_H00000413303-1   ------------.-----.--------..................................................
HGL_H00000310471-3   ------------.-----.--------..................................................
HGL_H00000338477-5   ------------.-----.--------..................................................
HGL_H00000325376     ------------.-----.-------Pneiihal...........................................
HGL_H00000352162     ------------.-----.--------..................................................
HGL_H00000262031     ---------PSP.SSSTP.NSSSGGNG..................................................
HGL_H00000358635-2   ------------.-----.---EEPDP..................................................
HGL_H00000292672     ------------.-----.--------..................................................
HGL_H00000218364     ------------.-----.--------..................................................
HGL_H00000313199-2   ------------.-----.--------..................................................
HGL_H00000338477-1   ------------.-----.--------..................................................
HGL_H00000338477-5   ------------.-----.--------..................................................
HGL_H00000216727-2   ------------.-----.--------..................................................
HGL_H00000285814-5   ------------.-----.--------..................................................
HGL_H00000349428-1   ------------.-----.--------..................................................
HGL_H00000338477-3   ------------.-----.--------..................................................
HGL_H00000338477-1   ------------.-----.--------..................................................
HGL_H00000309166-2   ------------.-----.--------..................................................
HGL_H00000309166-1   ------------.-----.--------..................................................
HGL_H00000327539     ------------.-----.--------..................................................
HGL_H00000265866-2   ------------.-----.--------..................................................
HGL_H00000265866-2   ------------.-----.--------..................................................
HGL_H00000338477-2   ------------.-----.--------..................................................
HGL_H00000265997     ------------.-----.--------..................................................
HGL_H00000361557     ------------.-----.----FSSY..................................................
HGL_H00000311747     ------------.-----.--------..................................................
HGL_H00000259997     ------------.-----.--------..................................................
HGL_H00000352668     ------------.-----.--------..................................................
HGL_H00000229390-1   ICGRNGYDYGQC.RLRVE.FPRTYGGRggcprggrtga.......................................
HGL_H00000338477-4   ------------.-----.--------..................................................
HGL_H00000349428-1   ------------.-----.--------..................................................
HGL_H00000349428-2   ------------.-----.--------..................................................
HGL_N10004544        RHDNRRRSRSKS.KPPKR.DEKERKRR..................................................
HGL_H00000240185     ------------.-----.--------..................................................
HGL_H00000285814-4   ------------.-----.--------..................................................
HGL_H00000376344     ------------.-----.--------..................................................
HGL_H00000383298-7   ------------.-----.---KSESP..................................................
HGL_H00000265085     ------------.-----.--------..................................................
HGL_H00000404545-2   ------------.-----.--------..................................................
HGL_H00000396578-3   ------------.-----.--------..................................................
HGL_M00000078602     ------------.-----.--------..................................................
HGL_H00000352668     PAFGPGPGPGPG.PIHIG.GPPGFGSS..................................................
HGL_H00000383298-4   ------------.-----.--------..................................................
HGL_H00000338095-2   ------------.-----.--------..................................................
HGL_H00000361927     ------------.-----.--------..................................................
HGL_H00000366829     ------------.-----.--------..................................................
HGL_H00000295470-3   ------------.-----.--------..................................................
HGL_R00000023552     ------------.-----.--------..................................................
HGL_H00000285814-1   ------------.-----.--------..................................................
HGL_N10004520        ------------.-----.--------..................................................
HGL_H00000246194-3   ------------.-----.-------N..................................................
HGL_H00000414859-2   ------------.----M.NGTLDHPD..................................................
HGL_H00000402503     ------------.-----.--------..................................................
HGL_H00000199814-2   ------------.-----.--------..................................................
HGL_H00000325376     ------------.-----.--------..................................................
HGL_H00000262031     ------------.-----.--------..................................................
HGL_H00000383298-5   ------------.-----.--EDSQRP..................................................
HGL_H00000390913     ------------.-----.--------..................................................
HGL_H00000344950     ------------.-----.-----GER..................................................
HGL_H00000334538     ------------.-----.-MGNVDPS..................................................
HGL_H00000310471-1   ------------.-----.--------..................................................
HGL_H00000223073     ------------.-----.--------..................................................
HGL_H00000310471-3   ------------.-----.--------..................................................
HGL_H00000400142     ------------.-----.--------..................................................
HGL_H00000294904     ------------.-----.--------..................................................
HGL_N10006621        ------------.-----.--------..................................................
HGL_H00000310471-2   ------------.-----.--------..................................................
HGL_M00000111283     ------------.-----.--------..................................................
HGL_H00000369887-2   ------------.-----.--------..................................................
HGL_H00000362820-1   ------------.-----.--------..................................................
HGL_H00000223073     ------------.-----.--------..................................................
HGL_H00000383298-3   ------------.-----.--------..................................................
HGL_H00000343054     RNSDRSEDGYHS.DGDYG.EHDYRHDI..................................................
HGL_H00000364639-1   ------------.-----.--------..................................................
HGL_H00000371212     ------------.-----.--------..................................................
HGL_H00000389951     ------------.-----.--------..................................................
HGL_H00000221419     ------------.-----.-----DDP..................................................
HGL_H00000379069     ------------.-----.--------..................................................
HGL_H00000390625     ------------.-----.--------..................................................
HGL_H00000315859     LSPSRRRHNNNW.PSCSK.SKPPERDEka................................................
HGL_H00000393937     ------------.-----.-------Pqiqtdvilpsckkkad..................................
HGL_H00000414921     --GLTKDFSNSP.LHRFK.KPGSKNFQ..................................................
HGL_H00000369887-1   ------------.-----.--------..................................................
HGL_H00000361927     ------------.-----.--------..................................................
HGL_N10001384        ------------.-----.--------..................................................
HGL_H00000360425     ------------.-----.--------..................................................
HGL_H00000240185     ------------.-----.------SP..................................................
HGL_H00000396578-2   ------------.-----.--------..................................................
HGL_H00000376344     ------------.-----.--------..................................................
HGL_H00000281722     ------------.-----.--------..................................................
HGL_H00000338095-1   ------------.-----.--------..................................................
HGL_H00000238688-1   ------------.-----.--------..................................................
HGL_H00000352956     ------------.-RSPV.REPVDNLS..................................................
HGL_H00000413532     ------------.-----.-------D..................................................
HGL_H00000310471-2   ------------.-----.--------..................................................
HGL_H00000338477-3   ------------.-----.--------..................................................
HGL_N10024532        RHDNRRRSRSKS.KRPKR.DEKERRRR..................................................
HGL_H00000253363     IRGKIGL-----.-----.-------Phsiklsrrrsrskspfrkdkspvrepidnlt...................
HGL_H00000348578     ------------.-----.--------..................................................
HGL_H00000377738     ------------.-----.--------..................................................
HGL_H00000338477-5   ------------.-----.--------..................................................
HGL_H00000338477-4   ------------.-----.--------..................................................
HGL_H00000310471-1   ------------.-----.--------..................................................
HGL_H00000349428-2   ------------.-----.--------..................................................
HGL_H00000382239     RPFVNFGRPEGG.KFDFG.KRNMGGFPegrfmpdpkln.......................................
HGL_H00000377738     ------------.-----.--------..................................................
HGL_H00000338477-3   ------------.-----.--------..................................................
HGL_H00000318195     ------------.-----.--------..................................................
HGL_H00000307863     ------------.-----.--------..................................................
HGL_H00000356154     YSSERRAREREK.ERQKK.GLPPIRSK..................................................
HGL_H00000338477-2   ------------.-----.--------..................................................
HGL_H00000416340-3   ------PQPDSG.RRRRR.RGEEGHDP..................................................
HGL_H00000414921     ------------.-----.--------..................................................
HGL_H00000414859-1   ------------.-----.--------..................................................
HGL_H00000295470-4   ------------.-----.--------..................................................
HGL_M00000094956     DKDRERERERDR.EGPFR.RSDSFPER..................................................
HGL_H00000286835     RSQERRDREKER.ERRQK.GLPQIKPE..................................................
HGL_H00000391432     ------------.-----.-----RSY..................................................
HGL_H00000266529-2   ------------.-----.--------..................................................
HGL_H00000349428-1   ------------.-----.--------..................................................
HGL_H00000295470-2   ------------.-----.-----NAS..................................................
HGL_N10021125        ------------.-----.--------..................................................
HGL_H00000257552     ------------.-----.--------..................................................
HGL_H00000265866-1   ------------.-----.--------..................................................
HGL_H00000358635-2   -----------R.KYGGP.PPDSVYSG..................................................
HGL_H00000420270-2   ------------.-----.--------..................................................
HGL_H00000254799     ------------.-----.--------..................................................
HGL_H00000260956-8   ------------.-----.--------..................................................
HGL_H00000311747     ------------.-----.--------..................................................
HGL_H00000358479     ------------.-----.--------..................................................
HGL_H00000339090     ------------.-----.--------..................................................
HGL_H00000291552-1   ------------.-----.--------..................................................
HGL_H00000358635-1   ------------.-----.--------..................................................
HGL_H00000358635-2   ------------.-----.--------..................................................
HGL_H00000382296     ------------.-----.--------..................................................
HGL_H00000376344     ------------.-----.--------..................................................
HGL_H00000405738     ------------.-----.-------Lkiaggtsnevaqf.....................................
HGL_H00000396578-4   ------------.-----.--------..................................................
HGL_H00000261723-3   ------------.-----.-------Dglseyyfkmssrrmrck.................................
HGL_H00000261723-2   ------------.-----.-------Evqvipwvladsnfvrsps................................
HGL_H00000358532     ------------.-----.--------..................................................
HGL_H00000409088     ------------.-----.--------..................................................
HGL_H00000405738     ------------.-----.--------..................................................
HGL_H00000267197     ------------.-LSVP.KFKIDEFY..................................................
HGL_H00000382239     ------------.-----.------TR..................................................
HGL_H00000218364     ------------.-----.--RKGWFH..................................................
HGL_H00000312675     ------------.-----.--------..................................................
HGL_H00000413303-1   ------------.-----.--------..................................................
HGL_H00000254799     ------------.-----.-------Pmttfenekeielpkevlekvpeaadl........................
HGL_H00000369887-4   ------------.-----.--------..................................................
HGL_H00000260956-6   ------------.-----.--------..................................................
HGL_H00000246194-1   ------------.-----.-------N..................................................
HGL_H00000352668     ------------.-----.--------..................................................
HGL_H00000260956-8   ------------.-----.--------..................................................
HGL_H00000309166-2   ------------.-----.--------..................................................
HGL_H00000415054     ------------.--QNP.NLPPPSTR..................................................
HGL_H00000413532     ------------.-----.--------..................................................
HGL_H00000293677     ------------.-----.--------..................................................
HGL_H00000390625     ------------.-----.--------..................................................
HGL_H00000418748     ------------.-----.--------..................................................
HGL_H00000221419     ------------.-----.--PPPPEY..................................................
HGL_H00000262563     ------------.-----.--------..................................................
HGL_N10014200        ------------.-----.--------..................................................
HGL_H00000260956-2   ------------.-----.--------..................................................
HGL_H00000386226     ------------.-----.--------..................................................
HGL_H00000260956-4   ------------.-----.--------..................................................
HGL_H00000377738     ------------.-----.----KNFQ..................................................
HGL_H00000382239     ------------.-----.--------..................................................
HGL_H00000396578-1   ------------.-----.--------..................................................
HGL_H00000358635-2   ------------.-----.--------..................................................
HGL_H00000199814-1   ------------.-----.--------..................................................
HGL_H00000397673-2   ------------.-----.--------..................................................
HGL_H00000260956-3   ------------.-----.--------..................................................
HGL_H00000420195-2   ------------.-----.--------..................................................
HGL_H00000390625     ------------.-----.--------..................................................
HGL_H00000349428-1   ------------.-----.--------..................................................
HGL_H00000349428-2   ------------.-----.--------..................................................
HGL_H00000418748     ------------.-----.--------..................................................
HGL_H00000345412-2   ------------.-----.--------..................................................
HGL_H00000391432     ------------.-----.--PSSTSL..................................................
HGL_H00000303015     ------------.-----.--------..................................................
HGL_H00000351723-2   ------------.-----.--------..................................................
HGL_H00000371634     ------------.-----.--------..................................................
HGL_H00000278070     SDRRRRYSSYRA.HDHYQ.RQRVLQKE..................................................
HGL_H00000266529-5   ------------.-----.--------..................................................
HGL_H00000327539     ------------.-----.--------..................................................
HGL_H00000266679     ------------.-----.--------..................................................
HGL_H00000340176     ------------.-----.--------..................................................
HGL_H00000246071-2   ------------.-----.--------..................................................
HGL_H00000371321     ------------.-----.--------..................................................
HGL_H00000369218     ------------.-----.--------..................................................
HGL_H00000347792     ------------.-----.--------..................................................
HGL_H00000359965     ------------.-----.---PPATR..................................................
HGL_H00000395738     ------------.-----.--------..................................................
HGL_H00000243563-2   ------------.-----.-----QPL..................................................
HGL_M00000102130     ------------.-----.--------..................................................
HGL_H00000260956-4   ------------.-----.--------..................................................
HGL_H00000387911     ------------.-----.--------..................................................
HGL_H00000417839     ------------.-----.--------..................................................
HGL_H00000300069     ------------.-----.--------..................................................
HGL_H00000295119-2   ------------.-----.--------..................................................
HGL_H00000221419     ------------.-----.--------..................................................
HGL_H00000246194-2   ------------.-----.--------..................................................
HGL_H00000318195     ------------.-----.--------..................................................
HGL_H00000383298-7   ------------.-----.--------..................................................
HGL_N10007480        ------------.-----.--------..................................................
HGL_N10009032        ------------.-----.--------..................................................
HGL_H00000266529-3   ------------.-----.--------..................................................
HGL_H00000260956-2   ------------.-----.--------..................................................
HGL_H00000265271     ------------.-----.--------..................................................
HGL_H00000369887-3   ------------.-----.-----TSG..................................................
HGL_H00000409667     ------------.-----.--------..................................................
HGL_H00000285814-2   ------------.-----.--------..................................................
HGL_H00000351723-1   ------------.-----.--------..................................................
HGL_H00000228284     ------------.-----.--MPKVPH..................................................
HGL_H00000262519     ----------DF.SLPVP.KFKLDEFY..................................................
HGL_R00000006780     ------------.-----.--------..................................................
HGL_H00000343054     ------------.-----.--------..................................................
HGL_H00000384357     ------------.-----.--------..................................................
HGL_H00000419446-2   ADVLNKHSVSGR.PLKVK.ENPDSEQSrramq.............................................
HGL_H00000377694     ------------.-----.--------..................................................
HGL_H00000264867     ------------.-----.--------..................................................
HGL_H00000223073     ------------.-----.--------..................................................
HGL_H00000387531     ------------.-----.--------..................................................
HGL_H00000285814-3   ------------.-----.--------..................................................
HGL_H00000401946     ------------.-----.--------..................................................
HGL_N10012356        ------------.-----.--------..................................................
HGL_H00000379654     ------------.-----.--------..................................................
HGL_H00000379144-1   ---TWGASPLGW.TSSYS.SGSAWSTD..................................................
HGL_H00000334538     ------------.-----.--------..................................................
HGL_N10012285        ------------.-----.--------..................................................
HGL_H00000260956-6   ------------.-----.--------..................................................
HGL_H00000316638     ------------.-----.--------..................................................
HGL_H00000379144-2   IRASNYSVPLSS.TAQST.SGSSWGES..................................................
HGL_H00000260956-5   ------------.-----.--------..................................................
HGL_H00000358799     ESRSSSRGGGGE.SRSSG.AASSAPGG..................................................
HGL_H00000354021-1   ------------.-----.--------..................................................
HGL_H00000377694     ------------.-----.--------..................................................
HGL_H00000295470-4   ------------.-----.--------..................................................
HGL_H00000420195-1   ------------.-----.--------..................................................
HGL_N10011773        ------------.-----.--------..................................................
HGL_H00000262710     ------------.-----.---QVPSP..................................................
HGL_H00000382239     ------------.-----.--------..................................................
HGL_H00000260956-1   ------------.-----.--------..................................................
HGL_H00000344950     ------------.-----.--------..................................................
HGL_H00000266022     ------------.----Q.DQDYRTGP..................................................
HGL_H00000222956     ------------.-----.-----VKP..................................................
HGL_H00000284073     ------------.-----.--------..................................................
HGL_H00000258729     ------------.-----.--------..................................................
HGL_H00000418748     ------------.-----.--------..................................................
HGL_H00000364912     ------------.-----.--------..................................................
HGL_H00000377694     ------------.-----.--------..................................................
HGL_H00000294428     ------------.-----.--------..................................................
HGL_H00000352668     ------------.-----.--------..................................................
HGL_H00000387531     ------------.-----.--------..................................................
HGL_H00000265866-1   ------------.-----.--------..................................................
HGL_H00000384160     ------------.-----.--------..................................................
HGL_H00000320401     ------------.-----.--------..................................................
HGL_H00000321449-1   ------------.-----.--------..................................................
HGL_H00000261723-1   ------------.-----.------PP..................................................
HGL_N10005061        ------------.-----.--------..................................................
HGL_N10021697        ------------.-----.--------..................................................
HGL_H00000266022     ------------.-----.--------..................................................
HGL_H00000295119-1   ------------.-----.--------..................................................
HGL_H00000291688     ------------.-----.--------..................................................
HGL_H00000330813     ------------.-----.--------..................................................
HGL_H00000274849     ------------.-----.--------..................................................
HGL_N10021697        ------------.-----.--------..................................................
HGL_H00000321449-2   ------------.-----.--------..................................................
HGL_H00000265753-2   ------------.-----.------KE..................................................
HGL_H00000379654     ------------.-----.--------..................................................
HGL_H00000419242     ------------.-----.--------..................................................
HGL_H00000324827-3   ------------.-----.--------..................................................
HGL_N10014876        ------------.-----.--------..................................................
HGL_H00000413303-2   ------------.-----.--------..................................................
HGL_H00000413303-2   ------------.-----.--------..................................................
HGL_H00000220496     ------------.-----.--------..................................................
HGL_H00000415464-2   ------------.-----.--------..................................................
HGL_H00000293273     ------------.-----.--------..................................................
HGL_H00000243563-1   ------------.-----.--------..................................................
HGL_H00000345412-1   PSPPILQEPSPK.PNNKT.PAILYMYS..................................................
HGL_H00000324827-2   ------------.-----.--------..................................................
HGL_H00000299213     ------------.-----.--------..................................................
HGL_H00000331211     ------------.-----.--------..................................................
HGL_H00000326128     ------------.-----.--------..................................................
HGL_H00000314491     ------------.-----.--------..................................................
HGL_H00000260956-1   ------------.-----.--------..................................................
HGL_H00000312649     ------------.-----.--------..................................................
HGL_H00000292672     ------------.-----.--------..................................................
HGL_H00000287202     ------------.-----.--------..................................................
HGL_H00000238688-2   ------------.-----.--------..................................................
HGL_H00000324827-1   ------------.-----.--------..................................................
HGL_H00000221419     ------------.-----.--------..................................................


                                    60        70                   80                            90 
                                     |         |                    |                             | 
d1hl6a_                ............QRSVEGWILFVTSIH.EE..A.Q....E.D..EIQ....EKFCD..Y...........G...EIK
HGL_H00000361949-2   ............ISRYQGVNLYIKNLD.DT..I.D....D.E..KLR....KEFSP..F...........G...SIT
HGL_H00000255136     ............QTRYQGVNLYVKNLD.DS..I.S....D.E..KLR....TVFSP..Y...........G...VIT
HGL_H00000271628-1   ............LDV--GANIFIGNLD.PE..I.D....E.K..LLY....DTFSA..F...........G...VIL
HGL_H00000361949-2   ............RKSG-VGNVFIKNLD.KS..I.D....N.K..ALY....DTFSA..F...........G...NIL
HGL_H00000308012     ............------TNVFVKNLG.DD..M.N....D.E..KLK....ELFSE..Y...........G...QIE
HGL_H00000393248-2   ............RKSG-VGNVFIKNLG.KT..I.D....N.K..ALY....NIFST..F...........G...NIL
HGL_H00000255136     ............RKSG-VGNVFIKNLE.DS..I.D....S.K..ALY....DTFST..F...........G...NIL
HGL_H00000358089     ............KDTSNHFHVFVGDLS.PE..I.T....T.E..DIK....SAFAP..F...........G...KIS
HGL_H00000408239     ............IRRCQGVKLYVKNLD.DT..V.D....D.E..QLR....KEFSS..F...........G...SIT
HGL_H00000271628-2   ............LDI--GANIFIGNLD.PE..I.D....E.K..LLY....DTFST..F...........G...VIL
HGL_H00000352612     dgmtslaginipGHPGTGWCIFVYNLA.PD..A.D....E.S..ILW....QMFGP..F...........G...AVT
HGL_H00000416340-1   ............----QLRKLFIGGLS.FE..T.T....D.D..SLR....EHFEK..W...........G...TLT
HGL_H00000360886     ............GHTGTGWCIFVYNLS.PD..S.D....E.S..VLW....QLFGP..F...........G...AVN
HGL_H00000408239     ............RRSG-IGNVFVKNLD.RS..V.D....N.K..TLY....EHFSG..F...........G...KIL
HGL_H00000352162     ............--------LIVNYLP.QN..M.T....Q.D..EFK....SLFGS..I...........G...DIE
HGL_H00000264073-2   ............GNASSGWCIFIYNLG.QD..A.D....E.G..ILW....QMFGP..F...........G...AVT
HGL_H00000389951     ............KEGPEGANLFIYHLP.QE..F.G....D.Q..DIL....QMFMP..F...........G...NVI
HGL_H00000355089     ............REGPEGCNLFIYHLP.QE..F.G....D.A..ELM....QMFLP..F...........G...NVI
HGL_H00000287202     ............REGPEGCNLFIYHLP.QE..F.G....D.A..ELI....QTFLP..F...........G...AVV
HGL_H00000313007-2   ............ITRYQGVNLYVKNLD.DG..I.D....D.E..HLR....KEFSP..F...........G...TIT
HGL_H00000308012     ............RKSG-VGNIFIKNLD.KS..I.D....N.R..GLF....YLFSA..F...........G...NIL
HGL_H00000414859-2   ............KEGPEGANLFIYHLP.QE..F.G....D.Q..DLL....QMFVP..F...........G...NVV
HGL_H00000313007-1   ............------TNVYIKNFG.ED..M.D....D.E..RLK....DLFGK..F...........G...PAL
HGL_H00000316042     ............GAHAKVKKLFVGGLK.GD..V.A....E.G..DLI....EHFSQ..F...........G...TVE
HGL_H00000414859-1   ............KEGPQGANLFIYHLP.QE..F.G....D.Q..DLL....QMFVP..F...........G...NVV
HGL_H00000414859-3   ............NNAVEDRKLFIGMIS.EK..C.T....E.N..DIR....VMFSS..F...........G...QIE
HGL_H00000412831     ............------GKLFVGGLS.FD..T.N....E.Q..SLE....QVFSK..Y...........G...QIS
HGL_H00000401336     ............------CRIYVGNLP.PD..I.R....T.K..DIE....DVFYK..Y...........G...AIR
HGL_H00000373277     ............QQEQDPTNLYISNLP.IS..M.D....E.Q..ELE....NMLKP..F...........G...HVI
HGL_H00000402734     ............PPVRTENRLIVENLS.SR..V.S....W.Q..DLK....DFMRQ..A...........G...EVT
HGL_H00000343966     ............------CRLFVGNLP.TD..I.T....E.E..DFK....RLFER..Y...........G...EPS
HGL_H00000264073-1   ............--------LIVNCLP.QN..M.T....Q.D..ELR....SLFSS..I...........G...EVE
HGL_H00000362900     ............PPTRTEYRLIVENLS.SR..C.S....W.Q..DLK....DYMRQ..A...........G...EVT
HGL_H00000326806     ............KLLKKSCTLYVGNLS.FY..T.T....E.E..QIY....ELFSK..S...........G...DIK
HGL_H00000229390-2   ............-------RIYVGNLP.TD..V.R....E.K..DLE....DLFYK..Y...........G...RIR
HGL_H00000365950-3   ............------GKLFVGGLN.FN..T.D....E.Q..ALE....DHFSS..F...........G...PIS
HGL_H00000416340-2   ............-----LSKLFIGGLS.FE..T.T....D.D..SLR....EHFEK..W...........G...TLT
HGL_H00000294172-1   ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000253363     ............-------RLYVGSLH.FN..I.T....E.D..MLR....GIFEP..F...........G...RIE
HGL_H00000349748-2   ............------CRLFVGNLP.AD..I.T....E.D..EFK....RLFAK..Y...........G...EPG
HGL_H00000297071     ............-NPDPNTCLGVFGLS.LY..T.T....E.R..DLR....EVFSR..Y...........G...PLS
HGL_H00000276079     ............-------RLFVGNLP.PD..I.T....E.E..EMR....KLFEK..Y...........G...KAG
HGL_H00000294172-2   ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000393937     ............VEDEELTRIFVM-IP.KS..Y.T....E.E..DLR....EKFKV..Y...........G...DIE
HGL_H00000376344     ............------GRLFVRNLP.YT..S.T....E.E..DLE....KLFST..Y...........G...PLS
HGL_H00000402114     ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000276201-1   ............-------KVVIRRLP.ST..L.T....R.E..QLQ....EHLQP..M...........P...EHD
HGL_H00000276201-2   ............-------KVVIRRLP.PT..L.T....R.E..QLQ....EHLQP..M...........A...EHD
HGL_H00000359645-2   ............-------KLFIGGLN.TE..T.N....E.K..ALE....AVFGK..Y...........G...RIV
HGL_H00000376290-4   ............--PDPNCCLGVFGLS.LY..T.T....E.R..DLR....EVFSK..Y...........G...PIA
HGL_H00000376290-3   ............ANPDPNCCLGVFGLS.LY..T.T....E.R..DLR....EVFSK..Y...........G...PIA
HGL_H00000341826     ............----QLRKLFIGGLS.FE..T.T....D.E..SLR....SHFEQ..W...........G...TLT
HGL_D0073543         ............CFGPEGCNLFIYHLP.QE..F.G....D.T..ELT....QMFLP..F...........G...NII
HGL_H00000383298-1   ............GAHLTVKKIFVGGIK.ED..T.E....E.H..HLQ....DYFKQ..Y...........G...KIE
HGL_H00000387996     ............--DRSLRSVFVGNIP.YE..A.T....E.E..QLK....DIFSE..V...........G...PVV
HGL_H00000309166-3   ............----PLVKLFIGNLP.RK..A.T....E.Q..EIH....SLFEQ..Y...........G...KVL
HGL_H00000364912     ............-----TRTLFIGNLE.KT..T.T....Y.H..DLR....NTFQR..F...........G...EIV
HGL_H00000393248-1   ............---HSLCSVFVGNIP.HE..A.S....E.E..QLR....DIFSE..V...........G...PVV
HGL_H00000332444     ............--DRSLRSVFVGNIP.YE..A.T....E.E..QLK....DIFSE..V...........G...SVV
HGL_H00000376290-2   ............-NPDPNLCLGVFGLS.LY..T.S....E.R..DLR....EVFSK..Y...........G...PIA
HGL_H00000313007-1   ............RK-SGVGNIFIKNLD.KS..I.D....N.K..ALY....DTFSA..F...........G...NIL
HGL_H00000313890-1   ............------RNLFIGNLD.HS..V.S....E.V..ELR....RAFEK..Y...........G...IIE
HGL_H00000376290-5   ............-NPDPNLCLGVFGLS.LY..T.S....E.R..DLR....EVFSK..Y...........G...PIA
HGL_H00000359645-1   ............-------KLFIGGLN.TE..T.N....E.K..ALE....AVFGK..Y...........G...RIM
HGL_H00000318195     ............ARSQPSKTLFVKGLS.EE..T.T....E.E..TLR....ESFDG..S...........-...--I
HGL_H00000401371     ............---QDHFHVFVGDLS.PE..I.T....T.E..DIK....AAFAP..F...........G...RIS
HGL_H00000221448     ............AQGDAFKTLFVARVN.YD..T.T....E.S..KLR....REFEV..Y...........G...PIK
HGL_H00000266529-8   ............-LAPSKSTVYVSNLP.FS..L.T....N.N..DLY....RIFSK..Y...........G...KVV
HGL_H00000333001     ............QRSVEGWILFVTGVH.EE..A.T....E.E..DIH....DKFAE..Y...........G...EIK
HGL_H00000364448     ............-------KVVLRRLP.PG..L.T....K.E..QLE....EQLRP..L...........P...AHD
HGL_H00000360886     ............ATDDSKTNLIVNYLP.QN..M.T....Q.E..EFR....SLFGS..I...........G...EIE
HGL_H00000281722     ............---PRGCEVFVGKIP.RD..M.Y....E.D..ELV....PVFER..A...........G...KIY
HGL_H00000383298-6   ............----QLRKLFIRELS.FE..T.T....D.E..SLR....SHSEQ..W...........G...TLT
HGL_H00000352612     ............NTEDSKTNLIVNYLP.QN..M.T....Q.E..ELK....SLFGS..I...........G...EIE
HGL_H00000352956     ............-----PKRLYVGCLH.FN..I.T....E.D..MLR....GIFEP..F...........G...KIE
HGL_H00000293677     ............--------LCVANLP.PS..L.T....Q.A..QFE....ELVRP..F...........G...SLE
HGL_H00000295470-1   ............----PPKKVFVGGLS.PD..T.S....E.E..QIK....EYFGA..F...........G...EIE
HGL_H00000322016     ............------NRIYVASVH.QD..L.S....D.D..DIK....SVFEA..F...........G...KIK
HGL_H00000402503     ............------RKLFVGMLG.KQ..Q.T....D.E..DVR....KMFEP..F...........G...TID
HGL_H00000233078     ............--SSKSNKIFVGGIP.HN..C.G....E.T..ELR....EYFKK..F...........G...VVT
HGL_H00000351108     ............--KDPVKKIFVGGLN.PE..A.T....E.E..KIR....EYFGD..F...........G...EIE
HGL_H00000253329     ............DIKPPENVLFVCKLN.PV..T.T....D.E..DLE....IIFSR..F...........G...PIR
HGL_H00000257552     ............KMVTRTKKIFVGGLS.VN..T.T....V.E..DVK....QYFEQ..F...........G...KVD
HGL_H00000341826     ............-----VKKIFVGGIK.ED..T.E....E.H..HLR....DYFEQ..Y...........G...KIE
HGL_H00000243563-3   ............----PNHTIYINNLN.EK..I.K....K.D..ELKkslyAIFSQ..F...........G...QIL
HGL_H00000416340-3   ............----TVKKIFVGGIK.ED..T.E....E.Y..NLR....DYFEK..Y...........G...KIE
HGL_H00000371212     ............------CEVFVGKIP.RD..V.Y....E.D..ELV....PVFEA..V...........G...RIY
HGL_H00000307863     ............-----AHKLFIGGLP.NY..L.N....D.D..QVK....ELLTS..F...........G...PLK
HGL_H00000361924     ............-----KRVLYVGGLA.EE..V.D....D.K..VLH....AAFIP..F...........G...DIT
HGL_H00000266529-6   ............----SKSTVYVSNLP.FS..V.T....N.N..DLY....RIFSK..C...........S...KVV
HGL_H00000331817     ............------GKLLVSNLD.FG..V.S....D.A..DIQ....ELFAE..F...........G...TLK
HGL_H00000266529-7   ............----SKSTVFVSNLS.FS..L.T....N.N..DLY....RIFSK..Y...........G...KVV
HGL_H00000365950-2   ............---PEGCNLFIYHLP.QE..F.G....D.T..ELT....QMFLP..F...........G...NII
HGL_H00000376290-1   ............------CCLGLFGLS.LY..T.T....E.R..DLR....EVFSK..C...........G...PIT
HGL_H00000313199-1   ............----PVKKIFVGGLS.PD..T.P....E.E..KIR....EYFGG..F...........G...EVE
HGL_H00000233078     ............----NCRKLFVGGLD.WS..T.T....Q.E..TLR....SYFSQ..Y...........G...EVV
HGL_H00000383298-2   ............----TVKKIFVGGIK.ED..T.E....E.H..HLR....DYFEQ..C...........G...KIE
HGL_H00000358799     ............-----NRTLFLGNLD.IT..V.T....E.S..DLR....RAFDR..F...........G...VIT
HGL_H00000264073-2   ............-----RTNLIVNYLP.QN..M.T....Q.D..ELR....SLFSS..I...........G...EVE
HGL_H00000354021-2   ............-----VKKLFVGGIK.ED..T.E....E.H..HLR....DYFEE..Y...........G...KID
HGL_H00000416340-3   ............----QLRKLFIGGLS.FE..T.T....D.D..SLR....EHFEK..W...........G...TLT
HGL_H00000376117     ............YGTVIPNRIFVGGID.FK..T.N....E.N..DLR....KFFSQ..Y...........G...SVK
HGL_H00000416340-4   ............GAHLTVKKIFVGGIK.ED..T.E....E.Y..NLR....DYFEK..Y...........G...KID
HGL_H00000246071-1   ............-----NHTIYINNMN.DK..I.K....K.E..ELKrslyALFSQ..F...........G...HVV
HGL_H00000285814-6   ............-EELTPGVIFVGHLP.PV..L.F....E.S..QIK....EYFSQ..F...........G...NIT
HGL_H00000383298-8   ............--------MFIGGLS.WQ..T.S....P.D..SLR....DYFSK..F...........G...EIR
HGL_H00000216727-1   ............----DARSIYVGNVD.YG..A.T....A.E..ELE....AHFHG..C...........G...SVN
HGL_H00000313199-1   ............------WKMFIGGLS.WD..T.T....K.K..DLK....DYFSK..F...........G...EVV
HGL_H00000318195     ............-----SKTLYLSNLS.YS..A.T....E.E..TLQ....EVFEK..A...........-...--T
HGL_H00000362936     ............PDNSPEYSLFVGDLT.PD..V.D....D.G..MLY....EFFVKv.Y...........P...SCR
HGL_H00000266529-9   ............----SKSTVYVSNLA.FS..L.T....N.N..DLY....RIFSK..Y...........G...KVV
HGL_H00000320768     ............--------VFVDGLC.--..-.-....R.A..KFE....SLFRT..Y...........D...KDI
HGL_H00000413035     ............ESKSTPKRLHVSNIP.FR..F.R....D.P..DLR....QMFGQ..F...........G...KIL
HGL_H00000386226     ............---RDKRSVFIGNLP.YK..V.E....E.T..AVE....EHFLD..C...........G...SIV
HGL_H00000309117     ............ENKSQPKRLHVSNIP.FR..F.R....D.P..DLR....QMFGQ..F...........G...KIL
HGL_H00000266529-1   ............----TKSTVYVSNSP.FS..L.T....N.N..DLY....WVFSK..Y...........G...KVV
HGL_H00000363105     ............DTMSSVKILYVRNLM.LS..T.S....E.E..IIE....REFNN..I...........Kp..EIW
HGL_H00000223073     ............------ARLIIRNLS.FK..C.S....E.D..DLK....TVFSQ..F...........G...AVL
HGL_M00000038256     ............-------KLFIGNLP.RE..A.T....G.Q..EIR....SLFEQ..Y...........G...KAL
HGL_H00000354021-2   ............------RKLFIGGLS.FE..T.T....E.E..SLR....NYYEQ..W...........G...KLT
HGL_H00000401371     ............------KTLYVGNLS.RD..V.T....E.A..LIL....QLFSQ..I...........G...PCK
HGL_H00000383298-2   ............------RKLFIQGLS.FE..T.T....D.E..SLR....SCFEQ..W...........G...MLM
HGL_H00000333170     ............---EADTTVFVGNLE.AR..V.R....E.E..ILY....ELFLQ..A...........G...PLT
HGL_H00000351108     ............--------MFVGGLS.WD..T.S....K.K..DLK....DYFTK..F...........G...EVV
HGL_H00000309166-1   ............-----STKLHVGNIS.PT..C.T....N.K..ELR....AKFEE..Y...........G...PVI
HGL_H00000363516     ............---------------.--..-.-....-.E..KFE....ALFSL..Y...........D...DQV
HGL_H00000294428     ............--------LCVTNLP.LS..F.T....L.E..DFE....ELVRA..Y...........G...NIE
HGL_H00000354719     ............----PLLTLFVARLN.LQ..T.K....E.D..KLR....EVFSR..Y...........G...DIR
HGL_H00000253108     ............RRADDNATIRVTNLS.ED..T.R....E.T..DLQ....ELFRP..F...........G...SIS
HGL_H00000313890-2   ............---------------.--..-.-....-.-..---....-----..-...........-...FIE
HGL_H00000266529-10  ............-LAPSKSTMYVSNLP.LS..L.T....D.R..DLY....RIFSK..Y...........G...KVV
HGL_H00000346120     ............---------------.--..-.-....-.-..---....E----..-...........-...---
HGL_H00000365950-5   ............------GKLFVGGLN.FT..T.G....E.Q..ALE....EHFSS..C...........G...PLS
HGL_H00000316950     ............----KGNQIFVRNLP.FD..L.T....W.Q..KLK....EKFSQ..C...........G...HVM
HGL_H00000295470-1   ............--QQDDGKMFIGGLS.WD..T.S....K.K..DLT....EYLSR..F...........G...EVV
HGL_H00000376344     ............---LPGCTLFIKNLN.FD..T.T....E.E..TLK....EVFSK..A...........G...AVR
HGL_H00000349428-2   ............---SPVLRIIVENLF.YP..V.T....L.D..VLH....QIFSK..F...........G...TVL
HGL_H00000290341     ............PKKQRSRKIQIRNIP.PQ..L.R....W.E..VLD....SLLAQ..Y...........G...TVE
HGL_H00000362820-2   ............------CKVYVGNLG.NN..G.N....K.T..ELE....RAFGY..Y...........G...PLR
HGL_H00000309558     ............SDNSDNNTIFVQGLG.EG..V.S....T.D..QVG....EFFKQ..I...........G...IIK
HGL_H00000316950     ............--GPNRNRVFISNIP.YD..M.K....W.Q..AIK....DLMREk.V...........G...EVT
HGL_H00000365950-4   ............------GKLFVGRLN.FN..T.N....E.Q..ALE....DHFSS..F...........G...AIS
HGL_H00000262633     ............EWDADDFRIFCGDLG.NE..V.N....D.D..ILA....RAFSR..F...........P...SFL
HGL_H00000420195-3   ............-----NRILYIRNLP.YK..I.T....A.E..EMY....DIFGK..Y...........G...PIR
HGL_H00000325376     ............-----ACQIFVRNLP.FD..F.T....W.K..MLK....DKFNE..C...........G...HVL
HGL_H00000294904     ............WDQLSKTNLYIRGLP.PN..T.T....D.Q..DLV....KLCQP..Y...........G...KIV
HGL_H00000265753-1   ............-PTEPPYTAYVGNLP.FN..T.V....Q.G..DID....AIFKD..L...........-...SIR
HGL_H00000325905     ............------TKVYVGNLG.TG..A.G....K.G..ELE....RAFSY..Y...........G...PLR
HGL_H00000364639-2   ............-----DRTLFVGNLE.TK..V.T....E.E..LLF....ELFHQ..A...........G...PVI
HGL_H00000363105     ............APPERGCEIFIGKLP.RD..L.F....E.D..ELI....PLCEK..I...........G...KIY
HGL_H00000358635-1   ............---AKVKVLFVRNLA.NT..V.T....E.E..ILE....KAFSQ..F...........G...KLE
HGL_H00000316950     ............QAGRLGSTIFVANLD.FK..V.G....W.K..KLK....EVFSI..A...........G...TVK
HGL_H00000338477-2   ............-QSTTGHCVHMRGLP.YK..A.T....E.N..DIY....NFFSP..L...........-...NPV
HGL_H00000252542     ............---SSGRNLWVSGLS.ST..T.R....A.T..DLK....NLFSK..Y...........G...KVV
HGL_H00000243563-2   ............---HPNHTVSINNLN.EK..I.K....E.D..ELKkslyAIFSQ..F...........G...HIL
HGL_H00000401371     ............-SSPSNCTVYCGGVT.SG..L.T....E.Q..LMR....QTFSP..F...........G...QIM
HGL_H00000354021-1   ............------RKLFIGGLN.FE..T.T....E.E..SLR....NYYKQ..W...........G...KLT
HGL_H00000409315     ............----EGHRLWIGNLD.PK..I.T....E.Y..HLL....KLLQK..F...........G...KVK
HGL_H00000313199-2   ............-------KMFMGGLS.WD..T.T....K.K..DLK....DCFSK..F...........G...EVV
HGL_H00000361927     ............FQSTTGHCVHMRGLP.YR..A.T....E.N..DIY....NFFSP..L...........-...NPM
HGL_H00000327539     ............-QSTTGHCVHMRGLP.YR..A.T....E.N..DIY....NFFSP..L...........-...NPV
HGL_H00000358089     ............-SSPKNCTVYCGGIA.SG..L.T....D.Q..LMR....QTFSP..F...........G...QIM
HGL_H00000338477-4   ............-QSTTGHCVHMRGLP.YK..A.T....E.N..DIY....NFFSP..L...........-...NPM
HGL_H00000361949-1   ............--------LSVGDLH.SD..A.A....E.A..VLY....EKFSR..A...........G...PVL
HGL_H00000228284     ............------HKLFISGLP.FS..C.T....K.E..ELE....DICKA..H...........G...TVK
HGL_H00000355089     ............MKDHDAIKLFIGQIP.RN..L.D....E.K..DLK....PLFEE..F...........G...KIY
HGL_H00000362687     ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000250863     ............EGKIMPNTIFVGGID.IR..M.D....E.S..EIR....SFFAR..Y...........G...SVK
HGL_H00000365950-1   ............---------------.--..-.-....-.-..---....---SS..C...........G...PVS
HGL_H00000377738     ............----PVLRIIIDNMY.YP..V.T....L.D..VLH....QIFSK..F...........G...AVL
HGL_H00000322016     ............------CRVYVGSIY.YE..L.G....E.D..TIR....QAFAP..F...........G...PIK
HGL_H00000358635-1   ............QQPSVGTEIFVGKIP.RD..L.F....E.D..ELV....PLFEK..A...........G...PIW
HGL_H00000414921     ............---SPVLRIIIENLF.YP..V.T....L.E..VLH....QIFSK..F...........G...TVL
HGL_N10016780        ............--DSDNSAIYIQGLN.DN..V.T....L.D..DLA....DFFKQ..C...........G...VVN
HGL_H00000413303-1   ............---AKVKVLFVRNLV.TR..V.T....E.E..ILE....KSFSE..F...........G...KLE
HGL_H00000310471-3   ............-------KLFIGNLP.RE..A.T....E.Q..EIR....SLFEQ..Y...........G...KVL
HGL_H00000338477-5   ............-QSTTGHCVHMRGLP.YK..A.T....E.N..DIY....NFFSP..L...........-...NPM
HGL_H00000325376     ............QAGRLGSTVFVANLD.YK..V.G....W.K..KLK....EVFSM..A...........G...VVV
HGL_H00000352162     ............-----GWCIFVYNLS.PE..A.D....E.S..VLW....QLFGP..F...........G...AVT
HGL_H00000262031     ............NDQLSKTNLYIRGLQ.PG..T.T....D.Q..DLV....KLCQP..Y...........G...KIV
HGL_H00000358635-2   ............EVMAKVKVLFVRNLA.TT..V.T....E.E..ILE....KSFSE..F...........G...KLE
HGL_H00000292672     ............----RDRKLFVGMLN.KQ..Q.S....E.E..DVL....RLFQP..F...........G...VID
HGL_H00000218364     ............---------------.--..-.-....-.D..DLR....VECSK..F...........G...QIK
HGL_H00000313199-2   ............---EPVKKIFVGGLS.PD..T.P....E.E..NIR....EYFGG..F...........G...EVE
HGL_H00000338477-1   ............--SAKGGFVRLRGLP.FG..C.T....K.E..EIV....QFFSG..L...........E...IVP
HGL_H00000338477-5   ............---ANDGFVRLRGLP.FG..C.T....K.E..EIV....QFFSG..L...........E...IVP
HGL_H00000216727-2   ............---TDARSIYVGNVD.YG..A.T....A.E..ELE....AHFHG..C...........G...SVN
HGL_H00000285814-5   ............EEEHTPGVIFVGLLP.PV..L.F....E.S..QIK....EYFSQ..F...........G...NIT
HGL_H00000349428-1   ............SAGVPSRVIHIRKLP.SD..V.T....E.G..EVI....SLVLP..F...........G...KVT
HGL_H00000338477-3   ............VQSTTGHCVHMRGLP.YK..A.T....E.N..DIY....NFFSP..L...........-...NAV
HGL_H00000338477-1   ............-QSTTGHCVHMRGLP.YK..A.T....E.N..DIY....NFFSP..L...........-...NAV
HGL_H00000309166-2   ............-----STKLHVGNIS.PT..C.T....N.K..ELR....AKREE..Y...........G...PVI
HGL_H00000309166-1   ............-------KLFIGNLP.RE..A.T....E.Q..EIR....SLFEQ..Y...........G...KVL
HGL_H00000327539     ............--TANDGFVRLRGLP.FG..C.S....K.E..EIV....QFFSG..L...........E...IVP
HGL_H00000265866-2   ............---HGGHFVHMRGLP.FR..A.T....E.N..DIA....NFFSP..L...........-...NPI
HGL_H00000265866-2   ............--DASDGTVRLRGLP.FG..C.S....K.E..EIV....QFFQG..L...........E...IVP
HGL_H00000338477-2   ............---ANDGFVRLRGLP.FG..C.T....K.E..EIV....QFFSG..L...........E...IVP
HGL_H00000265997     ............-----SRKVFVGGLP.PD..I.D....E.D..EIT....ASFRR..F...........G...PLV
HGL_H00000361557     ............NPGEPNKVLYLKNLS.PR..V.T....E.R..DLV....SLFAR..F...........Q...EKK
HGL_H00000311747     ............-----TWKIFVGDVS.AA..C.T....S.Q..ELR....SLFER..R...........G...RVI
HGL_H00000259997     ............-----SRKVFVGGLP.PD..I.D....E.D..EIT....ASFRR..F...........G...PLV
HGL_H00000352668     ............---EAGFCVYLKGLP.FE..A.E....N.K..HVI....DFFKK..L...........D...IVE
HGL_H00000229390-1   ............PARGSDFRVLVSGLP.PS..G.S....W.Q..DLK....DHIPE..A...........G...DVC
HGL_H00000338477-4   ............---ANDGFVRLRGLP.FG..C.T....K.E..EIV....QFFSG..L...........E...IVP
HGL_H00000349428-1   ............---SPVLRIIVENLF.YP..V.T....L.D..VLH....QIFSK..F...........G...TVL
HGL_H00000349428-2   ............SAGVPSRVIHIRKLP.SD..V.T....E.G..EVI....SLGLP..F...........G...KVT
HGL_N10004544        ............SPSPKPTKVHIGRLT.RN..V.T....K.D..HIM....EIFST..Y...........G...KIK
HGL_H00000240185     ............--------LIVLGLP.WK..T.T....E.Q..DLK....EYFST..F...........G...EVL
HGL_H00000285814-4   ............---------FVGQLP.PV..L.F....E.S..QIK....EYFSQ..S...........G...NIT
HGL_H00000376344     ............----TTSKILVRNIP.FQ..A.S....L.R..EIR....ELFST..F...........G...ELK
HGL_H00000383298-7   ............KEPEQLRKLFIGGLS.FE..T.T....D.E..TLK....SHSEQ..W...........G...TLT
HGL_H00000265085     ............------RKVFVGGLP.PD..I.D....E.D..EIT....ASFRR..F...........G...PLI
HGL_H00000404545-2   ............------RNFWVSGLS.SM..T.R....A.T..DLK....TLFSK..Y...........G...KVV
HGL_H00000396578-3   ............-PKSPPYTAFLGNLP.YD..V.T....E.D..SIK....EFFRG..L...........-...NIS
HGL_M00000078602     ............-GDPSTTNLYLGNIN.PQ..M.N....E.E..MLC....QEFGR..F...........G...PLA
HGL_H00000352668     ............SGKPGPTVIKVQNMP.FT..V.S....I.D..EIL....DFFYG..Y...........Q...VIP
HGL_H00000383298-4   ............-----LWKLFIRWLS.FE..T.T....D.E..SLR....SHSEQ..W...........G...TLT
HGL_H00000338095-2   ............--RSMNSRVFIGNLN.TLv.V.K....K.S..DVE....AIFSK..Y...........G...KIV
HGL_H00000361927     ............------GFVRLRGLP.FG..C.S....K.E..EIV....QFFSG..L...........E...IVP
HGL_H00000366829     ............------NIVMLRMLP.QA..A.T....E.D..DIR....GQLQS..H...........Gv..QAR
HGL_H00000295470-3   ............-------KMFIAGLS.WD..T.S....K.K..DLM....EYLSR..F...........V...EVI
HGL_R00000023552     ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000285814-1   ............---------------.--..-.-....-.E..QIK....EYFSQ..F...........G...NIT
HGL_N10004520        ............-GNSDNNTIFVQGLG.EN..V.T....I.E..SVA....DHFKQ..I...........G...IIK
HGL_H00000246194-3   ............DPKSINSRVFIGNLN.TAv.V.K....K.S..DVE....TIFSK..Y...........G...RVA
HGL_H00000414859-2   ............QPDLDAIKMFVGQVP.RT..W.S....E.K..DLR....ELFEQ..Y...........G...AVY
HGL_H00000402503     ............------IKLFVGQIP.RH..L.E....E.K..DLK....PIFEQ..F...........G...RIF
HGL_H00000199814-2   ............PEDKTITTLYVGGLG.DT..I.T....E.T..DLR....NHFYQ..F...........G...EIR
HGL_H00000325376     ............------YRAFITNIP.FD..V.K....W.Q..SLK....DLVKEk.V...........G...EVT
HGL_H00000262031     ............-QEQDPTNLYISNLP.LS..M.D....E.Q..ELE....GMLKP..F...........G...QVI
HGL_H00000383298-5   ............GAHLTVKKIFVGGIK.ED..T.E....K.H..HLQ....DYFEQ..Y...........G...KTE
HGL_H00000390913     ............--------------D.YG..G.T....A.E..ELQ....AHFHP..C...........G...EVH
HGL_H00000344950     ............PKDEDERTVYVELLP.KN..V.N....H.S..WIE....KVFGK..C...........G...NVV
HGL_H00000334538     ............KIDEIRRTVYVGNLN.SQt.T.T....A.D..QLL....EFFKQ..V...........G...EVK
HGL_H00000310471-1   ............-------KLFIGNLP.RE..A.T....E.Q..EIR....SLFEQ..Y...........G...KVQ
HGL_H00000223073     ............-------TLFVRNLP.PS..A.R....S.E..QLE....ELFSQ..V...........G...PVK
HGL_H00000310471-3   ............----ASTKLHVGNIS.PT..C.T....N.Q..ELR....AKFEE..Y...........G...PVI
HGL_H00000400142     ............-----NSAIYVQGLN.DN..V.T....L.D..DLA....DFFKQ..C...........G...VVK
HGL_H00000294904     ............-QEQDPTNLYISNLP.LS..M.D....E.Q..ELE....NMLKP..F...........G...QVI
HGL_N10006621        ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000310471-2   ............-----STKLHVGNIS.PT..V.T....N.Q..GLR....GKFAE..Y...........G...PVI
HGL_M00000111283     ............---------------.--..-.-....-.-..-LR....GIFEP..S...........G...RIE
HGL_H00000369887-2   ............----STKTIWVSGLS.SN..T.K....A.A..DLK....NLFGK..Y...........G...KVL
HGL_H00000362820-1   ............------CKVYVGNLG.NN..G.N....K.T..ELD....RAFGY..Y...........G...PLR
HGL_H00000223073     ............--VSEGKTVFIRNLS.FD..S.E....E.E..EVG....ELLQQ..F...........G...ALK
HGL_H00000383298-3   ............-------KIFIGSIK.ED..T.E....E.Y..NLR....DHFEK..C...........G...KIE
HGL_H00000343054     ............SDERESKTIMLRGLP.IT..I.T....E.S..DIR....EMMES..F...........Egp.QPA
HGL_H00000364639-1   ............-----DLTLFVGNLE.TK..V.T....E.E..LLF....KLFHQ..A...........G...PVI
HGL_H00000371212     ............----TVKILYVRNLM.IE..T.T....E.D..TIK....KSFGQ..Fnp.........G...CVE
HGL_H00000389951     ............QPDPDAIKMFVGQIP.RS..W.S....E.K..ELK....ELFEP..Y...........G...AVY
HGL_H00000221419     ............HKTPASPVVHIRGLI.DG..V.V....E.A..DLV....EALQE..F...........G...PIS
HGL_H00000379069     ............---PDSHQLFVGNLP.HD..I.D....E.N..ELK....EFFMS..F...........G...NVV
HGL_H00000390625     ............---SVSPVVHVRGLC.ES..V.V....E.A..DLV....DALEK..F...........G...TIC
HGL_H00000315859     ............SPSPKPIEVRIRRLT.RN..V.T....K.A..HIM....EIFST..Y...........G...KIK
HGL_H00000393937     ............PETPVKERLFIVFNP.HP..L.P....L.D..VLE....DIFCR..F...........G...NLI
HGL_H00000414921     ............NIFPPSATLHLSNIP.PS..V.T....M.D..DLK....NIFTE..A...........Gc..SVK
HGL_H00000369887-1   ............----STKNIWVSGLS.SN..T.K....A.A..DLK....NLFGK..Y...........G...KVL
HGL_H00000361927     ............---REGFVVKVRGLP.WS..C.S....A.D..EVM....RFFSD..C...........-...KIQ
HGL_N10001384        ............---------------.--..-.-....-.-..---....-----..-...........-...--P
HGL_H00000360425     ............---------------.--..-.-....-.E..KFE....GLFRT..Y...........D...DCV
HGL_H00000240185     ............DEPLRSRKVFVGRCT.ED..M.T....A.D..ELR....QFFSQ..Y...........G...EVE
HGL_H00000396578-2   ............-PKSPPYTAFLGNLP.YD..V.T....E.D..SIK....EFFRG..L...........-...NIS
HGL_H00000376344     ............-------RLIVKNLP.SG..M.K....E.E..RFR....QLFAA..F...........G...TLT
HGL_H00000281722     ............----RVKVLFVRNLM.IS..T.T....E.E..TIK....GEFNK..Fkp.........G...AVE
HGL_H00000338095-1   ............---SMNSHVFIGNLN.TL..V.K....K.S..DVE....AIFSK..Y...........G...KIV
HGL_H00000238688-1   ............-----RRVAFVWKIP.WT..A.T....V.N..ELR....KHFTQ..F...........G...HIQ
HGL_H00000352956     ............PEERDARTVFCMQLA.AR..I.R....P.R..DLE....DFFSA..I...........G...KVH
HGL_H00000413532     ............QKQELGRVIHLSNLP.HSg.Y.S....D.S..AVL....KLAEP..Y...........G...KIK
HGL_H00000310471-2   ............-------KLFIGNLP.WE..A.S....E.Q..EIC....SLFEQ..Y...........G...KVL
HGL_H00000338477-3   ............----EGYVVKLRGLP.WS..C.S....T.E..DVQ....NFLSD..C...........-...TIR
HGL_N10024532        ............SPSPKPTKVHIGRLI.RN..V.T....K.D..HIM....EISST..Y...........G...KIK
HGL_H00000253363     ............PEERDARTVFCMQLA.AR..I.R....P.R..DLE....EFFST..V...........G...KVR
HGL_H00000348578     ............---PDSHQLFIGNLP.HE..V.D....K.S..ELK....DFFQN..Y...........G...NVV
HGL_H00000377738     ............--GAPSRVLHIRKLP.GE..V.T....E.T..EVI....ALGLP..F...........G...KVT
HGL_H00000338477-5   ............----EGYVVKLRGLP.WS..C.S....I.E..DVQ....NFLSD..C...........-...TIR
HGL_H00000338477-4   ............----EGYVVKLRGLP.WS..C.S....I.E..DVQ....NFLSD..C...........-...TIR
HGL_H00000310471-1   ............-----STKLHVGNIS.PT..C.T....N.E..ELW....AKLEE..Y...........G...PVI
HGL_H00000349428-2   ............-----NSVLLVSNLN.PEr.V.T....P.Q..SLF....ILFGV..Y...........G...DVQ
HGL_H00000382239     ............CSSGRVTPVKIMNLP.FK..A.N....V.N..EIL....DFFHG..Y...........Ri..IPD
HGL_H00000377738     ............---GGNTVLLVSNLN.EEm.V.T....P.Q..SLF....TLFGV..Y...........G...DVQ
HGL_H00000338477-3   ............TDTANDSFVRLWGLS.FG..C.T....K.G..EIV....QFFSG..L...........E...IVP
HGL_H00000318195     ............--DRDARTLLAKNLP.YK..V.T....Q.D..ELK....EVFED..A...........-...--V
HGL_H00000307863     ............------RRLYVGNIP.FG..I.T....E.E..AMM....DFFNA..QmrlggltqapgN...PVL
HGL_H00000356154     ............TLSVCSTTLWVGQVD.KK..A.T....Q.Q..DLT....NLFEE..F...........G...QIE
HGL_H00000338477-2   ............-----AYVVKLRGLP.WS..C.S....I.E..DVQ....NFLSD..C...........-...TIR
HGL_H00000416340-3   ............KEPEQLRKLFIGGLS.FE..T.T....D.D..SLR....EHFEK..W...........G...TLT
HGL_H00000414921     ............PPCSPSRVLHLRKIP.CD..V.T....E.A..EVI....SLGLP..F...........G...KVT
HGL_H00000414859-1   ............--DLDAIKMFVGQVP.RT..W.S....E.K..DLR....ELFEQ..Y...........G...AVY
HGL_H00000295470-4   ............--QQDDGKMFIGVLS.WD..T.N....K.K..DLM....ECLSQ..F...........G...EVV
HGL_M00000094956     ............RAPRKGNTLYVYG--.ED..M.T....P.T..LLR....GAFAP..F...........G...NII
HGL_H00000286835     ............TASVCSTTLWVGQLD.KR..T.T....Q.Q..DVA....SLLEE..F...........G...PIE
HGL_H00000391432     ............EPGEPNCRIYVKNLA.KH..V.Q....E.K..DLK....FIFGR..Y...........V...DFS
HGL_H00000266529-2   ............-----KSTMCVSNLS.IS..L.T....N.N..NLY....RRFSK..Y...........A...KAI
HGL_H00000349428-1   ............-----NSVLLVSNLN.PEr.V.T....P.Q..SLF....ILFGV..H...........G...DVQ
HGL_H00000295470-2   ............KNQQDDGKMFIGGLS.WD..T.S....K.K..DLM....EYLSR..F...........G...EVV
HGL_N10021125        ............---------------.--..-.-....-.-..---....EIFST..Y...........G...KIK
HGL_H00000257552     ............---------------.--..-.-....-.-..-LR....EYFGQ..F...........G...EVK
HGL_H00000265866-1   ............---ASDGTVRLLGLP.FG..C.S....K.E..EIV....QFFQW..L...........E...-IM
HGL_H00000358635-2   ............VQPGIGTEVFVGKIP.RD..L.Y....E.D..ELV....PLFEK..A...........G...PIW
HGL_H00000420270-2   ............---------------.--..-.-....-.E..DVK....EECQK..Y...........G...PVV
HGL_H00000254799     ............--VDDVFLIRAQGLP.WS..C.T....V.E..DVL....NFFQD..C...........-...KIR
HGL_H00000260956-8   ............-NDVKNRSVYIKGFP.TD..A.T....L.D..DIK....EWLED..K...........G...QVL
HGL_H00000311747     ............-------KIFVGNVDgAD..T.T....P.E..ELA....ALFAP..Y...........G...TVM
HGL_H00000358479     ............---------------.--..-.-....-.E..DLR....REFGR..Y...........G...PIV
HGL_H00000339090     ............---------------.--..-.-....-.-..---....----K..Y...........G...EVV
HGL_H00000291552-1   ............---------------.--..-.-....-.-..-FT....EMEEK..Y...........G...EVE
HGL_H00000358635-1   ............-------RLFVGSIP.KS..K.T....K.E..QIL....EEFSK..V...........Te..GLT
HGL_H00000358635-2   ............--------VFVGKIP.RD..L.Y....E.D..ELV....PLFEK..A...........G...PIW
HGL_H00000382296     ............DPKSINSRVFIGNLN.TAi.V.K....K.V..DIE....AIFSK..Y...........G...KIV
HGL_H00000376344     ............-EPTTCHTVKLRGAP.FN..V.T....E.K..NVT....EFLAP..L...........-...KPV
HGL_H00000405738     ............LSKENQVIVRMRGLP.FT..A.T....A.E..EVV....AFFGQ..H...........C...PIT
HGL_H00000396578-4   ............---SPPYTAFLGNLP.YD..V.K....E.D..SIK....EFFRG..L...........-...NIS
HGL_H00000261723-3   ............ERVDPSRTVFVSALH.AM..L.N....A.E..SLA....AILNDl.F...........G...GVV
HGL_H00000261723-2   ............QRLDPSRTVFVGALH.GM..L.N....A.E..ALA....AILNDl.F...........G...GVV
HGL_H00000358532     ............-----GRVVHICNLP.EGs.C.T....E.N..DVI....NLGLP..F...........G...KVT
HGL_H00000409088     ............----EGTKMTVNNLH.PR..V.T....E.E..DIV....ELFCV..C...........G...ALK
HGL_H00000405738     ............-----RDCIRLRGLP.YA..A.T....I.E..DIL....DFLGE..F...........S...TDI
HGL_H00000267197     ............VGPVPPKQVTFAKLN.DN..I.R....E.N..FLR....DMCKK..Y...........G...EVE
HGL_H00000382239     ............SRSPVGFYVHLKNLS.LN..V.S....K.R..DLR....NFFRD..I...........Dl..TNE
HGL_H00000218364     ............VEEDRNTNVYVSGLP.PD..I.T....V.D..EFI....QLMSK..F...........G...IIM
HGL_H00000312675     ............---SDNNTIFVQGLG.EN..V.T....I.E..SVA....DYFKQ..I...........G...IIK
HGL_H00000413303-1   ............-------RLFVGSIP.KN..K.T....K.E..NIL....EEFSK..V...........Te..GLV
HGL_H00000254799     ............GAMPSLHVVHMRGLP.FQ..A.N....A.Q..DII....NVCAF..F...........M...PLR
HGL_H00000369887-4   ............----STKNIWVSRLS.SN..T.K....A.A..DLK....NLFGK..Y...........A...KVL
HGL_H00000260956-6   ............-----------GDLD.DQ..T.C....R.E..DLQ....VLFSN..H...........G...EIK
HGL_H00000246194-1   ............DPKSINSRVFIGNLN.SAv.V.K....K.P..DVE....TIFST..Y...........G...HVA
HGL_H00000352668     ............--NPDDLYVSVHGMP.FS..A.A....E.N..DVR....DFFHG..L...........-...RVD
HGL_H00000260956-8   ............-----------GDLD.DQ..T.C....R.E..DLH....VLFSN..H...........G...EIK
HGL_H00000309166-2   ............-------KLFIGNLP.QE..A.T....E.Q..EIR....SRSEQ..C...........G...QVR
HGL_H00000415054     ............ERPPGCKTVFVGGLP.EN..A.T....E.E..IIQ....EVFEQ..C...........G...DIT
HGL_H00000413532     ............---------------.--..-.-....-.Y..QLL....QLVEP..F...........G...VIS
HGL_H00000293677     ............-----RRKILIRGLP.GD..V.T....N.Q..EVH....DLLSD..Y...........-...ELK
HGL_H00000390625     ............-GNPSGSVVMVSGLH.QLk.M.N....C.S..RVF....NLFCL..Y...........G...NIE
HGL_H00000418748     ............-------CVRLRGLP.YT..A.T....I.E..DIL....SFLGE..A...........AadiRPH
HGL_H00000221419     ............GPHADSPVLMVYGLD.QSk.M.N....C.D..RVF....NVFCL..Y...........G...NVE
HGL_H00000262563     ............----QKNLVFVVGLS.QRl.A.D....P.E..VLKrp..EYFGK..F...........G...KIH
HGL_N10014200        ............--------IYTGRLS.YN..V.R....E.K..DIQ....RFFSG..Y...........S...RLL
HGL_H00000260956-2   ............-NDVKNRSVYIKGFP.KV..A.T....L.D..DIK....EWLED..K...........G...QVL
HGL_H00000386226     ............ERLKNERTLFVGNLP.IT..C.N....K.K..KLK....SFFKE..Y...........G...QIE
HGL_H00000260956-4   ............-----------GDLD.DQ..T.C....R.E..DLH....VLFSN..H...........G...EIK
HGL_H00000377738     ............NIFPPSATLHLSNIP.PS..V.A....E.E..DLR....TLFAN..T...........Gg..TVK
HGL_H00000382239     ............PSKAENPYLFLRGLP.YL..V.N....E.D..DVR....VFFSG..L...........-...CVD
HGL_H00000396578-1   ............--KSPPYTAFLGNLP.YA..V.T....E.D..SIK....EFFRG..L...........-...NIS
HGL_H00000358635-2   ............-------RLFVGSIP.KN..K.T....K.E..NIL....EEFSK..V...........Te..GLV
HGL_H00000199814-1   ............---------YVGGLG.DT..I.S....K.T..DLR....NHFYQ..F...........G...EIW
HGL_H00000397673-2   ............-----------GGLG.NG..M.S....R.K..QLL....PVLEK..C...........G...LVE
HGL_H00000260956-3   ............-NDVKNRSVYIKGFP.AD..A.N....L.D..DIK....EWLED..K...........G...QVL
HGL_H00000420195-2   ............---------------.--..-.-....-.-..--R....REFGS..C...........G...PTV
HGL_H00000390625     ............---------------.YP..I.T....V.D..VLY....TVCNP..V...........G...KVQ
HGL_H00000349428-1   ............NIFPPSATLHLSNIP.PSisI.S....E.E..DLK....SLFSS..N...........G...GVV
HGL_H00000349428-2   ............NIFPPSATLHLSNIP.PSisI.S....E.E..DLK....SLFSS..N...........G...GVV
HGL_H00000418748     ............----SETVVRARGLP.WQ..S.S....D.Q..DVA....RFFKG..L...........-...NIA
HGL_H00000345412-2   ............--------VYVGSFS.WW..T.T....D.Q..QLI....QVIRS..I...........Gvy.DVV
HGL_H00000391432     ............SPPRGDRTLLVRHLP.AE..L.S....P.E..EKE....DLLKY..F...........-...GAQ
HGL_H00000303015     ............---------------.--..-.-....-.-..DVV....PEFKN..V...........G...KVI
HGL_H00000351723-2   ............---RETKRLFVGGLS.QA..I.S....K.T..DLQ....NQFSR..F...........G...EVS
HGL_H00000371634     ............-----SRKIQIRNIP.PH..L.Q....W.E..VLD....GLLAQ..Y...........G...TVE
HGL_H00000278070     ............RAIEERRVVFIGKIP.GR..M.T....R.S..ELK....QRFSV..F...........G...EIE
HGL_H00000266529-5   ............------STVYVSNWP.FS..P.T....N.N..DLD....RRFSK..Y...........G...KAV
HGL_H00000327539     ............----EGFVVKVRGLP.WS..C.S....A.D..XV-....-FFPD..C...........-...KIQ
HGL_H00000266679     ............--------LYIGNLT.WW..T.T....D.E..DLT....EAVHS..L...........Gvn.DIL
HGL_H00000340176     ............------RTLFVSGLP.LD..I.K....P.R..ELY....LLFRP..F...........K...GYE
HGL_H00000246071-2   ............PDYPPKYILFLNNLP.EE..T.N....E.V..MLF....NQF--..-...........P...GFK
HGL_H00000371321     ............-----------GDLD.DQ..T.C....R.E..DLH....VLFSN..H...........G...EIK
HGL_H00000369218     ............---------------.--..-.-....-.-..--K....EECEK..Y...........G...KVG
HGL_H00000347792     ............---------------.--..-.-....-.T..ELM....QTLGN..Y...........G...TIV
HGL_H00000359965     ............ERPPGCKTVFVGGLP.EN..G.T....E.Q..IIV....EVFEQ..C...........G...EII
HGL_H00000395738     ............------FKLELQNLP.RH..A.S....F.S..DVR....RFLGR..F...........Gl..QPH
HGL_H00000243563-2   ............SENPPNHILFLTNLP.EE..T.N....E.L..MLS....MPFNQ..F...........P...GFQ
HGL_M00000102130     ............RDSENRDTIYLSGVS.ES..F.-....K.D..HIF....HVSSH..F...........P...GLE
HGL_H00000260956-4   ............-NDVKNRSVYIKGFP.TD..A.T....L.D..DIK....AWLED..K...........G...QVL
HGL_H00000387911     ............--PKRDHVLHVT-FP.KE..W.K....S.S..DLY....QLFSA..F...........G...NIQ
HGL_H00000417839     ............------RSVFVSGFP.RD..V.D....S.T..ELS....EYFQA..F...........G...PVA
HGL_H00000300069     ............------RTLFVSGLP.VD..I.K....P.R..ELY....LLFRP..F...........K...GYE
HGL_H00000295119-2   ............---------------.--..-.-....-.-..-IL....LQFPQ..Y...........G...NIL
HGL_H00000221419     ............---------------.YS..I.T....T.D..VLY....TICNP..C...........G...PVQ
HGL_H00000246194-2   ............---------------.--..V.T....K.S..EVE....TIFST..Y...........G...RVA
HGL_H00000318195     ............-EPTTAFNLFIGNLN.SN..K.S....A.P..ELKtgisEVFAM..N...........Dl..ITV
HGL_H00000383298-7   ............---------------.--..-.-....-.-..---....----K..Y...........G...KIE
HGL_N10007480        ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_N10009032        ............---------------.--..-.-....-.-..---....--LGK..F...........G...PAL
HGL_H00000266529-3   ............----NKRTVYLFNLA.FS..L.K....N.N..DLH....RMFSK..Y...........G...KVV
HGL_H00000260956-2   ............-----------GDLD.DQ..T.C....R.E..DLH....VLFSN..H...........G...EIK
HGL_H00000265271     ............-----NTKLEVKKIP.QE..L.Nn...I.T..KLN....EHFSK..F...........G...TIV
HGL_H00000369887-3   ............STGSSTKNIWASGLS.SN..T.K....A.A..DLK....NLFGK..Y...........G...KML
HGL_H00000409667     ............---------------.--..A.L....I.D..ELL....QQFAN..F...........G...EVT
HGL_H00000285814-2   ............---------FVGRLP.PV..L.F....E.S..QIK....EYFSQ..F...........D...YIT
HGL_H00000351723-1   ............---RETKHLFVGGLS.QT..I.S....K.T..DLQ....NQFSR..F...........G...EVS
HGL_H00000228284     ............DSSKDSITVFVSNLP.YS..M.V....E.PevKLR....PLFEA..C...........G...EVA
HGL_H00000262519     ............IGQIPLKEVTFARLN.DN..V.R....E.T..FLK....DMCRK..Y...........G...EVE
HGL_R00000006780     ............---------YVSNLP.FS..L.T....N.N..DLY....RIFSK..Y...........G...EVV
HGL_H00000343054     ............----YCDTIILRNIA.PH..T.V....V.D..SIM....TALSP..Y...........Asl.AVN
HGL_H00000384357     ............--------IQVTNVS.PS..A.S....S.E..QMR....TLFGF..L...........G...KID
HGL_H00000419446-2   ............KAGRLGSTVFVANLD.YK..V.G....W.K..KLK....YLVMA..-...........G...MMV
HGL_H00000377694     ............----YGSVLLVSELP.EDg.C.T....E.E..DIR....KVFQP..F...........G...KVA
HGL_H00000264867     ............---EERRVIYIDKIR.PD..T.T....R.T..ELR....DRFEV..F...........G...EIE
HGL_H00000223073     ............-----QTRLCLHNLP.KA..V.D....D.K..QLR....KLLLN..Atrgek......Gv..HIK
HGL_H00000387531     ............-----NTKLELRKVP.PE..LnN....I.S..KLN....EHFSR..F...........G...TLV
HGL_H00000285814-3   ............---------------.--..-.-....-.-..---....-----..-...........-...-VE
HGL_H00000401946     ............----PSYWLVLHNLT.PQ..I.D....G.S..TLR....TICMQ..H...........G...PLL
HGL_N10012356        ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000379654     ............--------IQVSNVD.YR..L.S....R.K..ELQqliqEAFSR..H...........G...KVK
HGL_H00000379144-1   ............TSGRTSSWLVLRNLT.PQ..I.D....G.S..TLR....TLCLQ..H...........G...PLI
HGL_H00000334538     ............-----TAVIQVTNLS.SA..V.T....S.E..QMR....TLFSF..L...........G...EIE
HGL_N10012285        ............-------------LS.EE..T.T....K.E..ILK....EFFDG..S...........P...---
HGL_H00000260956-6   ............---------------.-D..A.T....L.N..DIK....EQLED..K...........G...QVL
HGL_H00000316638     ............---------------.--..-.-....-.-..VIH....KIFSK..F...........G...KIT
HGL_H00000379144-2   ............SSGRITNWLVLKNLT.PQ..I.D....G.S..TLR....TLCMQ..H...........G...PLI
HGL_H00000260956-5   ............-------------LD.DQ..T.C....R.E..DLH....VLFSN..H...........G...EIK
HGL_H00000358799     ............GDGGEYKTLKISELG.SQ..L.SdeavE.D..GLF....HEFKR..F...........G...DV-
HGL_H00000354021-1   ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000377694     ............----YNRFVHLYNLP.ED..-.G....L.Q..CVL....CVGLQ..F...........G...KVD
HGL_H00000295470-4   ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000420195-1   ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_N10011773        ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000262710     ............PRGKISNIVHISNLV.RP..F.T....L.G..QLK....ELLGR..T...........G...TLV
HGL_H00000382239     ............--------IRLLGLP.FI..A.G....P.V..DIR....HFFTG..L...........-...TIP
HGL_H00000260956-1   ............---------------.-D..A.T....L.D..DIK....EWLED..K...........S...QVL
HGL_H00000344950     ............---------------.--..-.-....-.K..QLR....DTLAA..I...........S...EVV
HGL_H00000266022     ............SEEKPSRLIRLSGVP.EN..A.T....K.E..EIL....NAFRT..A...........Ng..MPV
HGL_H00000222956     ............GAHLTVKKICVSGIK.ED..T.E....E.A..NLR....DDFEK..Y...........G...KIE
HGL_H00000284073     ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000258729     ............---------------.--..-.-....-.-..---....-LLVQ..Y...........G...VVE
HGL_H00000418748     ............------VILRLRGLP.FS..A.G....P.A..DVL....SFLGP..E...........C...PVT
HGL_H00000364912     ............---------------.--..-.-....-.D..GLF....HEFKK..F...........G...KVT
HGL_H00000377694     ............---EEMCVILISNLP.NRg.Y.S....T.E..EIC....NLAKP..F...........G...GLK
HGL_H00000294428     ............---------------.--..-.-....-.Q..EVH....DLLKD..Y...........-...ELK
HGL_H00000352668     ............--------IRLQGLP.IV..A.G....T.M..DIR....HFFSG..L...........-...TIP
HGL_H00000387531     ............---------------.--..-.D....R.E..DLL....PHFAQ..Y...........G...EIE
HGL_H00000265866-1   ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000384160     ............--KPQPCVVSVEGLS.SS..T.T....D.V..QLK....SLLMS..V...........G...PIQ
HGL_H00000320401     ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000321449-1   ............---PQKRTLFVLNVP.RY..C.S....E.E..SLS....RLLSP..C...........G...LVQ
HGL_H00000261723-1   ............KGLDPSRTVFVCALH.GM..L.N....A.E..ALA....AILNDl.F...........G...VVT
HGL_N10005061        ............---------------.--..-.-....-.-..MLK....DKFKE..C...........G...HVL
HGL_N10021697        ............----DMPRVYIGLLS.YN..V.R....E.K..DIQ....RFFSG..Y...........G...RLL
HGL_H00000266022     ............--DGESKTIMLKRIY.RS..T.P....P.E..VIV....EVLEP..Y...........V...HLT
HGL_H00000295119-1   ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000291688     ............---------QCKNIP.DC..L.N....DrT..TLE....NYFSK..I...........A...QVQ
HGL_H00000330813     ............---RRSAMLCILTVP.AT..M.T....S.H..DLM....KFVAP..F...........N...EVI
HGL_H00000274849     ............------GIVYLGHIP.PR..F.R....P.L..HVR....NLLSA..Y...........G...EVG
HGL_N10021697        ............-------RVYIGRLS.YN..V.R....E.K..DIQ....RFFSG..Y...........G...RLL
HGL_H00000321449-2   ............---PQKRTLFVLNVP.PY..C.S....E.E..SLS....RLLSP..C...........G...LVQ
HGL_H00000265753-2   ............LPIEPPYTAYVGNLP.FN..T.V....Q.G..NID....AIFKD..L...........-...SIR
HGL_H00000379654     ............------TLLYVYNLP.AN..K.D....G.K..SIS....NRLRR..Lsdncg......G...KVL
HGL_H00000419242     ............-----SRYLLIQGVP.AV..G.A....M.K..ELV....ERFAL..Y...........G...TIE
HGL_H00000324827-3   ............---------------.--..-.-....E.E..ILR....VVFEN..F...........G...KIK
HGL_N10014876        ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000413303-2   ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000413303-2   ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000220496     ............---------------.--..-.-....-.-..---....----Q..Y...........G...EVL
HGL_H00000415464-2   ............--SHKRCIVILREIP.ET..T.P....V.E..EVK....ALFKNenC...........P...KVI
HGL_H00000293273     ............------KTLLVWDLN.SG..P.T....A.E..ALHrslsTALSC..F...........G...LLH
HGL_H00000243563-1   ............---------------.--..-.-....-.-..---....----K..F...........G...QIL
HGL_H00000345412-1   ............GLRSRRAAVYVGSFF.WW..T.T....D.Q..QLI....QVIRS..I...........Gvy.DVV
HGL_H00000324827-2   ............---------------.--..-.S....E.D..VLV....RVFQR..F...........G...EIR
HGL_H00000299213     ............---------------.--..-.-....-.E..HLL....KLFGT..F...........G...VIS
HGL_H00000331211     ............----SERTVIVAGLP.VGl.F.S....D.Q..QLA....TLVKN..Yfqgmkteg...G...EVE
HGL_H00000326128     ............--NQNRCIVILREIS.ES..T.P....V.E..EVE....ALFKGdnL...........P...KFI
HGL_H00000314491     ............----KTCSLFMRNIA.PN..I.S....R.A..EII....SLCKR..Y...........P...GFM
HGL_H00000260956-1   ............-------------LD.DQ..T.C....G.E..DLH....ILSSN..H...........G...EVK
HGL_H00000312649     ............--------------P.DY..M.S....S.R..ELK....KRFEV..F...........G...EIV
HGL_H00000292672     ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000287202     ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000238688-2   ............---------------.--..-.-....-.-..---....-----..-...........-...---
HGL_H00000324827-1   ............---------------.--..-.-....Q.E..VLV....KVFKK..F...........G...EIR
HGL_H00000221419     ............-IQHPSNVLHFFNAP.LE..V.T....E.E..NFF....EICDE..L...........Gvk.RPT


                                                            100                 110               12
                                                              |                   |                 
d1hl6a_                N........IHLN.L......................DRR.T...GF....SKGY..ALVE......YET..HKQAL
HGL_H00000361949-2   S........AKVM.L......................E--.D...GR....SKGF..GFVC......FSS..PEEAT
HGL_H00000255136     S........AKVM.T......................E--.G...GH....SKGF..GFVC......FSS..PEEAT
HGL_H00000271628-1   Qt.......PKIM.R......................DPD.T...GN....SKGY..AFIN......FAS..FDASD
HGL_H00000361949-2   S........CKVV.C......................DEN.-...-G....SKGY..AFVH......FET..QEAAD
HGL_H00000308012     S........VKVV.R......................DAS.-...GK....SKGF..GFVK......YET..HEAAQ
HGL_H00000393248-2   S........CKVA.C......................DEK.-...-G....PKGY..GFVH......FQK..QESAE
HGL_H00000255136     S........CKVA.C......................DEH.-...-G....SRGF..GFVH......FET..NEAAQ
HGL_H00000358089     D........ARVV.K......................DMA.T...GK....SKGY..GFVS......FYN..KLDAE
HGL_H00000408239     R........VKVM.K......................E--.E...GY....SRGF..GLIC......FSS..PEEAA
HGL_H00000271628-2   Qt.......PKIM.R......................DPD.T...GN....SKSY..AFIN......FAS..FDASD
HGL_H00000352612     N........VKVI.R......................DFN.T...NK....CKGF..GFVT......MTN..YDEAA
HGL_H00000416340-1   N........CAVM.R......................DPQ.T...KR....SRGF..GFVT......YSC..VEEVD
HGL_H00000360886     N........VKVI.R......................DFN.T...NK....CKGF..GFVT......MTN..YDEAA
HGL_H00000408239     S........SKVM.S......................DD-.-...QG....SKGY..AFVH......FQS..QSAAN
HGL_H00000352162     S........CKLV.R......................DKI.T...GQ....SLGY..GFVN......YSD..PNDAD
HGL_H00000264073-2   N........VKVI.R......................DFN.T...NK....CKGF..GFVT......MTN..YEEAA
HGL_H00000389951     S........AKVF.I......................DKQ.T...NL....SKCF..GFVS......YDN..PVSAQ
HGL_H00000355089     S........SKVF.V......................DRA.T...SQ....SKCF..GLVS......FDT..PASAQ
HGL_H00000287202     S........AKVF.V......................DRA.T...NQ....SKCF..GFVS......FDN..PTSAQ
HGL_H00000313007-2   S........AKVM.M......................E--.G...GR....SKGF..GFVC......FSS..PEEAT
HGL_H00000308012     S........CKVV.C......................DD-.-...NG....SKGY..AYVH......FDS..LAAAN
HGL_H00000414859-2   S........AKVF.I......................DKQ.T...NL....SKCF..GFVS......YDN..PVSAQ
HGL_H00000313007-1   S........VKVM.T......................DES.-...GK....SKGF..GFVS......FER..HEDAQ
HGL_H00000316042     K........AEII.A......................DKQ.S...GK....KRGF..GFVY......FQN..HDAAD
HGL_H00000414859-1   S........AKVF.I......................DKQ.T...NL....SKCF..SFVS......YDN..PLSAQ
HGL_H00000414859-3   E........YRIL.R......................GPD.-...GL....SRGC..AFVT......FTT..RGMAQ
HGL_H00000412831     E........VVVV.K......................DRE.T...QR....SRGF..GFVT......FEN..IDDAK
HGL_H00000401336     D........IDLK.N......................RRG.-...GP....P--F..AFVE......FED..PRDAE
HGL_H00000373277     S........TRIL.R......................DAN.-...GV....SRGV..GFAR......MES..TEKCE
HGL_H00000402734     F........ADAH.R......................PKL.N...--....---E..GVVE......FAS..YGDLK
HGL_H00000343966     E........VFIN.R......................DRG.-...--....---F..GFIR......LES..RTLAE
HGL_H00000264073-1   S........AKLI.R......................DKV.A...GH....SLGY..GFVN......YVT..AKDAE
HGL_H00000362900     Y........ADAH.K......................GRK.N...--....---E..GVIE......FVS..YSDMK
HGL_H00000326806     K........IIMG.L......................DKM.K...KT....ACGF..CFVE......YYS..RADAE
HGL_H00000229390-2   E........IELK.N......................RH-.-...GL....-VPF..AFVR......FED..PRDAE
HGL_H00000365950-3   E........VVVV.K......................DRE.T...QR....SRGF..GFIT......FTN..PEHAS
HGL_H00000416340-2   D........CVVM.R......................DPQ.T...KR....SRGF..GFVT......YSC..VEEVE
HGL_H00000294172-1   -........----.-......................---.-...--....----..-FVE......DAS..TASAL
HGL_H00000253363     S........IQLM.M......................DSE.T...GR....SKGY..GFIT......FSD..SECAK
HGL_H00000349748-2   E........VFIN.K......................GKG.-...--....---F..GFIK......LES..RALAE
HGL_H00000297071     G........VNVV.Y......................DQR.T...GR....SRGF..AFVY......FER..IDDSK
HGL_H00000276079     E........VFIH.K......................DKG.-...--....---F..GFIR......LET..RTLAE
HGL_H00000294172-2   -........----.-......................---.-...--....----..-FVE......DAS..TASAL
HGL_H00000393937     Y........CSII.K......................NKV.T...GE....SKGL..GYVR......YLK..PSQAA
HGL_H00000376344     E........LHFP.I......................DSL.T...KK....PKGF..AFVT......FLF..PEHAV
HGL_H00000402114     -........F---.-......................---.-...--....----..----......---..-----
HGL_H00000276201-1   Y........FEFF.P......................NDT.S...LY....PHMYarAYIN......FKN..QEDII
HGL_H00000276201-2   Y........FEFF.S......................NDT.S...LY....PHMYarAYIN......FKN..QEDII
HGL_H00000359645-2   E........VLLM.K......................DRE.T...NK....SRGF..AFVT......FES..PADAK
HGL_H00000376290-4   D........VSIV.Y......................DQQ.S...RR....SRGF..AFVY......FEN..VDDAK
HGL_H00000376290-3   D........VSIV.Y......................DQQ.S...RR....SRGF..AFVY......FEN..VDDAK
HGL_H00000341826     D........CVVM.R......................DPN.T...KR....SRGF..GFVT......YAT..VEEVD
HGL_D0073543         S........SKVF.M......................DRA.T...NQ....SKCF..GFVS......FDN..PASAQ
HGL_H00000383298-1   V........IEIM.T......................DRG.S...RK....KRGF..AFVT......FDD..HDSVD
HGL_H00000387996     S........FRLV.Y......................DRE.T...GK....PKGY..GFCE......YQD..QETAL
HGL_H00000309166-3   E........CDII.K......................N--.-...--....---Y..GFVH......IED..KTAAE
HGL_H00000364912     D........IDIK.K......................--V.N...GV....PQ-Y..AFLQ......YCD..IASVC
HGL_H00000393248-1   S........FRWV.Y......................DRE.T...GK....PKGY..GFCE......YQD..QETAL
HGL_H00000332444     S........FRLV.Y......................DRE.T...GK....PKGY..GFCE......YQD..QETAL
HGL_H00000376290-2   D........VSIG.C......................NQQ.S...RR....SRGF..AFVC......FEN..VDDAK
HGL_H00000313007-1   S........CKVV.C......................DEN.-...-G....SKGY..GFVH......FET..QEAAE
HGL_H00000313890-1   E........VVIK.R......................PAR.-...GQ....GGAY..AFLK......FQN..LDMAH
HGL_H00000376290-5   D........VSIG.C......................NQQ.S...RR....SRGF..AFVC......FEN..VDDAK
HGL_H00000359645-1   E........VLLM.K......................DQE.T...NK....SRGF..AIVT......FES..PADAK
HGL_H00000318195     G........ARIV.T......................DRE.T...GS....SKGF..GFVD......FNS..EEDAK
HGL_H00000401371     D........ARVV.K......................DMA.T...GK....SKGY..GFVS......FFN..KWDAE
HGL_H00000221448     R........IHMV.Y......................SKR.S...GK....PRGY..AFIE......YEH..ERDMH
HGL_H00000266529-8   K........VTIM.K......................DKD.T...RK....SKGV..AFIL......FLD..KDSAQ
HGL_H00000333001     N........IHLN.L......................DRR.T...GY....LKGY..TLVE......YET..YKEAQ
HGL_H00000364448     Y........FEVA.G......................ADR.Sly.PH....LYSR..AYIN......FRN..PDDIL
HGL_H00000360886     S........CKLV.R......................DKI.T...GQ....SLGY..GFVN......YID..PKDAE
HGL_H00000281722     E........FRLM.M......................EFS.-...GE....NRGY..AFVM......YTM..KEEAQ
HGL_H00000383298-6   D........CVVM.R......................DPN.T...KR....SRGF..GFVT......YAT..VEEVD
HGL_H00000352612     S........CKLV.R......................DKI.T...GQ....SLGY..GFVN......YID..PKDAE
HGL_H00000352956     N........IVLM.K......................DSE.T...GH....SKGY..GFIT......FSE..SECAR
HGL_H00000293677     R........CFLV.Y......................SEH.T...GQ....SKGY..GFAE......YMK..KDSAA
HGL_H00000295470-1   N........IELP.M......................DTK.T...NE....RRGF..CFIT......YTD..EEPVK
HGL_H00000322016     S........CTLA.R......................DPT.T...GK....HKGY..GFIE......YEK..AQSSQ
HGL_H00000402503     E........CTVL.R......................GPD.-...GT....SKGC..AFVK......FQT..HAEAQ
HGL_H00000233078     E........VVMI.Y......................DAE.K...QR....PRGF..GFIT......FED..EQSVD
HGL_H00000351108     A........IELP.M......................DPK.L...NK....RRGF..VFIT......FKE..EDPVK
HGL_H00000253329     S........CEVI.R......................DWK.T...GE....SLCY..AFIE......FEK..EEDCE
HGL_H00000257552     D........AMLM.F......................DKT.T...NR....HRGF..GFVT......FES..EDIVE
HGL_H00000341826     V........IEIM.T......................DRG.S...GK....KRGF..AFVT......FDD..HDSVD
HGL_H00000243563-3   D........ILVS.R......................S--.-...LK....MRGQ..AFVI......FKE..VSSAT
HGL_H00000416340-3   T........IEVM.E......................DRQ.S...GK....KRGF..AFVT......FDD..HDTVD
HGL_H00000371212     E........LRLM.M......................DFD.-...GK....NRGY..AFIM......YCH..KHEAK
HGL_H00000307863     A........FNLV.K......................DSA.T...GL....SKGY..AFCE......YVD..INVTD
HGL_H00000361924     D........IQIP.L......................DYE.T...EK....HRGF..AFVE......FEL..AEDAA
HGL_H00000266529-6   K........VTIV.K......................DKD.T...RR....SKGV..AFIL......FLD..KNSAQ
HGL_H00000331817     K........AAVH.Y......................DRS.-...GR....SLGT..ADVH......FER..KADAL
HGL_H00000266529-7   K........VTIM.K......................DKD.T...RK....SKGV..AFIL......FLD..KDSAQ
HGL_H00000365950-2   S........SKVF.M......................DRA.T...NQ....SKCF..GFVS......FDN..PASAQ
HGL_H00000376290-1   D........LSIV.Y......................DQQ.S...RC....SRGF..AFVY......FEN..VDDAK
HGL_H00000313199-1   S........IELP.M......................DNK.T...NK....RRGF..CFIT......FKE..EEPVK
HGL_H00000233078     D........CVIM.K......................DKT.T...NQ....SRGF..GFVK......FKD..PNCVG
HGL_H00000383298-2   V........IEII.T......................DRG.S...GK....KRGF..AFVT......FDD..HDSVD
HGL_H00000358799     E........VDIK.R......................PSR.-...GQ....TSTY..GFLK......FEN..LDMSH
HGL_H00000264073-2   S........AKLI.R......................DKV.A...GH....SLGY..GFVN......YVT..AKDAE
HGL_H00000354021-2   T........IEII.T......................DRQ.S...GK....KRGF..GFVT......FDD..HDPVD
HGL_H00000416340-3   D........CVVM.R......................DPQ.T...KR....SRGF..GFVT......YSC..VEEVD
HGL_H00000376117     E........VKII.N......................DRA.-...GV....SKGY..GFVT......FET..QEDAQ
HGL_H00000416340-4   T........IEVM.E......................DRQ.S...GK....KREF..AFVT......FDD..HSTVD
HGL_H00000246071-1   D........IVAL.K......................T--.-...MK....MRGQ..AFVI......FKE..LGSST
HGL_H00000285814-6   R........FRLS.R......................SKR.T...GN....SRGY..AFVE......FAS..GDVAK
HGL_H00000383298-8   E........CMVM.R......................DPT.T...KR....SRGF..GFVT......FAD..PASVD
HGL_H00000216727-1   R........VTIL.C......................DKF.S...GH....PKGF..AYIE......FSD..KESVR
HGL_H00000313199-1   D........CTLK.L......................DPI.T...GR....SRGF..GFVL......FKE..SESVD
HGL_H00000318195     F........IKVP.Q......................NQN.-...GK....SKGY..AFIE......FAS..FEDAK
HGL_H00000362936     G........GKVV.L......................DQT.-...GI....SKGY..GFVK......FTD..ELEQK
HGL_H00000266529-9   K........ITIM.E......................GKD.T...RK....SKRV..AFVL......FLD..KDSAQ
HGL_H00000320768     T........FQYF.K......................SFK.-...--....---R..VRIN......FSN..PLSAA
HGL_H00000413035     D........VEII.F......................NER.-...-G....SKGF..GFVT......FEN..SADAD
HGL_H00000386226     A........VRIV.R......................DPV.T...GV....GKGF..GYVL......FEN..TDAVH
HGL_H00000309117     D........VEII.F......................NER.-...-G....SKGF..GFVT......FEN..SADAD
HGL_H00000266529-1   K........VTIM.K......................DKD.T...RK....SKGV..AFIL......FLD..KDSAQ
HGL_H00000363105     D........----.-......................---.-...--....---Y..AFVH......FSK..REDAV
HGL_H00000223073     E........VNIP.R......................KPD.-...GK....MRGF..AFVQ......FKN..LLEAG
HGL_M00000038256     E........YDVI.K......................N--.-...--....---Y..GFVH......MED..ETAAE
HGL_H00000354021-2   D........CVVM.R......................DPA.S...KR....SRGF..GFVT......FSS..MAEVD
HGL_H00000401371     N........CKMI.M......................DTA.G...ND....P--Y..CFVE......FHE..HRHAA
HGL_H00000383298-2   D........CVVM.R......................DPN.T...KR....SRGF..GFVT......YAT..VEEVD
HGL_H00000333170     K........VTIC.K......................DRE.-...GK....PKSF..GFVC......FKH..PESVS
HGL_H00000351108     D........CTIK.M......................DPN.T...GR....SRGF..GFIL......FKD..AASVE
HGL_H00000309166-1   E........CDIV.K......................D--.-...--....---Y..AFVH......MER..AEDAV
HGL_H00000363516     T........FQLF.K......................SFR.-...--....---R..VRIN......FSK..PEAAA
HGL_H00000294428     R........CFLV.Y......................SEV.T...GL....SKGY..GFVE......YMK..KDSAA
HGL_H00000354719     R........LRLV.R......................DLV.T...GF....SKGY..AFIE......YKE..ERALL
HGL_H00000253108     R........IYLA.K......................DKT.T...GQ....SKGF..AFIS......FHR..REDAG
HGL_H00000313890-2   E........VDIK.R......................PAR.-...GQ....GAAC..ALLR......FQD..RAAAH
HGL_H00000266529-10  K........VTIM.K......................NKD.T...KK....SKGV..AFIL......FLD..KDSAQ
HGL_H00000346120     -........----.-......................---.-...--....----..----......---..-----
HGL_H00000365950-5   E........VAAV.K......................DRE.T...RR....SQAF..GFIA......STN..PEHAS
HGL_H00000316950     F........AEIK.M......................E--.N...GK....SKGC..GTVR......FDS..PESAE
HGL_H00000295470-1   D........CTIK.T......................DPV.T...GR....SRGF..GFVL......FKD..AASVD
HGL_H00000376344     S........CSVS.K......................KKN.-...KEgallSMGF..GFVE......YRK..PEHAQ
HGL_H00000349428-2   K........IITF.T......................K--.-...-N....SQFQ..ALLQ......YAD..PVSAQ
HGL_H00000290341     N........CEQV.N......................TES.-...--....ETAV..VNVT......YSN..REQTR
HGL_H00000362820-2   S........VWVA.R......................NPP.-...--....--GF..AFVE......FED..PRDAA
HGL_H00000309558     TnkktgkpmINLY.T......................DKD.T...GK....PKGE..ATVS......FDD..PPSAK
HGL_H00000316950     Y........VELF.K......................DAE.-...GK....SRGC..GVVE......FKD..EEFVK
HGL_H00000365950-4   E........VVVV.K......................DRV.T...QQ....LWGF..GFNT......STN..PEQAS
HGL_H00000262633     K........AKVI.R......................DKR.T...GK....TKGY..GFVS......FKD..PSDYV
HGL_H00000420195-3   Q........IRVG.N......................TPE.-...--....TRGT..AYVV......YED..IFDAK
HGL_H00000325376     Y........ADIK.M......................E--.N...GK....SKGC..GVVK......FES..PEVAE
HGL_H00000294904     S........TKAI.L......................DKT.T...NK....CKGY..GFVD......FDS..PAAAQ
HGL_H00000265753-1   S........VRLV.R......................DKD.T...DK....FKGF..CYVE......FDE..VDSLK
HGL_H00000325905     T........VWIA.R......................NPP.-...--....--GF..AFVE......FED..PRDAE
HGL_H00000364639-2   K........VKIP.K......................DKD.-...GK....PKQF..AFVN......FKH..EVS-V
HGL_H00000363105     E........MRMM.M......................DFN.-...GN....NRGY..AFVT......FSN..KLEAK
HGL_H00000358635-1   R........VKKL.K......................D--.-...--....---Y..AFIH......FDE..RDGAV
HGL_H00000316950     R........ADIK.E......................DKD.-...GK....SRGM..GTVT......FEQ..AIEAV
HGL_H00000338477-2   R........VHIE.I......................GPD.-...GR....VTGE..ADVE......FAT..HEEAV
HGL_H00000252542     G........AKVV.T......................NAR.S...PG....ARCY..GFVT......MST..SEEAT
HGL_H00000243563-2   D........ILVS.R......................S--.-...LK....MRGQ..ALVI......FKE..VSSAT
HGL_H00000401371     E........IRVF.P......................DKG.-...--....---Y..SFVR......FNS..HESAA
HGL_H00000354021-1   D........CVVL.R......................DPA.S...KR....SRGS..GFVT......FSS..MGEVD
HGL_H00000409315     Q........FDFL.F......................HKS.GaleGQ....PRGY..CFVN......FET..KQEAE
HGL_H00000313199-2   D........CTLK.L......................DPI.T...GR....SRGF..GFVL......LKE..SESVD
HGL_H00000361927     R........VHIE.I......................GPD.-...GR....VTGE..ADVE......FAT..HEDAV
HGL_H00000327539     R........VHIE.I......................GPD.-...GR....VTGE..ADVE......FAT..HEDAV
HGL_H00000358089     E........IRVF.P......................EKG.-...--....---Y..SFVR......FST..HESAA
HGL_H00000338477-4   R........VHIE.I......................GPD.-...GR....VTGE..ADVE......FAT..HEEAV
HGL_H00000361949-1   P........IRVC.G......................DVI.T...RR....SLGH..AYVS......FQQ..PAEAE
HGL_H00000228284     E........LRLV.T......................NRA.-...GK....PKGL..AYVE......YEN..ESQAS
HGL_H00000355089     E........LTVL.K......................DRF.T...GM....HKGC..AFLT......YCE..RESAL
HGL_H00000362687     -........----.-......................---.-...--....----..----......---..----S
HGL_H00000250863     E........VKII.T......................DRT.-...GV....SKGY..GFVS......FYN..DVDVQ
HGL_H00000365950-1   E........VVAV.K......................DRE.T...QQ....SRGF..AFIT......FTN..PEHAS
HGL_H00000377738     K........IITF.T......................KNN.-...--....-QFQ..ALLQ......YGD..PVNAQ
HGL_H00000322016     S........IDMS.W......................DSV.T...MK....HKGF..AFVE......YEV..PEAAQ
HGL_H00000358635-1   D........LRLM.M......................DPL.T...GL....NRGY..AFVT......FCT..KEAAQ
HGL_H00000414921     K........IITF.T......................KNN.-...--....-QFQ..ALLQ......YAD..PVNAH
HGL_N10016780        InkrtgqpmIHIY.L......................DKK.T...GN....PKGD..AMVS......YED..PPTAK
HGL_H00000413303-1   R........VKKL.K......................D--.-...--....---Y..AFVH......FED..RGAAV
HGL_H00000310471-3   E........CDII.K......................N--.-...--....---Y..GFVH......IED..KTAAE
HGL_H00000338477-5   R........VHIE.I......................GPD.-...GR....VTGE..ADVE......FAT..HEEAV
HGL_H00000325376     R........ADIL.E......................DKD.-...GK....SRGI..GTVT......FEQ..SIEAV
HGL_H00000352162     N........VKVI.R......................DFT.T...NK....CKGF..GFVT......MTN..YDEAA
HGL_H00000262031     S........TKAI.L......................DKT.T...NK....CKGY..GFVD......FDS..PSAAQ
HGL_H00000358635-2   R........VKKL.K......................D--.-...--....---Y..AFVH......FED..RGAAV
HGL_H00000292672     E........CTVL.R......................GPD.-...GS....SKGC..AFVK......FSS..HTEAQ
HGL_H00000218364     K........LLLFdR......................HPD.-...--....--GV..ASVS......FRD..PEEAD
HGL_H00000313199-2   S........IELP.M......................DNK.T...NK....RRGF..CFIT......FKE..EEPVK
HGL_H00000338477-1   Ng.......ITLP.V......................DPE.-...GK....ITGE..AFVQ......FAS..QELAE
HGL_H00000338477-5   Ng.......ITLP.V......................DPE.-...GK....ITGE..AFVQ......FAS..QELAE
HGL_H00000216727-2   Y........VTIL.C......................DKF.S...GH....PKGF..AYMK......FSD..KESVR
HGL_H00000285814-5   R........FRLS.R......................SKR.T...GN....SRGY..AFVE......FAS..EDVAK
HGL_H00000349428-1   N........LLMV.K......................GKN.-...--....---Q..AFIE......MNT..EEAAN
HGL_H00000338477-3   R........VHIE.I......................RPN.-...GR....VTGE..ADVE......FAT..NEEAM
HGL_H00000338477-1   R........VHIE.I......................RPN.-...GR....VTGE..ADVE......FAT..NEEAM
HGL_H00000309166-2   E........CDIV.K......................D--.-...--....---Y..AFVH......MEP..AEDAV
HGL_H00000309166-1   E........CDII.K......................N--.-...--....---Y..GFVH......IED..KTAAE
HGL_H00000327539     Ng.......ITLP.V......................DFQ.-...GR....STGE..AFVQ......FAS..QEIAE
HGL_H00000265866-2   R........VHID.I......................GAD.-...GR....ATGE..ADVE......FVT..HEDAV
HGL_H00000265866-2   Ng.......ITLT.M......................DYQ.-...GR....STGE..AFVQ......FAS..KEIAE
HGL_H00000338477-2   Ng.......ITLP.V......................DPE.-...GK....ITGE..AFVQ......FAS..QELAE
HGL_H00000265997     -........VDWP.H......................KAE.S...KSyfp.PKGY..AFLL......FQE..ESSVQ
HGL_H00000361557     G........PPIH.F......................QMM.T...GR....MRGQ..AFIT......FPS..KEIAW
HGL_H00000311747     E........CDVV.K......................D--.-...--....---Y..AFVH......MEK..EADAK
HGL_H00000259997     -........VDWP.H......................KAE.S...KSyfp.PKGY..AFLL......FQE..ESSVQ
HGL_H00000352668     Ds.......IYIA.Y......................GPN.-...GK....ATGE..GFVE......FRN..EADYK
HGL_H00000229390-1   Y........ADVQ.K......................D--.-...--....--GM..GMVE......HLR..KEDMD
HGL_H00000338477-4   Ng.......ITLP.V......................DPK.-...GK....ITGE..AFVQ......FAS..QELAE
HGL_H00000349428-1   K........IITF.T......................K--.-...-N....SQFQ..ALLQ......YAD..PVSAQ
HGL_H00000349428-2   N........LLML.K......................GKN.-...--....---Q..AFIE......MNT..EEAAN
HGL_N10004544        M........IDMP.V......................ERM.Hp..HL....SKGY..AYVE......FEN..PDEAE
HGL_H00000240185     M........VQVK.K......................DIK.T...GH....SKGF..GFVR......FTE..YETQV
HGL_H00000285814-4   R........FRLS.R......................SKR.T...GN....SRGY..AFAE......FAS..EDVAK
HGL_H00000376344     T........VRLP.K......................KMTgT...GA....HRGF..GFVD......FLT..KQDAK
HGL_H00000383298-7   D........CVVM.R......................DPN.T...KR....SRGF..GFVT......YTT..VEEVD
HGL_H00000265085     -........VDWP.H......................KAE.S...KSyfp.PKGY..AFML......FQD..ESSVQ
HGL_H00000404545-2   G........AKVV.T......................NAR.S...PG....ARCY..GFVT......MST..AEEAT
HGL_H00000396578-3   A........VRLP.R......................EPS.Np..ER....LKGF..GYAE......FED..LDSLL
HGL_M00000078602     S........VKIM.Wprt...................DEE.R...AR....ERNC..GFVA......FMN..RRDAE
HGL_H00000352668     Gs.......VCLK.Y......................NEK.-...GM....PTGE..AMVA......FES..RDEAT
HGL_H00000383298-4   D........SVVM.R......................DPN.T...KC....SRAF..GFVT......YTT..VEEVD
HGL_H00000338095-2   G........CSVH.K......................G--.-...--....---F..AFVQ......YVN..EKSAR
HGL_H00000361927     Ng.......MTLP.V......................DFQ.-...GR....STGE..AFVQ......FAS..QEIAE
HGL_H00000366829     E........VRLM.R......................NKS.S...GQ....SRGF..AFVE......FSH..LQDAT
HGL_H00000295470-3   D........CTIK.T......................DPV.T...GR....SRGF..GFVL......FKD..AASVD
HGL_R00000023552     -........----.-......................---.-...--....---R..AYIN......FRN..PDDIL
HGL_H00000285814-1   R........FRLS.R......................SKR.T...GN....SRGY..AFVE......FAS..EDVAK
HGL_N10004520        TnkkteqsmINLY.T......................DRE.T...AK....LKGE..GTVS......FDE..PPSAK
HGL_H00000246194-3   G........CSVH.K......................G--.-...--....---Y..AFVQ......YSN..ERHAR
HGL_H00000414859-2   E........INVL.R......................DRS.Qnp.PQ....SKGC..CFVT......FYT..RKAAL
HGL_H00000402503     E........LTVI.K......................DKY.T...GL....HKGC..AFLT......YCA..RDSAL
HGL_H00000199814-2   T........ITVV.Q......................RQQ.-...--....---C..AFIQ......FAT..RQAAE
HGL_H00000325376     Y........VELL.M......................DAE.-...GK....SRGC..AVVE......FKM..EESMK
HGL_H00000262031     S........TRIL.R......................DTN.-...GT....SRGV..GFAR......MES..TEKCE
HGL_H00000383298-5   V........IEIM.T......................DRG.S...GK....KRGF..AFVT......FDD..HDSVD
HGL_H00000390913     R........VTIL.C......................DKF.S...GH....PKGY..AYVE......FTT..QLSAQ
HGL_H00000344950     Y........ISIP.H......................YKS.T...GD....PKGF..AFVE......FET..KEQAA
HGL_H00000334538     F........VRMA.G......................DET.-...-Q....PTRF..AFVE......FAD..QNSVP
HGL_H00000310471-1   E........CDII.K......................N--.-...--....---Y..GFVL......IED..KTAPE
HGL_H00000223073     Q........CFVV.T......................EKG.S...KA....CRGF..GYVT......FSM..LEDVQ
HGL_H00000310471-3   E........CDIV.K......................D--.-...--....---Y..AFVH......MER..AEDAV
HGL_H00000400142     InkrtgqpmIHIY.L......................DKE.T...GK....PKGD..ATVS......YED..PPTAK
HGL_H00000294904     S........TRIL.R......................DSS.-...GT....SRGV..GFAR......MES..TEKCE
HGL_N10006621        -........----.-......................---.-...--....---R..ACIN......FRN..PDDIL
HGL_H00000310471-2   K........CDIV.K......................D--.-...--....---Y..AFVH......MEQ..AEDEV
HGL_M00000111283     S........SQLM.M......................DSE.T...GR....SKGY..GFIT......FSD..SKRAK
HGL_H00000369887-2   S........AKVV.T......................NAR.S...PG....AKCY..GIVT......MSS..STEVS
HGL_H00000362820-1   S........VWVA.R......................NPP.-...--....--GF..AFVE......FED..PRASA
HGL_H00000223073     Y........VRIV.L......................HPD.T...EH....SKGC..AFAQ......FMT..QEATQ
HGL_H00000383298-3   T........IEVM.E......................DRE.S...GK....KRGF..AFVT......FDD..HDTVD
HGL_H00000343054     D........VRLM.K......................RKT.-...GV....SRGF..AFVE......FYH..LQDAT
HGL_H00000364639-1   K........VKIS.K......................DKD.-...GK....P--K..VIVN......FKH..EISVL
HGL_H00000371212     R........VKKI.R......................D--.-...--....---Y..AFVH......FTS..REDAV
HGL_H00000389951     Q........INVL.R......................DRS.Qnp.PQ....SKGC..CFVT......FYT..RKAAL
HGL_H00000221419     Y........VVVM.P......................KKR.-...--....---Q..ALVE......FED..VLGAC
HGL_H00000379069     E........LRIN.T......................KGV.G...GK....LPNF..GFVV......FDD..SEPVQ
HGL_H00000390625     Y........VMMM.P......................FKR.-...--....---Q..ALVE......FEN..IDSAK
HGL_H00000315859     M........MGMP.V......................ERM.Hp..HL....PKAY..AYVE......FEN..PDEAE
HGL_H00000393937     E........VYLV.S......................GKN.-...--....---V..GYAK......FAD..RMSAN
HGL_H00000414921     A........FKFFqK......................DRK.-...--....---M..ALIQ......LGS..VEEAI
HGL_H00000369887-1   S........AKVV.T......................NAR.S...PG....AKCY..GIVT......MSS..STEVS
HGL_H00000361927     Ngtag....IRFI.Y......................TRE.-...GR....PSGE..AFVE......LES..EDEVK
HGL_N10001384        D........VSIG.C......................NQQ.S...RR....SRGF..AFVC......FEN..VDDAK
HGL_H00000360425     T........FQLF.K......................SFR.-...--....---R..VRIN......FSS..PKPAA
HGL_H00000240185     D........VFIP.I......................PFR.-...--....--AF..AFVT......FAD..DQVAQ
HGL_H00000396578-2   A........VRLP.R......................EPS.Np..ER....LKGF..GYAE......FED..LDSLL
HGL_H00000376344     D........CSLK.F......................TKD.-...GK....FRKF..GFIG......FKS..EVEAQ
HGL_H00000281722     R........VKKL.R......................D--.-...--....---Y..AFVH......FFN..REDAV
HGL_H00000338095-1   G........S---.-......................---.-...SV....HKGF..AFVQ......YVN..ERNAW
HGL_H00000238688-1   K........CILP.F......................DKE.T...GF....HKGM..CWIY......FSS..SEALQ
HGL_H00000352956     D........VRII.S......................DRN.S...RR....SKGI..AYVE......FCD..IQSVP
HGL_H00000413532     N........YILM.R......................MKS.-...--....---Q..AFIE......MET..REDAM
HGL_H00000310471-2   E........SGII.K......................N--.-...--....---Y..GFVH......IED..KTAAE
HGL_H00000338477-3   Dgvag....VHFI.Y......................TRE.-...GR....QSGE..AFVE......LES..EEDVK
HGL_N10024532        M........IDMP.V......................ESM.Hp..HL....SKGY..AYVE......FEN..PDEAE
HGL_H00000253363     D........VRMI.S......................DRN.S...RR....SKGI..AYVE......FVD..VSSVP
HGL_H00000348578     E........LRIN.S......................G--.-...GK....LPNF..GFVV......FDD..SEPVQ
HGL_H00000377738     N........ILML.K......................GKN.-...--....---Q..AFLE......LAT..EEAAI
HGL_H00000338477-5   Dgvag....VHFI.Y......................TRE.-...GR....QSGE..AFVE......LES..EDDVK
HGL_H00000338477-4   Dgvag....VHFI.Y......................TRE.-...GR....QSGE..AFVE......LES..EDDVK
HGL_H00000310471-1   E........CDIV.K......................D--.-...--....---Y..AFVY......MER..AEDAV
HGL_H00000349428-2   R........VKIL.F......................NKK.E...--....---N..ALVQ......MAD..GSRAQ
HGL_H00000382239     S........VSIQ.Y......................NEQ.-...GL....PTGE..AIVA......MIN..YNEAM
HGL_H00000377738     R........VKIL.Y......................NKK.D...--....---S..ALIQ......MAD..GNQSQ
HGL_H00000338477-3   Ng.......ITLP.V......................DPE.-...GK....FTGK..AFLQ......FAS..QELAE
HGL_H00000318195     E........IRLV.S......................K--.D...GK....SKGI..AYIE......FKT..EADAE
HGL_H00000307863     A........VQIN.Q......................DKN.-...--....---F..AFLE......FRS..VDETT
HGL_H00000356154     S........INMI.P......................PRG.-...--....---C..AYVC......MVH..RQDAF
HGL_H00000338477-2   Dgvag....VHFI.Y......................TRE.-...GR....QSGE..AFVE......LES..EDDVK
HGL_H00000416340-3   D........CVVM.R......................DPQ.T...KR....SRGF..DFVT......YSC..VE---
HGL_H00000414921     N........LLML.K......................GKS.-...--....---Q..AFLE......MAS..EEAAV
HGL_H00000414859-1   E........INVL.R......................DRS.Qnp.PQ....SKGC..CSVT......FYT..RKAAL
HGL_H00000295470-4   D........RTIK.T......................DPV.T...GT....SRGF..GFVL......FKD..AASVD
HGL_M00000094956     D........LSMD.P......................PRN.-...--....---C..AFVT......YEK..MESAD
HGL_H00000286835     S........INMI.P......................PRG.-...--....---C..AYIV......MVH..RQDAY
HGL_H00000391432     SetqrimfdIRLM.K......................E--.-...GR....MKGQ..AFIG......LPN..EKAAA
HGL_H00000266529-2   K........VTVM.K......................DKD.M...RK....GKGV..AFIL......FLD..KDSAQ
HGL_H00000349428-1   R........VKIL.F......................NKK.E...--....---N..ALVQ......MAD..GSRAQ
HGL_H00000295470-2   D........CTIK.T......................DPV.T...GR....SRGF..GFVL......F--..-----
HGL_N10021125        M........IDMP.V......................ERM.Hp..HL....SKGY..AYVE......FEN..PDEAE
HGL_H00000257552     E........CLVM.R......................DPL.T...KR....SRGF..GFVT......FMD..QAGVD
HGL_H00000265866-1   Png......ITMT.M......................DYQ.-...GR....STGE..TFVQ......FAS..KEIAE
HGL_H00000358635-2   D........LRLM.M......................DPL.S...GQ....NRGY..AFIT......FCG..KEAAQ
HGL_H00000420270-2   S........LLVP.K......................E--.-...NP....GRGQ..VFVE......YAN..AGDSK
HGL_H00000254799     Nsekg....IHFL.L......................NRD.-...GK....RRGD..ALIE......MES..ERDVQ
HGL_H00000260956-8   N........IQMR.R......................TLH.-...KA....FKGS..IFAV......FDN..IESAK
HGL_H00000311747     S........CAVM.K......................Q--.-...--....---F..AFVH......MRE..NAGAL
HGL_H00000358479     D........VYIP.L......................DFY.T...RR....PRGF..AYVQyplffiFED..VRDAE
HGL_H00000339090     N........INLV.R......................DKK.T...GK....SKGF..CFLC......YED..QRSTI
HGL_H00000291552-1   E........MNVC.D......................NLG.-...DH....LVGN..VYVK......FRR..EEDAE
HGL_H00000358635-1   D........VILY.H......................QPD.Dk..KK....NRGF..CFLE......YED..HKTAA
HGL_H00000358635-2   D........LRLM.M......................DPL.S...GQ....NRGY..ALIT......FCG..KEAAQ
HGL_H00000382296     G........CSVH.K......................G--.-...--....---Y..AFVQ......YMS..ERHAR
HGL_H00000376344     A........IRIV.R......................NAH.-...GN....KTGY..IFVD......FSS..EEEVK
HGL_H00000405738     Ggkeg....ILFV.T......................YPD.-...GR....PTGD..AFVL......FAC..EEYAQ
HGL_H00000396578-4   A........VHLP.H......................EPR.Np..ER....IKGF..VYAE......FED..LDSLL
HGL_H00000261723-3   Y........AGID.T......................DKH.-...KY....HIGS..GQVT......FNN..QSSYL
HGL_H00000261723-2   Y........AGID.T......................DKH.-...KY....PIGS..GRVT......FNN..QRSYL
HGL_H00000358532     N........YILM.K......................STN.-...--....---Q..AFLE......MAY..TEAAQ
HGL_H00000409088     R........ARLV.H......................P--.-...--....--GV..AEVV......FVK..KDDAI
HGL_H00000405738     Rthg.....VHMV.L......................NHQ.-...GR....PSGD..AFIQ......MKS..ADRAF
HGL_H00000267197     E........VEIL.Y......................NPK.T...KK....HLGI..AKVV......FAT..VRGAK
HGL_H00000382239     Q........IRFL.Y......................KDE.-...KR....TR-Y..AFVT......FKT..LKDYN
HGL_H00000218364     RdpqteefkVKLY.K......................DNQ.-...GN....LKGD..GLCC......YLK..RESVE
HGL_H00000312675     TnkktgqpmINLY.T......................DRE.T...GK....LKGE..ATVS......FDD..PPSAK
HGL_H00000413303-1   D........VILY.H......................QPD.Dk..KK....NRGF..RFLE......YED..HKSAA
HGL_H00000254799     P........VRIT.M......................EYSsS...GK....ATGE..AHVH......FGS..HEDAV
HGL_H00000369887-4   S........AKVV.T......................NAR.S...PG....AKCY..GIVT......MSS..STEVS
HGL_H00000260956-6   W........IDFV.R......................GAK.-...--....---E..GVIL......FKEkaKEALD
HGL_H00000246194-1   G........CSVH.K......................G--.-...--....---H..AFVQ......YSN..EHRAW
HGL_H00000352668     A........VHLL.K......................DHV.-...GR....NNGN..GLVK......FLS..PQDTF
HGL_H00000260956-8   W........IDFV.R......................GAK.-...--....---E..GVIL......FKEkaKEALD
HGL_H00000309166-2   E........CDII.K......................N--.-...--....---Y..AFLH......AED..ETAAE
HGL_H00000415054     A........IRKS.K......................-KN.-...--....---F..CHIR......FAE..EFMVD
HGL_H00000413532     N........HLIL.N......................KIN.-...--....---E..AFIE......MAT..TEDAQ
HGL_H00000293677     Y........CFVD.K......................Y--.-...--....-KGT..AFVT......LLN..GEQAE
HGL_H00000390625     K........VKFM.K......................TIP.-...--....--GT..ALVE......MGD..EYAVE
HGL_H00000418748     G........VHMV.L......................NQQ.-...GR....PSGD..AFIQ......MTS..AERAL
HGL_H00000221419     K........VKFM.K......................SKP.-...--....--GA..AMVE......MAD..GYAVD
HGL_H00000262563     K........VVIN.Nstsya.................G--.S...QG....PSAS..AYVT......YIR..SEDAL
HGL_N10014200        K........VDLK.N......................G--.-...--....---Y..GFVE......FKD..SCDAD
HGL_H00000260956-2   N........IQMK.R......................TLH.-...KA....FKGS..IFAV......FDN..IESAK
HGL_H00000386226     S........VRFR.Slipaegtvskklaaikrkihp.D--.-...QK....N-IN..AYVV......FKE..ESAAT
HGL_H00000260956-4   W........IDFV.R......................GAK.-...--....---K..GVIL......FIEkaKEALD
HGL_H00000377738     A........FKFFqR......................DHK.-...--....---M..ALLQ......MAT..VEEAI
HGL_H00000382239     G........VIFL.K......................HHD.-...GR....NNGD..AIVK......FAS..CIDAS
HGL_H00000396578-1   A........VHLP.R......................EPS.Np..ER....LKGF..GYAE......FEN..LDSLL
HGL_H00000358635-2   D........VILY.H......................QPD.D...KK....KNRF..CFLE......YED..HKSAA
HGL_H00000199814-1   T........IAVF.Q......................KQQ.-...--....---C..AFIH......FAT..RQAVE
HGL_H00000397673-2   A........LLMP.P......................NKP.-...--....---Y..SFVR......YKT..TEESR
HGL_H00000260956-3   N........IQMR.R......................TLH.-...KA....LKGS..IFAV......FDN..IESAK
HGL_H00000420195-2   D........VYVP.L......................DFY.I...RR....PRGF..AYVQ......FED..VCDAE
HGL_H00000390625     R........IVIF.K......................RNG.-...--....--IQ..AMFM......FES..VLCAQ
HGL_H00000349428-1   Kgf......KFFQ.K......................DRK.-...--....---M..ALIQ......MGS..VEEAV
HGL_H00000349428-2   Kgf......KFFQ.K......................DRK.-...--....---M..ALIQ......MGS..VEEAV
HGL_H00000418748     Rgg......VALC.L......................NAQ.-...GR....RNGE..ALIR......FTD..REQRD
HGL_H00000345412-2   E........LKFA.E......................NRA.N...GQ....SKGY..AEVV......VAS..ENSVH
HGL_H00000391432     S........VRVL.S......................DK-.-...GR....LKHT..AFAT......FPN..EKAAI
HGL_H00000303015     Q........FKVS.C......................NLE.-...PH....LRGN..VYVQ......YQS..EEECH
HGL_H00000351723-2   D........VEII.Trk....................DDQ.G...NA....QKVF..AYVN......IRV..EADLK
HGL_H00000371634     N........VEQVnT......................DTE.-...--....-TAV..VNVT......YAT..REEAK
HGL_H00000278070     E........CTIH.F......................RVQ.-...GD....N--Y..GFVT......YRC..AEEAF
HGL_H00000266529-5   K........VTIM.K......................DKD.T...RK....SKGV..AFLL......FLD..KDLFG
HGL_H00000327539     Ngaqg....IRFI.Y......................TRE.-...GR....PSGE..AFVE......LES..EDEVK
HGL_H00000266679     E........IKFF.E......................NRA.N...GQ....SKGF..ALVG......VGS..EASSK
HGL_H00000340176     Gsl......IKLT.S......................KQP.-...--....---V..GFVS......FDS..RSEAE
HGL_H00000246071-2   E........IHLV.P......................GRH.D...--....---I..AFVE......FEN..DGQAG
HGL_H00000371321     W........IDFV.R......................GAK.-...--....---E..GVIL......FKE..K----
HGL_H00000369218     K........CVIF.Eipgapdd...............EA-.-...--....--VR..IFLE......FER..VESAI
HGL_H00000347792     L........VRIN.Q......................G--.-...--....---Q..MLVT......FAD..SHSAL
HGL_H00000359965     A........IRKS.K......................-KN.-...--....---F..CHIR......FAE..EYMVD
HGL_H00000395738     K........TKLF.G......................QPP.-...--....---C..AFVT......FRS..AAERD
HGL_H00000243563-2   E........ARLV.P......................GRH.D...--....---I..AFVE......FDE..V-QAG
HGL_M00000102130     A........VILP.K......................DLE.S...GK....QKKF..CFMK......FKT..FASAQ
HGL_H00000260956-4   N........IQMR.R......................TLH.-...KA....FKGS..ICAV......FDS..IESAE
HGL_H00000387911     I........SWID.D......................T--.-...--....---S..AFVS......LSQ..PEQVP
HGL_H00000417839     S........VVMD.K......................DKG.-...--....--VF..AIVE......MGD..MGSRD
HGL_H00000300069     Gsl......IKLT.S......................RQP.-...--....---V..GFVI......FDS..RAGAE
HGL_H00000295119-2   K........HVMS.S......................TGN.-...--....---W..MHSR......YQS..KLQAQ
HGL_H00000221419     R........IVIF.R......................KNG.-...--....--VQ..AMVE......YPLl.RNSAQ
HGL_H00000246194-2   A........CSVH.K......................G--.-...--....---Y..AFVQ......CSN..ERHAP
HGL_H00000318195     D........VRIG.T......................NRK.-...--....---F..GYVD......FES..AEDLE
HGL_H00000383298-7   V........IEIM.T......................DRG.S...GK....KGGF..AFVT......FDD..HDSVD
HGL_N10007480        -........IHIY.L......................DKE.T...GK....PKGN..ATVS......YED..PLTAK
HGL_N10009032        G........VKVM.T......................DES.-...GI....SKGF..GFGN......FER..HADAQ
HGL_H00000266529-3   K........ITIM.K......................DKD.T...RK....SKGC..----......---..-----
HGL_H00000260956-2   W........IAFV.R......................GAK.-...--....---E..GEIL......FKDkaKEALD
HGL_H00000265271     N........IQVA.Fkg....................DPE.-...--....---A..ALIQ......YLT..NEEAR
HGL_H00000369887-3   N........PKVV.T......................NAQ.S...PR....AKYY..GIVI......MSS..STEVS
HGL_H00000409667     L........IRFV.E......................DKM.-...--....----..-WVT......FLE..GSSAL
HGL_H00000285814-2   R........FRQS.R......................SKR.T...GN....SRGS..AFVE......FAF..EAVAK
HGL_H00000351723-1   D........VEII.Trk....................DDQ.G...NA....QKVF..AYVN......IRVv.EADLK
HGL_H00000228284     E........IRPI.F......................SNR.-...GD....FRGY..CYVQ......FKD..ENTA-
HGL_H00000262519     E........VEIL.L......................HPR.T...RK....HLGL..ARVL......FTS..TRGAK
HGL_R00000006780     K........VIIM.K......................DKD.T...R-....----..----......---..-----
HGL_H00000343054     N........IRLI.K......................DKQ.T...QQ....NRGF..AFVQ......LSS..AMDAS
HGL_H00000384357     E........LRLF.P......................PDD.S...PLpv..SSRV..CFVK......FHD..PDSAV
HGL_H00000419446-2   Q........ADIL.K......................DKD.-...GK....TRGI..GTVT......FEQ..SIEAV
HGL_H00000377694     D........ILIV.P......................YRK.-...--....---E..AYLE......MEF..KAVT-
HGL_H00000264867     E........CTVN.L......................RDD.-...GD....S--Y..GFIT......YRY..TCDAF
HGL_H00000223073     E........CRVM.Rdlkgvhg...............NMK.-...GQ....SLGY..AFAE......FQE..HEHAL
HGL_H00000387531     N........LQVA.Yng....................DPE.-...--....---G..ALIQ......FAT..YEEAK
HGL_H00000285814-3   Q........VRRR.L......................TQT.-...GN....SRGY..AFVE......FAS..EDVAK
HGL_H00000401946     T........FHLN.L......................TQG.-...--....---T..ALIR......YST..KQEAA
HGL_N10012356        -........---M.M......................DPL.S...GQ....NRGY..AFIT......FCG..KEAAQ
HGL_H00000379654     S........VELS.P......................HTD.Y...QL....---K..ATVQ......MEN..LQEAI
HGL_H00000379144-1   T........FHLN.L......................TQG.-...--....---N..AVVR......YSS..KEEAA
HGL_H00000334538     E........LRLY.P......................PDN.A...PLaf..SSKV..CYVK......FRD..PSSVG
HGL_N10012285        G........ARTV.T......................DWE.T...RA....SKGF..GFVD......INS..EEDAK
HGL_H00000260956-6   N........IQMR.R......................TLH.-...KA....CKGS..IFAV......FDN..IESAK
HGL_H00000316638     N........DYYP.E......................E--.D...GK....TKGY..IFLE......YAS..PAHAV
HGL_H00000379144-2   T........FHLN.L......................L--.-...--....-HGN..ALVC......YSS..KEEVV
HGL_H00000260956-5   W........IDFV.R......................GAK.-...--....----..----......---..-----
HGL_H00000358799     S........VKIS.Hlsgsgsg...............DER.-...--....---V..AFVN......FRR..PEDAR
HGL_H00000354021-1   -........----.-......................---.-...--....-KGF..GFVT......FDD..HDPVD
HGL_H00000377694     H........HIFM.N......................NKN.-...--....---K..AILQ......LES..PESAQ
HGL_H00000295470-4   -........----.-......................---.T...SE....RRGF..CFIT......YTD..EEPVK
HGL_H00000420195-1   -........----.-......................---.-...--....----..---T......FED..VRDAE
HGL_N10011773        -........---M.T......................DQS.Y...GK....KRGF..AFIT......FDD..HASVD
HGL_H00000262710     E........EAFW.I......................DKI.-...--....-KSH..CFVT......YST..VEEAV
HGL_H00000382239     Dgg......VHII.G......................GDI.-...--....--GE..AFII......FAT..DEDAR
HGL_H00000260956-1   N........IQMR.R......................TLH.-...KA....FKGS..IFAV......FDN..IESAK
HGL_H00000344950     Y........VDLL.E......................GDT.-...--....---E..CHAR......FKT..PEAAQ
HGL_H00000266022     R........ELQL.K......................EYN.T...GY....DYGY..VCVE......FSL..LEDAI
HGL_H00000222956     I........IEVM.E......................DRQ.S...GK....KSEF..----......---..-----
HGL_H00000284073     -........----.-......................---.-...--....--GF..GFVT......FEN..EDVVE
HGL_H00000258729     T........CEQV.N......................TES.-...--....ETAV..VNVT......YSS..KDQAR
HGL_H00000418748     Ggadg....LLFV.R......................HPD.-...GR....PTGD..AFAL......FAC..EELAQ
HGL_H00000364912     S........VQIH.G......................ASE.-...ER....---Y..GLVF......FRQ..QEDQE
HGL_H00000377694     D........ILIL.S......................SHK.-...--....---K..AFIE......-IN..RKSAE
HGL_H00000294428     Y........CYVD.R......................NKR.-...--....---T..AFVT......LLN..GDQAR
HGL_H00000352668     Dgg......VHIV.G......................GEL.-...--....--GE..AFIV......FAT..DEDAR
HGL_H00000387531     D........YQID.D......................SSL.-...--....---H..AVIT......FKT..RAEAE
HGL_H00000265866-1   -........---M.R......................DGR.D...GR....AKGE..ADVE......FVT..HEDPV
HGL_H00000384160     S........LQML.P......................QQR.-...--....---K..AIAK......FKE..PAHAL
HGL_H00000320401     -........---M.T......................DQG.S...GK....KRGF..AFVT......IDD..HDSVD
HGL_H00000321449-1   S........VELQ.EkpdlaespkepkskffhprpvpGFR.-...--....---V..AYVV......FQR..PSGVA
HGL_H00000261723-1   F........AGID.T......................DKH.-...KY....PIGS..GRVT......FNN..RSSYL
HGL_N10005061        H........ANIK.M......................E--.N...GK....CKGY..GVVE......L--..PKLAE
HGL_N10021697        E........VDLK.N......................GSR.-...SR....SKG-..----......---..-----
HGL_H00000266022     Tan......VRII.K......................NRT.G...PM....GHTY..GFID......LDS..HAEAL
HGL_H00000295119-1   -........----.-......................---.-...--....----..--IR......YQS..KLQAR
HGL_H00000291688     R........IFIR.R......................SKK.-...--....---L..AVVH......FFD..HASAA
HGL_H00000330813     Eq.......MKII.R......................DST.P...NQ....Y--M..VLIK......FST..QADAD
HGL_H00000274849     R........VFFQ.Aedrfvrrkkkaaaasgg.....KKG.S...KY....SKDYteGWVE......FRD..KRVAK
HGL_N10021697        E........VDL-.-......................---.-...--....----..----......---..-----
HGL_H00000321449-2   S........VELQ.-......................---.-...--....----..----......---..-----
HGL_H00000265753-2   S........VQLV.R......................DKD.-...--....----..----......---..-----
HGL_H00000379654     S........IT--.-......................---.-...GC....---S..AILR......FIN..QDSAE
HGL_H00000419242     E........YNAL.D......................EYP.A...ED....FTEV..YLIK......FMN..LQSSR
HGL_H00000324827-3   N........VDIP.Mldpyrevmtggsfg........SFS.F...GL....QTFE..AFIQ......YQE..STDFI
HGL_N10014876        -........--LV.P......................ELQ.D...GK....VCGF..AFVQ......FKT..LLEKG
HGL_H00000413303-2   -........----.-......................---.-...--....----..----......--D..RRAAV
HGL_H00000413303-2   -........---M.M......................DPL.S...GQ....NGGY..AFIT......FCG..KEAAQ
HGL_H00000220496     N........LVLS.S......................KKA.-...--....--GT..AVVE......FST..VKAAE
HGL_H00000415464-2   S........CEFA.H......................NSN.-...--....----..WYIT......FQS..DTDAQ
HGL_H00000293273     S........VRVL.P......................NAS.V...AR....PGFY..AVVK......FYS..ARAAR
HGL_H00000243563-1   D........ILVS.R......................S--.-...LM....MRNQ..AFV-......---..-SNAT
HGL_H00000345412-1   E........LKFA.E......................NQA.N...GQ....SKGF..G---......---..-----
HGL_H00000324827-2   N........VDIP.Mldpyreemtgrnfhtf......SFG.-...GH....LNFE..AYVQ......YRE..YAGFI
HGL_H00000299213     S........VRIL.Kpgrelppdirrissrysqvg..TQE.-...--....---C..AIVE......FEE..VEAAI
HGL_H00000331211     D........VIYP.T......................RIK.-...--....--GV..AYVM......FKE..RKVAK
HGL_H00000326128     N........CEFA.Y......................NDN.-...--....----..WFIT......FET..EADAQ
HGL_H00000314491     R........VALS.E......................PQP.E...RR....FFRR..GWVT......FDR..SVNIK
HGL_H00000260956-1   W........IDFV.R......................GAK.-...--....---E..EVIL......F--..-----
HGL_H00000312649     E........CQVL.T......................RSK.R...GE....K--H..GFIT......YRC..SEHAA
HGL_H00000292672     -........----.-......................---.-...--....--GC..AFLT......YCA..RDSAI
HGL_H00000287202     -........----.-......................---.-...--....--GC..AFLT......YCA..RDSAL
HGL_H00000238688-2   -........----.-......................---.-...--....----..CWIY......FSS..EEALQ
HGL_H00000324827-1   N........VDIP.Mldpyreemtsrnfhvf......GFG.-...GH....LNFE..AYIQ......YCE..YGGFL
HGL_H00000221419     S........VKVF.S......................GKS.-...ER....SS-S..GLLE......WES..KSDAL


                       0                    130            140                                      
                       |                      |              |                                      
d1hl6a_                AAKEA.L..N......GA....EI..MG...QTIQVDWC---fvk................................
HGL_H00000361949-2   KAVTE.M..N......GR....IV..GS...KPLYVALA---qrkeer.............................
HGL_H00000255136     KAVTE.M..N......GC....IV..GT...KPLYVALA---qrkeer.............................
HGL_H00000271628-1   AAIEA.M..N......GQ....YL..CN...RPITVSYA---fkkdsk.............................
HGL_H00000361949-2   KAIEK.M..N......GM....LL..ND...RKVFVG-----rfksrker...........................
HGL_H00000308012     KAVLE.L..H......GK....SM..DG...KVLYVGRA---qkkierlaelrrrferlrlkeksrppgvpiyiknl
HGL_H00000393248-2   RAIDA.M..N......GM....FL..NY...RKIFVG-----rfkshke............................
HGL_H00000255136     QAIST.M..N......GM....LL..ND...RKVFVG-----hfkshr.............................
HGL_H00000358089     NAIVH.M..G......GQ....WL..GG...RQIRTNWA---trkp...............................
HGL_H00000408239     KALTE.M..N......GR....VL..GS...KALSIALA---qr.................................
HGL_H00000271628-2   AAIEA.M..N......GQ....YL..CN...RPITVSYA---fkkds..............................
HGL_H00000352612     MAIAS.L..N......GY....RL..GD...RVLQVSF----ktnkt..............................
HGL_H00000416340-1   AAMCA.-..R......PH....KV..DG...RVVEPK-----ravsredsvkpgahltvkkifvggikedteeynlr
HGL_H00000360886     MAIAS.L..N......GY....RL..GD...RVLQVSF----ktnka..............................
HGL_H00000408239     CAIEQ.M..N......GK....VI..ND...RPVFVA-----pfkprkdr...........................
HGL_H00000352162     KAINT.L..N......GL....KL..QT...KTIKVSYA---rpssasirdanlyvsglpktmsqkemeqlfsqygr
HGL_H00000264073-2   MAIAS.L..N......GY....RL..GD...KILQVSF----ktnks..............................
HGL_H00000389951     AAIQA.M..N......GF....QI..GM...KRLKVQL----krsknd.............................
HGL_H00000355089     TAIQA.M..N......GF....QI..GM...KRLKVQL----krpkdan............................
HGL_H00000287202     TAIQA.M..N......GF....QI..GM...KRLKVQL----krpkdan............................
HGL_H00000313007-2   KAVKE.M..N......GR....TV..AT...KPLYVALA---qlke...............................
HGL_H00000308012     RAIWH.M..N......GV....RL..NN...RQVYVG-----rfkf...............................
HGL_H00000414859-2   AAIQS.M..N......GF....QI..GM...KRLKVQL----krsknd.............................
HGL_H00000313007-1   KAVDE.M..N......GK....EL..NG...KQIYVGRA---qkkverqtelkrkfeqmkqdritryqgvnlyvknl
HGL_H00000316042     KAAVV.-..K......FH....PI..QG...HRVEV------v..................................
HGL_H00000414859-1   AAIQS.V..N......GF....QI..GM...KQLKVQL----krsskn.............................
HGL_H00000414859-3   TAIKA.M..H......Q-....--..--...-----------aq.................................
HGL_H00000412831     DAMMA.M..N......GK....SV..DG...RQIRVDQA---gkssdsrsrgyrggsaggrgffrggrgrgrg....
HGL_H00000401336     DAVYG.R..D......GY....DY..DG...YRLRVEF----prsgrgtgrgggggggggaprgrygppsrrsenrv
HGL_H00000373277     VVIQH.F..N......GK....YL..--...-----------k..................................
HGL_H00000402734     NAIEK.L..S......GK....EI..NG...RKIKL------ie.................................
HGL_H00000343966     IAKAE.L..D......GT....IL..KS...RPLRIRFA---thgaaltvknlspvvsnelleqafsqfgpvekavv
HGL_H00000264073-1   RAICT.L..N......GL....RL..PS...KTIKVSYA---rpsseviknanlyisglprtmtqkdvedmfsrfgr
HGL_H00000362900     RALEK.L..D......GT....EV..NG...RKIRL------ve.................................
HGL_H00000326806     NAMRF.I..N......GT....RL..DD...RIIRTDW----dagfkegrqygrgrsggqvrdeyrqdydagrggyg
HGL_H00000229390-2   DAIYG.R..N......GY....DY..GQ...CRLRVEF----prtyggrggwprggrtgpptrrsdfrvlvsglpps
HGL_H00000365950-3   DAMRA.M..N......GE....SL..DG...RQIRVDHA---gksargtrgggtfgahgrgrsysrgggdqgygs..
HGL_H00000416340-2   TAMCT.L..P......HK....--..--...-----------vdgdvvepkrtvsredsvkpgahltvkkicvsgik
HGL_H00000294172-1   KAVN-.-..-......--....--..--...-----------ckivdrdnrkisiiinssaapqtv...........
HGL_H00000253363     KALEQ.L..N......GF....EL..AG...RPMKVG-----hvtertdassassfldsdelertgidlgttgrlql
HGL_H00000349748-2   IAKAE.L..D......DT....PM..RG...RQLRVRFA---thaaalsvrnlspyvsnelleeafsqfgpieravv
HGL_H00000297071     EAMER.A..N......GM....EL..DG...RRIRVDYS---itkrahtptpgiymgrpthsgggggggggggggg.
HGL_H00000276079     IAKVE.L..D......NM....PL..RG...KQLRVRFA---chsasltvrnlpqyvsnelleeafsvfgqveravv
HGL_H00000294172-2   KAM--.-..N......CK....TV..--...-----------drnnqkisiiinssatphtv...............
HGL_H00000393937     QAIEN.C..-......--....--..--...-----------d..................................
HGL_H00000376344     KAYSA.V..D......GQ....VF..QG...RMLHVLPS---tirkeaseeagapgssykrkkdskdkansasshnw
HGL_H00000402114     -----.-..-......--....--..--...-----------hyinnralffvqdaciaskikhvrnkiydeekrki
HGL_H00000276201-1   LFRDR.F..D......GY....VF..LD...N----------kgqeyaamvefapfqka..................
HGL_H00000276201-2   LFRDR.F..D......GY....VF..LD...N----------kgqeypaivefapfqka..................
HGL_H00000359645-2   DAARD.M..N......GK....SL..DG...KAIKVEQA---tkpsfeggrrgppppprsrgpprglrggrggsgg.
HGL_H00000376290-4   EAKEC.A..N......GM....EP..DG...RRIRVGFS---itkrphtptpgiymgrltyassrrrdysdr.....
HGL_H00000376290-3   EAKER.A..N......GM....EL..DG...RRIRVDFS---itkrphtptpgiymgrp..................
HGL_H00000341826     AAMNA.-..R......PH....KV..DG...RVVEPK-----ravsredsqrpgahltvkkifvggi..........
HGL_D0073543         TGIQA.M..N......GF....QI..GM...KRLKVQL----krpke..............................
HGL_H00000383298-1   KI---.-..-......--....--..--...-----------v..................................
HGL_H00000387996     SAMRN.L..N......GR....EF..SG...RALRVDNA---aseknke............................
HGL_H00000309166-3   DAIRN.L..H......HY....KL..HS...VNINVEAS---knknkastklhvgnisptctnqelrakfeeygpvi
HGL_H00000364912     KAIKK.M..D......GE....YL..GN...NRLKLGF----gksmptncvwldglssnvsdqyltrhfcrygpvik
HGL_H00000393248-1   SAMQH.L..N......GH....EF..SG...RALRVDS----aasek..............................
HGL_H00000332444     SAMRN.L..N......GR....EF..SG...RALRVDNA---aseknk.............................
HGL_H00000376290-2   EAKEC.A..N......GM....EP..DG...RRIRVGFS---itkrphtptpgiymgrptygssrrrdysdr.....
HGL_H00000313007-1   RAIEK.M..N......GM....LL..ND...RKVFVG-----rfksrkereael.......................
HGL_H00000313890-1   RAKVA.M..S......GR....VI..GR...NPIKIGYG---kanpttrlwvgglgpntslaalarefdrfgsirti
HGL_H00000376290-5   EAKEC.A..N......GM....EP..DG...RRIRVGFS---itkrphtptpgiymgrptygssrrrdysdr.....
HGL_H00000359645-1   EATRD.M..N......GK....SL..DG...KAIKVEQA---tkvsfesgrrgtpppprsrgpprglrggrggsgg.
HGL_H00000318195     AAKEA.M..E......DG....EI..DG...NKVTLDWA---kpkgeggfggrgggrggfggrgggrggrggf....
HGL_H00000401371     NAIQQ.M..G......GQ....WL..GG...RQIRTNWA---trkppapk...........................
HGL_H00000221448     SAYKH.A..D......GK....KI..DG...RRVLVD-----vergrtvkgwrprrlggglggtrrgga........
HGL_H00000266529-8   NCTRA.I..N......NK....QL..FG...RVIKASIA---idngraaefirr.......................
HGL_H00000333001     AAMEG.L..N......GQ....DL..MG...QPISVDWC---fvrgppkgkrrggrrrsrspdrrr...........
HGL_H00000364448     LFRDR.F..D......GY....VF..MS...-----------skgleypavvefapfqk..................
HGL_H00000360886     KAINT.L..N......GL....RL..QT...KTIKVSYA---rpssa..............................
HGL_H00000281722     LAIRI.L..N......NY....EIr.PG...KFIGVCV----sldncrlfigaipkekkkeeildemkkvtegvvdv
HGL_H00000383298-6   AAMNE.-..R......PH....KV..DG...R----------vgepkravsredsqrpgahltvkkifvggikedtv
HGL_H00000352612     KAINT.L..N......GL....RL..QT...KTIKVSYA---rpss...............................
HGL_H00000352956     RAVEQ.L..N......GF....EL..AG...RPMRVG-----hlterad............................
HGL_H00000293677     RAKSD.L..L......GK....PL..GP...RTLYVHW----tdagqltpallhsrclcvdrlppgfsdvdtlrqal
HGL_H00000295470-1   KLLES.-..R......YH....QI..GS...GKCEIKVA---qpkevyrqqqqqqkggrgaagggrggtrgrgr...
HGL_H00000322016     DAVSS.M..N......LF....DL..GG...QYLRVGKA---vtppmplltpatpgglppaaavaaaaatakitaqe
HGL_H00000402503     AAINT.L..H......SSr...TL..PGas.SSLVVKFA---dtekerglrrmqqvatqlgmfspialqfgaysayt
HGL_H00000233078     QAVN-.M..H......FH....DI..MG...KKVEVKRA---eprdsksqapgqpgasqwgsr..............
HGL_H00000351108     KVLEK.-..K......FH....TI..SG...SKCEIKVA---qpkevyqqqqygsggrgnrnrgnrgssgggggg..
HGL_H00000253329     KAFFK.M..D......NV....LI..DD...RRIHVDFS---qsvakvkwk..........................
HGL_H00000257552     KVCEI.-..H......FH....EI..NN...KMVECKKA---qpkevmsptgsargrsrvvpy..............
HGL_H00000341826     KIVIQ.-..K......YH....TV..NG...HNCEVRKA---lskqemasasssqrgrsgsgnfgggrgggfgg...
HGL_H00000243563-3   NALRS.M..Q......GF....PF..YD...KPMRIQYA---ktdsdiiakmkgtfverdrkrekrkpksqetpsak
HGL_H00000416340-3   KIVVQ.-..K......YH....TI..NG...HNCEVKKA---lskqemqsagsqrgrgggsgnfmgrggnfggggg.
HGL_H00000371212     RAVRE.L..N......NY....EIr.PG...RLLGVC-----csvdncrlfiggipklkkreeiakvtegvldvimy
HGL_H00000307863     QAIAG.L..N......GM....QL..GD...KKLLVQRA---svgaknatlstinqtpvtlqvpglmssqvqmgghp
HGL_H00000361924     AAIDN.M..N......ES....EL..FG...RTIRVNLA---kpmrik.............................
HGL_H00000266529-6   NCTRA.I..N......NK....QL..FG...RAIKASIA---idngraaefirrr......................
HGL_H00000331817     KAMKQ.Y..N......GV....PL..DG...RPMNIQL----vtsqietqrrpapsinrggmtrnrgsggfggggg.
HGL_H00000266529-7   NYTRA.I..N......NK....QL..FG...RVIKASIA---idngraaefirr.......................
HGL_H00000365950-2   TAIQA.M..N......GF....QI..GM...KRLKVQL----krpkd..............................
HGL_H00000376290-1   ETKER.A..N......GM....EL..DG...RRIRVDFS---itkrphtptpgiymgrpiygssrrrdyygrg....
HGL_H00000313199-1   KIMEKkY..H......NV....GL..SK...CEIKVAM----skeqyqqqqqwgsrggfsgrargrgggps......
HGL_H00000233078     TVLAS.-..R......PH....TL..DG...RNID-------pkpctprgmqpertrpkegwqkgprsds.......
HGL_H00000383298-2   KIVIQ.-..K......YH....TV..NG...HNCEVRKA---llkqemasasssqrgrsgsgnfgggrgggfgg...
HGL_H00000358799     RAKLA.M..S......GK....II..IR...NPIKIGY----gkatpttrlwvgglgpwvplaalarefdrfgtirt
HGL_H00000264073-2   RAINT.L..N......GL....RL..QS...KTIKVSYA---rpss...............................
HGL_H00000354021-2   KIVLQ.-..K......YH....TI..NG...HNAEVRKA---lsrqemqevqssrsgrggnfgfgdsrggggn....
HGL_H00000416340-3   AAMCA.-..R......PH....KV..DG...RVVEPK-----ravsredsvkp........................
HGL_H00000376117     KILQE.A..A......KL....IY..KD...KKLNIGPA---irrqhvg............................
HGL_H00000416340-4   KIVFQ.-..K......YH....TI..NG...HNCEVKRA---lskqeihsagsqrgrgggsgnfmgrggnfggggg.
HGL_H00000246071-1   NALRQ.L..Q......GF....PF..YG...KPMRIQYA---ktdsdiiskmrgtfadkekkkekkkaktveqtatt
HGL_H00000285814-6   IVAET.M..H......NY....LF..GE...RLLVCRF----mppkkaglptpyrgpqsqgihris...........
HGL_H00000383298-8   KVLGQ.-..P......HH....EL..DS...KTID-------pkvafprraqpkpr.....................
HGL_H00000216727-1   TSLA-.L..D......ES....LF..RG...RQIKVIP----krtnrpgisttdrgfpraryrarttnynssr....
HGL_H00000313199-1   KVMDQ.-..K......EH....KL..NG...KVID-------pkrakamktke........................
HGL_H00000318195     EALNS.C..N......KR....EI..EG...RTIRLEL----qgprgspnarsqpsktlfvkglseetteetlresf
HGL_H00000362936     RALTE.C..Q......GAv...GL..GS...KPVRLSVA---ipk................................
HGL_H00000266529-9   NCTRA.I..N......NK....QL..FG...RVIKASIA---idngraa............................
HGL_H00000320768     DARLQ.L..H......KT....EF..LG...KEMKLYFA---qtlhigsshlappnpdkqflisp............
HGL_H00000413035     RAREK.L..H......GT....VV..EG...RKIEVNNA---tarvmtnk...........................
HGL_H00000386226     LALK-.L..N......NS....EL..MG...RKLRVMHS---vnkeklkq...........................
HGL_H00000309117     RAREK.L..H......GT....VV..EG...RKIEVNNA---tarvmtnk...........................
HGL_H00000266529-1   NCTRA.I..N......NK....QL..FG...RVIKASIA---idngraaefirr.......................
HGL_H00000363105     EAMKA.L..N......GK....VL..DG...SPIEVTLA---kp.................................
HGL_H00000223073     KALKG.M..N......MK....DI..KG...RTVAVDWA---vakdkykntqs........................
HGL_M00000038256     DAIHN.L..H......RY....EL..HG...VNINVEAS---knkgkastklhvgnvsptctnkelkgkcaeygpfm
HGL_H00000354021-2   AAMAA.-..R......PH....SI..DG...RVVEPK-----ravareesgkpg.......................
HGL_H00000401371     AALAA.M..N......GR....KI..MG...KEVKVNWA---ttpssq.............................
HGL_H00000383298-2   AAMNA.-..R......LH....KV..GG...RVVE-------pkravsredsqrpga....................
HGL_H00000333170     YAIAL.L..N......GI....RL..YG...RPINVQY----rfgssrssepanq......................
HGL_H00000351108     KVLDQ.-..K......EH....RL..DG...RVID-------pkkamamkkdp........................
HGL_H00000309166-1   EAIRG.L..D......NT....EF..QG...KRMHVQLS---tsrlrtapgmgdqsgcyrcgkegh...........
HGL_H00000363516     RARIE.L..H......ET....DF..NG...KKLKLYFA---qvqmsgeardrsylrppqpakqflisp........
HGL_H00000294428     RARLE.L..L......GK....RL..GP...WVLFAQW----mdvnllasdrvhskclcvdklpahfsdteellqcl
HGL_H00000354719     KAYRD.A..D......GL....VV..DQ...HEVFVDY----elertlrgwiprrlggglggkkesgqlrfggr...
HGL_H00000253108     RAIAG.V..S......GF....GY..DH...LILNVEWA---k..................................
HGL_H00000313890-2   RAKVA.M..S......GR....VL..GR...SPIKVGYG---kanptarlwvgglgpnpslaalarefdrfgiirti
HGL_H00000266529-10  NCTRV.I..I......NK....QL..FG...SVIKASIA---idn................................
HGL_H00000346120     -----.-..-......--....--..--...-----------qlgedidskvkgmvflkgklgvcfdvrtaavteiq
HGL_H00000365950-5   DATRA.M..N......GE....SL..GG...RRIRVDRA---gkaargtrgggafgahgrgrsysrgagdqgygs..
HGL_H00000316950     KACRI.M..N......GI....KI..SG...REIDVRL----dr.................................
HGL_H00000295470-1   KVLE-.L..K......EH....KL..DG...KLID-------pkrak..............................
HGL_H00000376344     KALRQ.L..Q......GH....VV..DG...HKLELRI----sera...............................
HGL_H00000349428-2   HAKLS.L..D......GQ....NI..YNac.CTLRIDFS---kltslnvkynndksrdytrpdlps...........
HGL_H00000290341     QAIMK.L..N......GH....QL..EN...HALKVSY----ipdeq..............................
HGL_H00000362820-2   DAVRE.L..D......GR....TL..CG...CRVRVELS---ngekrsrnrgpppswgrrprddyrrrspppr....
HGL_H00000309558     AAIDW.F..D......GK....EF..HG...NIIKVSFA---...................................
HGL_H00000316950     KALET.M..N......KY....DL..SG...RPLNIK-----edpdgenarralqrtggsfpgghapem........
HGL_H00000365950-4   DAMRA.M..N......GE....SL..DG...RQIRVDHA---gksargtrggsafgahglncsysrgvgdhey....
HGL_H00000262633     RAMRE.M..N......GK....YV..GS...RPIKLRK----smwkdrn............................
HGL_H00000420195-3   NACDH.L..S......GF....NV..CN...RYLVVLY----ynanraf............................
HGL_H00000325376     RACRM.M..N......GM....KL..SG...REIDVRI----dr.................................
HGL_H00000294904     KAVSA.L..-......--....--..--...-----------...................................
HGL_H00000265753-1   EALTY.-..D......GA....LL..GD...RSLRVDIA---egrkqdkggfgfrkggpddrgiggsresrgg....
HGL_H00000325905     DAVRG.L..D......GK....VI..CG...SRVRVELS---tgmprrsrfdrpparrp..................
HGL_H00000364639-2   YAMNL.L..N......GI....KL..FG...RPIKIQF----rsgsshasqdvsls.....................
HGL_H00000363105     NAIKQ.L..N......NY....EIr.NG...RLL--------gvc................................
HGL_H00000358635-1   KAMEE.M..N......GK....DL..EG...ENIEIVFA---kppdqkrkerkaqrqaaknqmyddyyy........
HGL_H00000316950     QAISM.F..N......GQ....FL..FD...RPMHVKM----ddksvphe...........................
HGL_H00000338477-2   AAMSK.-..D......RA....NM..QH...RYIELF-----lnstt..............................
HGL_H00000252542     KCISH.L..H......RT....EL..HG...RMISVEKA---knepa..............................
HGL_H00000243563-2   NALRS.M..Q......GF....PF..YD...KPMRIQYA---kansdiiaklkgtfverdr................
HGL_H00000401371     HAIVS.V..N......GT....TI..EG...HVVKCYWG---ketldminpvqqqnqigypqpygqwgqwyg.....
HGL_H00000354021-1   AAMAA.-..R......PH....SI..DG...RVVEPK-----ravareesgks........................
HGL_H00000409315     QAIQC.L..N......GK....LA..LS...KKLVVRWA---haqikrydh..........................
HGL_H00000313199-2   KVMDQ.-..K......EH....KL..NG...KVID-------pkrakamktk.........................
HGL_H00000361927     AAMAK.-..D......KA....NM..QH...RYVELF-----lnsta..............................
HGL_H00000327539     AAMSK.-..D......KA....NM..QH...RYVELF-----lnsta..............................
HGL_H00000358089     HAIVS.V..N......GT....TI..EG...HVVKCYWG---kespd..............................
HGL_H00000338477-4   AAMSK.-..D......RA....NM..QH...RYIELF-----lnstt..............................
HGL_H00000361949-1   RALDT.M..N......FD....GI..KG...KQIYIMW----pqkdpsltksgvgnvfiknldksidnkalydtfsa
HGL_H00000228284     QAVMK.M..D......GM....TI..KE...NVIKVAIS---nppqrkvpek.........................
HGL_H00000355089     KAQSA.L..H......EQk...TLpgMN...RPIQVKPA---dsesr..............................
HGL_H00000362687     -----.-..-......--....--..--...-----------cawkelnrklssnaasqitrmcllkgkmgvcfdvp
HGL_H00000250863     KIVE-.-..S......QI....NF..HG...KKLKLGPA---irkqnlc............................
HGL_H00000365950-1   DAMRA.M..N......GE....SL..DG...RRIRVDHA---gkaaggtrrggafgahghggsysrgggdqgygng.
HGL_H00000377738     QAKLA.L..D......GQ....NI..YNac.CTLRIDFS---klvnlnvkynndksrdytrpdlps...........
HGL_H00000322016     LALEQ.M..N......SV....ML..GG...RNIKVG-----r..................................
HGL_H00000358635-1   EAVKL.Y..N......NH....EIr.SG...KHIGVCI----sv.................................
HGL_H00000414921     YAKMA.L..D......GQ....NI..YNac.CTLRIDFS---kltslnvkynndksrdftrldl.............
HGL_N10016780        AVVEW.F..S......GK....DF..QG...SKLKVSLA---wkkpp..............................
HGL_H00000413303-1   KAMDE.M..N......GK....EI..EG...EEIEIVLA---kppdkkrkerqaarqasrs................
HGL_H00000310471-3   DAIRN.L..H......HY....KL..HG...VNINVEAS---knks...............................
HGL_H00000338477-5   PAMSK.-..D......RA....NM..QH...RYIELF-----lnstt..............................
HGL_H00000325376     QAISM.F..N......GQ....LL..FD...RPMHVKM----deral..............................
HGL_H00000352162     MAIAS.L..N......G-....--..--...-----------...................................
HGL_H00000262031     KAVTA.L..-......--....--..--...-----------...................................
HGL_H00000358635-2   KAMDE.M..N......GK....EI..EG...EEIEIVLA---kppdk..............................
HGL_H00000292672     AAIHA.L..H......GSq...TM..PGas.SSLVVKFA---dtdkertlrrmqqmv....................
HGL_H00000218364     HCIQT.L..D......GR....WF..GG...RQITAQ-----pwdgt..............................
HGL_H00000313199-2   KIMEKkY..H......NV....GL..SK...CEIKVA-----ms.................................
HGL_H00000338477-1   KALRK.-..H......KE....RI..GH...RYIEVFKS---sqqevrsy...........................
HGL_H00000338477-5   KALRK.-..H......KE....RI..GH...RYIEVFKS---sqqevrsy...........................
HGL_H00000216727-2   TSLA-.L..D......ES....LF..RG...RQIKV------...................................
HGL_H00000285814-5   IEAEM.T..H......NY....LF..GE...RLLVCHF----mppekvhk...........................
HGL_H00000349428-1   TMVNY.Y..T......SVtp..VL..RG...QPIYIQFS---nhkelktdsspnq......................
HGL_H00000338477-3   AAMSKdK..D......RT....NI..QH...RYIELF-----lnst...............................
HGL_H00000338477-1   AAMSKdK..D......RT....NI..QH...RYIELF-----lnst...............................
HGL_H00000309166-2   EAIRG.L..D......NT....EF..QG...KRMHVQLS---tswldrsplhhatgpvttvgegygyrh........
HGL_H00000309166-1   DAIRN.L..H......HY....KL..HG...VNINVEAS---knks...............................
HGL_H00000327539     KALKK.-..H......KE....RI..GH...RYIEIFKS---sraevrthyd.........................
HGL_H00000265866-2   AAMSK.-..D......KN....NM..QH...RYIELF-----lnstpgggsg.........................
HGL_H00000265866-2   NALGK.-..H......KE....RI..GH...RYIEIFRS---srseikgfydpprr.....................
HGL_H00000338477-2   KALGK.-..H......KE....RI..GH...RYIEVFKS---sqeevrsy...........................
HGL_H00000265997     ALIDA.-..-......--....--..--...-----------cleedgklylcvssptikdkpvqirpwnlsdsdfv
HGL_H00000361557     EALHL.A..N......GY....KL..HG...KILVIEFG---knksq..............................
HGL_H00000311747     AAIAQ.L..N......GK....EV..KG...KRINVELS---tkgqkkgpglavq......................
HGL_H00000259997     ALIDA.-..-......--....--..--...-----------cieedgklylcvssptikdkpvqirpwnlsdsdfv
HGL_H00000352668     AALCR.-..H......KQ....YM..GN...RFIQVHP----itkkgmlekidtir.....................
HGL_H00000229390-1   YALRK.L..D......DT....KF..RS...H----------eg.................................
HGL_H00000338477-4   KALWK.-..H......KE....RI..GH...RYIEVFKS---sqeevrsy...........................
HGL_H00000349428-1   HARLS.L..D......RQ....NI..YNtc.CTLSIDF----skltslnvkynydksragfpp..............
HGL_H00000349428-2   TMVNY.Y..T......SVtp..VL..RG...QPIYIQFS---nhkelktdsspn.......................
HGL_N10004544        KALKH.M..D......G-....--..--...-----------...................................
HGL_H00000240185     KVMS-.-..Q......RH....MI..DG...RWCDCK-----lpnskq.............................
HGL_H00000285814-4   TVAEM.M..H......NY....LF..GE...RLLVCRF----mppekkkk...........................
HGL_H00000376344     RAFNA.Lc.H......ST....HL..YG...RRLVLEWA---ds.................................
HGL_H00000383298-7   AAR--.-..-......--....--..--...-----------n..................................
HGL_H00000265085     ALIDA.-..-......--....--..--...-----------cieedgklylcvssptikdkpvqirpwnlsdsdfv
HGL_H00000404545-2   KCINH.L..H......KT....EL..HG...KMISVEKA---knepas.............................
HGL_H00000396578-3   SALS-.L..N......EE....SL..GN...RRIRVDVA---dqaqdkdrd..........................
HGL_M00000078602     RALKN.L..N......GK....MI..MS...FEMKLGW----gka................................
HGL_H00000352668     AAVID.L..N......DR....PI..GS...RKVK-------l..................................
HGL_H00000383298-4   AAMNV.-..R......PH....KL..DG...RVVE-------pkr................................
HGL_H00000338095-2   AAVAG.E..D......GR....MI..AG...QVLDINLA---aepkvnrg...........................
HGL_H00000361927     KALKK.-..H......KE....RI..GH...RHVEIFKS---sraevrthydpp.......................
HGL_H00000366829     RWMEA.-..N......QHsl..NI..LG...QKVSMHYS---dpkpkinedwlcnkcgvqnfkrrekcfkcgvpkse
HGL_H00000295470-3   KVLE-.L..K......EH....EL..GS...-----------vksklhnpkryigsnsnnkkeeevlqlvge.....
HGL_R00000023552     LFRDR.F..D......GY....VF..MS...-----------skgleypavaefapfqk..................
HGL_H00000285814-1   IVAET.M..H......NY....LF..GE...RLLVCRF----mppekkke...........................
HGL_N10004520        AAIDW.L..E......GK....EF..SG...NPIKVSFA---trladfnqdggngrggrgrggptghggcggggsg.
HGL_H00000246194-3   AAVVG.E..N......GR....VL..AG...QTLDINMA---gepkpnrp...........................
HGL_H00000414859-2   EAQNA.L..H......NM....KVl.PGmh.HPIQMKP----adsek..............................
HGL_H00000402503     KAQSA.L..H......EQk...TLpgMN...RPIQVKPA---dses...............................
HGL_H00000199814-2   VAAEKsF..N......KL....IV..NG...RRLNVKWG---rsqaargk...........................
HGL_H00000325376     KAAEV.L..N......KH....SL..SG...RPLKVK-----edpdgeharramqkvmattggmgmgpggpg.....
HGL_H00000262031     AIITH.F..N......GK....FI..K-...-----------tppgvpapsdpllckfadggpkkrqnqgkfvqngr
HGL_H00000383298-5   KI---.-..-......--....--..--...-----------vi.................................
HGL_H00000390913     AAVE-.L..D......ES....IF..RG...RVIKVLP----krtnfpgisstdrgg....................
HGL_H00000344950     KAIEF.L..N......N-....--..--...-----------...................................
HGL_H00000334538     RALA-.F..N......GV....MF..GD...RPLKINHS---nna................................
HGL_H00000310471-1   DAIHN.L..H......HY....KL..HG...VNINVEAS---knks...............................
HGL_H00000223073     RALKE.I..-......-T....TF..EG...SKINITVA---kkklrnnskekr.......................
HGL_H00000310471-3   EAIRG.L..D......NT....EF..QG...-----------...................................
HGL_H00000400142     AAVEW.F..D......GR....I-..--...-----------nkrtgqpmihiyldketgkpkgdatvsyedpptak
HGL_H00000294904     AVIGH.F..N......GK....FI..K-...-----------tppgvsaptepllckfadggqkkrqnpnkyipngr
HGL_N10006621        LFRDR.F..D......GY....VF..MS...-----------skgleypavvefapfqk..................
HGL_H00000310471-2   EAIRG.L..D......DT....EF..QG...QRVYVQLS---isslwtapgmgeqsgcyrcgkeg............
HGL_M00000111283     KALEQ.L..N......GF....EL..AG...RPMKVG-----hviertd............................
HGL_H00000369887-2   RCIAH.L..H......RS....EL..HG...QLISVKK----vkgdpskke..........................
HGL_H00000362820-1   DAVRE.L..D......GR....TS..CG...CRVRVELS---ngek...............................
HGL_H00000223073     KCLAA.A..SpeteggGL....KL..NG...RQLKVDLA---vtrd...............................
HGL_H00000383298-3   KIVV-.-..-......--....--..--...-----------qkyqgkkkkalskqemqsagsqrgsgggsgnfmcc
HGL_H00000343054     SWMEA.N..Q......KKl...VI..QG...KHIAMHY----s..................................
HGL_H00000364639-1   YAMNL.L..N......GI....KL..FG...RPIKIQF----rsgs...............................
HGL_H00000371212     HAMSN.L..N......GT....EL..EG...SCLEVTLA---kpvdkeqysryqk......................
HGL_H00000389951     EAQNA.L..H......NIk...TL..PGmh.HPIQMKP----adseks.............................
HGL_H00000221419     NAVNY.AadN......QI....YI..AG...HPAFVNYS---tsqkisrpgdsdds.....................
HGL_H00000379069     RILIA.-..K......PI....MF..RGe..VRLNV------eekktraareretrgggddrrdirrndrgpggpr.
HGL_H00000390625     ECVT-.-..-......--....--..--...-----------faadepvyiagqqaffnystskritrpgntdd...
HGL_H00000315859     KALKH.M..D......GG....PI..DG...QEI--------l..................................
HGL_H00000393937     DAIAT.L..H......GK....IL..NG...VRLKVMLA---dspre..............................
HGL_H00000414921     QALIE.L..H......NH....DL..G-...-----------enh................................
HGL_H00000369887-1   RCIAH.L..H......RT....EL..HG...QLISVEK----vkgdpskke..........................
HGL_H00000361927     LALKK.-..D......RE....TM..GH...RYVEVFKS---nsvemdwvlk.........................
HGL_N10001384        EAKEC.A..N......GM....EL..DG...HRIRVDFS---itkrphtptpgiymgrptygssrrrdysdr.....
HGL_H00000360425     RARIE.L..H......ET....QF..RG...KKLKLYFA---qvqtpetdgdklhlappqpakqflisp........
HGL_H00000240185     SLCG-.-..-......--....--..--...-----------edliikgisvhisnaepkhnsnrqlersgrfggnp
HGL_H00000396578-2   SGLS-.L..N......EE....SL..GN...RRIRVDVA---dqaqdkdrd..........................
HGL_H00000376344     RALSH.F..N......KC....FI..DT...ARITVEFC---ksfgdptkpr.........................
HGL_H00000281722     AAMSV.M..S......GK....CI..DG...ASIEVTLA---kpvnkestgrqhlngq...................
HGL_H00000338095-1   AAVAG.E..D......GR....MI..AG...QVLGINLA---aepkvnrg...........................
HGL_H00000238688-1   NAVQH.-..E......NH....VI..DG...VK---------v..................................
HGL_H00000352956     LAIG-.L..T......GQ....RL..LG...VPIVVQAS---qaeknrl............................
HGL_H00000413532     AMVDH.C..L......KKal..WF..QG...RCVKVDLS---eky................................
HGL_H00000310471-2   DAIRN.L..H......HY....KL..YG...VNINVEAS---knks...............................
HGL_H00000338477-3   TALKK.-..D......RE....SM..GH...RYIEVFKS---hktemdwvlk.........................
HGL_N10024532        KALKH.M..D......GG....QI..GG...-----------...................................
HGL_H00000253363     LAIG-.L..T......GQ....RV..LG...VPIIVQ-----a..................................
HGL_H00000348578     KVLSN.-..R......PI....MF..RGe..VRLNV------eekktraaregdrrdnrlrgpggprgglgggmr..
HGL_H00000377738     TMVNY.Y..S......AVtp..HL..RN...QPIYIQYS---nhkel..............................
HGL_H00000338477-5   MALKK.-..D......RE....SM..GH...RYIEVFKS---hrtemdwvlk.........................
HGL_H00000338477-4   MALKK.-..D......RE....SM..GH...RYIEVFKS---hrtemdwvlk.........................
HGL_H00000310471-1   EAIRG.L..D......NT....EF..QG...-----------...................................
HGL_H00000349428-2   LAMSH.L..D......GH....KL..HG...KPIRITLS---khqnvqlpregqe......................
HGL_H00000382239     AAIKD.L..N......DR....PV..GP...RKVK-------l..................................
HGL_H00000377738     LAMNH.L..N......GQ....KM..YG...KIIRVTLS---khqtvqlpre.........................
HGL_H00000338477-3   KALRK.-..H......KE....KI..GH...RYIEVFK----ssqe...............................
HGL_H00000318195     KTFEE.K..Q......GT....EI..DG...RSVSLYY----tgekgqnqdyrggkns...................
HGL_H00000307863     QAMA-.F..D......GI....IF..QG...QSLKIRR----phdyq..............................
HGL_H00000356154     RALQK.L..Ssg....SY....KI..GS...KVIKIAWA---...................................
HGL_H00000338477-2   MALKK.-..D......RE....SM..GH...RYIEVFKS---hrtemdwvlk.........................
HGL_H00000416340-3   -----.-..-......--....--..--...-----------e..................................
HGL_H00000414921     TMVNY.Y..T......PVtp..HL..RS...QPVYIQYS---nhrelktd...........................
HGL_H00000414859-1   EAQNA.L..H......NM....KVl.PGmh.HPIQMKP----adsek..............................
HGL_H00000295470-4   KVLE-.-..-......--....--..--...-----------lk.................................
HGL_M00000094956     QAVAE.L..N......GT....QV..ES...VQLKVNIA---...................................
HGL_H00000286835     RALQK.L..Srg....NY....KV..NQ...KSIKIAWA---...................................
HGL_H00000391432     KALKE.A..N......GY....IL..FG...KPMVVQFA---rsarpkqds..........................
HGL_H00000266529-2   NSTRA.I..N......NK....QL..FG...RVIKASI----gidngrtaefmqr......................
HGL_H00000349428-1   LAMSH.L..D......GH....KL..HG...KPIRITLS---khqnvqlpregqe......................
HGL_H00000295470-2   -----.-..-......--....--..--...-----------...................................
HGL_N10021125        KALKH.M..D......GG....QI..DG...QEITA------tavlapwprppprrfspprrmlpprpm........
HGL_H00000257552     KVLAQ.-..S......RH....EL..DS...KTID-------pkvafprraqpkm......................
HGL_H00000265866-1   NALGK.-..H......KE....RI..GH...RYIEIFRS---srskikgfyd.........................
HGL_H00000358635-2   EAVK-.-..-......--....--..--...-----------...................................
HGL_H00000420270-2   AAQKL.L..T......GR....MF..DG...KFVVATF----ypl................................
HGL_H00000254799     KALEK.-..H......RL....YM..GQ...RYVEVY-----einnedvd...........................
HGL_H00000260956-8   KFVET.-..P......GQ....KY..KD...TDLLI------lfkedyfakkneer.....................
HGL_H00000311747     RAIEA.L..H......GH....ELr.PG...RALVVEMS---rprpmn.............................
HGL_H00000358479     DALYN.L..N......RK....WV..CG...RQIEIQFA---qgdrktpgq..........................
HGL_H00000339090     LAVDN.F..N......GI....KI..KG...RTIRVDH----vsn................................
HGL_H00000291552-1   KAVID.L..N......NR....WF..NG...QPIHAELS---pvtdf..............................
HGL_H00000358635-1   QARRR.Lm.S......GKv...KV..WG...NVGTVEWA---dpiedpd............................
HGL_H00000358635-2   EAVKL.C..D......SY....EIr.PG...KHLGVCI----sva................................
HGL_H00000382296     AAVAG.E..N......SR....II..AG...QPL--------...................................
HGL_H00000376344     KALK-.C..N......RE....YM..GG...RYIEVFR----ekq................................
HGL_H00000405738     NALRK.-..-......--....--..--...-----------h..................................
HGL_H00000396578-4   SALSH.-..S......EE....SL..DN...RRIQVDVA---dqaqdknrd..........................
HGL_H00000261723-3   TAV--.-..-......--....--..--...-----------s..................................
HGL_H00000261723-2   KAV--.-..-......--....--..--...-----------s..................................
HGL_H00000358532     AMVQF.Y..Q......EKsa..VI..NG...EKLLIRM----skryq..............................
HGL_H00000409088     TAYKK.Y..N......NR....CL..DG...QPMKCNL----hmngnvi............................
HGL_H00000405738     MASQK.C..H......KK....TM..KD...RYVEVFQ----csaeemn............................
HGL_H00000267197     EAVQH.L..H......CT....SV..MG...NIIHVEL----...................................
HGL_H00000382239     TALG-.F..H......KT....VL..QH...RPIHIDP----vskkqmlkfi.........................
HGL_H00000218364     LALKL.L..D......ED....EI..RG...YKLHVEVA---kfql...............................
HGL_H00000312675     AAIDW.F..D......GG....--..--...-----------nyg................................
HGL_H00000413303-1   QARRR.Lm.S......GKv...KV..WG...NVVTVEWA---dpveepd............................
HGL_H00000254799     AAML-.-..-......--....--..--...-----------k..................................
HGL_H00000369887-4   RCIAH.L..H......RT....EL..HG...QLISVEK----m..................................
HGL_H00000260956-6   KAKDA.N..N......GI....--..--...-----------lqlrnkevtwgvlegevekealkkiiedqqeslnk
HGL_H00000246194-1   AAVLG.E..N......GR....VL..AR...QTLNINMA---...................................
HGL_H00000352668     EALKR.-..N......RM....LM..IQ...RYVEISPA---terqwvaa...........................
HGL_H00000260956-8   KAKDA.N..N......GT....--..--...-----------lqlrnkevtwevlegevekealkkiiedqqeslnk
HGL_H00000309166-2   DAKHN.L..H......HY....KL..HG...VNINVEAS---knkgk..............................
HGL_H00000415054     KAIY-.L..S......GY....RM..--...-----------rlgsstdkkdsgrlhvdfaqard............
HGL_H00000413532     AAVDY.Y..T......TTpa..LV..FG...KPVRVHLS---qkyk...............................
HGL_H00000293677     AAINA.F..H......QS....HL..RD...RELSVQL----qptd...............................
HGL_H00000390625     RAVTH.L..N......NV....KL..FG...KRLNVCVS---kqhsvvp............................
HGL_H00000418748     AAAQR.C..H......KK....MM..KE...RYVEVV-----scstedmsr..........................
HGL_H00000221419     RAITH.L..N......NN....FM..FG...QKMNVCVS---kqpaimpg...........................
HGL_H00000262563     RAIQC.V..N......NV....VV..DG...RTLK-------a..................................
HGL_N10014200        EAPLR.A..K......RK....EL..CS...ERVMVEHA---rgpgrdrdrysygsrsgaggcssrrtsg.......
HGL_H00000260956-2   KFVET.L..G......QK....--..--...-----------ykdtdllilfkedyfakkne...............
HGL_H00000386226     KALKR.-..N......GA....QIa.DG...FRIRVDLA---set................................
HGL_H00000260956-4   KAKDA.N..N......GT....--..--...-----------lqlrnkevmwevlegevekealkkiiedqqeslnk
HGL_H00000377738     QALID.L..H......NY....NLg.EN...HHLRVSFS---ks.................................
HGL_H00000382239     GGLK-.C..H......RS....FM..GS...RFIEVMQ----gseqqwie...........................
HGL_H00000396578-1   SALS-.L..N......--....--..--...-----------eesld..............................
HGL_H00000358635-2   QARRR.Lm.S......GKv...KV..WG...NVVTVEWA---dpveepd............................
HGL_H00000199814-1   VAAEKsF..N......KL....TV..ND...RRLNVKR----rrsqeakrkrkrv......................
HGL_H00000397673-2   NAYAS.L..N......GK....EI..--...-----------vddl...............................
HGL_H00000260956-3   KFVE-.-..-......--....--..--...-----------...................................
HGL_H00000420195-2   DVLHN.L..D......RK....WI..CG...HQTEIQFA---qgdrktpnqmkpkerr...................
HGL_H00000390625     KAKAA.L..N......GA....DIy.AGc..CTLKIEYA---rptrlnvirndndswdytkpylgr...........
HGL_H00000349428-1   QALID.L..H......NH....DLg.EN...HHLRVSFS---ks.................................
HGL_H00000349428-2   QALID.L..H......NH....DLg.EN...HHLRVSFS---ks.................................
HGL_H00000418748     LALQR.-..H......KH....HM..GV...RYIEVYKA---tgeefvkia..........................
HGL_H00000345412-2   KLLEL.L..P......GK....VL..NG...EKVDVRPA---trqnlsqfeaqarkrecvrvpr.............
HGL_H00000391432     KALTR.L..H......QL....KL..LG...HTLVVEFA---keqdq..............................
HGL_H00000303015     AALSL.F..N......GR....WY..AG...RQLQCEFC---pvt................................
HGL_H00000351723-2   KCMSI.L..N......KT....KW..KG...GTLQIQLA---ke.................................
HGL_H00000371634     IATEK.L..S......GH....QF..EN...HSFKISY----ipdeevsspsppqgaqrgdhssreqgh........
HGL_H00000278070     AAIES.-..-......--....--..--...-----------gh.................................
HGL_H00000266529-5   RVIK-.-..-......--....--..--...-----------asiaidnr...........................
HGL_H00000327539     LALKK.-..D......RE....TM..GH...RYVEVFKS---nnvemdwvlk.........................
HGL_H00000266679     KLMDL.L..P......KR....EL..HG...QNPVVTP----cnkqflsqfemqsrkttqsgqmsgegkag......
HGL_H00000340176     AAKNA.L..N......GI....RF..DPeipQTLRLEFA---kantkmaknk.........................
HGL_H00000246071-2   AARDA.L..Q......GF....KIt.PS...HAMKITYA---k..................................
HGL_H00000371321     -----.-..-......--....--..--...-----------vkealdkardvnngslqlrnkevtwevlegeveke
HGL_H00000369218     KAVVD.L..N......GR....YF..GG...RVVKACF----ynldkf.............................
HGL_H00000347792     SVLDV.-..D......GM....KV..KG...RAVKIRP----kt.................................
HGL_H00000359965     KALY-.L..S......GY....RI..--...-----------rlgsstdkkdtgrlhvdfaqar.............
HGL_H00000395738     KALRV.L..H......GA....LW..KG...RPLSVRLA---rpkadpmarrrqq......................
HGL_H00000243563-2   AAREA.L..Q......GY....KIt.QN...NAMKISFA---k..................................
HGL_M00000102130     RALNI.L..T......G-....--..--...-----------k..................................
HGL_H00000260956-4   KFVET.-..-......--....--..--...-----------pgq................................
HGL_H00000387911     IAVNT.-..-......--....--..--...-----------sryaesyriqtyadyvgkkqg..............
HGL_H00000417839     AALAQ.-..P......QH....SL..RG...QRLRVRP----reqkafqs...........................
HGL_H00000300069     AAKNA.L..N......GI....RF..DPenpQTLRLEFA---kantkmakskl........................
HGL_H00000295119-2   KALNK.-..D......GR....IF..AE...-----------simigvkpcidksvm....................
HGL_H00000221419     RAKAS.L..N......GA....DI..YSgc.CTLKIEYA---kptrlnvfkndqdtwdytnpnls............
HGL_H00000246194-2   AAVLG.E..N......GR....VL..AG...QTLDINMA---gepkpnrp...........................
HGL_H00000318195     KALE-.L..T......GL....KV..FG...SEIKLE-----kpkgkdskk..........................
HGL_H00000383298-7   KIVIQ.-..K......YH....TV..NS...HNCEVRKA---vrkallkremasasssqrgrsgsgnfgggcgg...
HGL_N10007480        AAVVW.F..D......GK....DF..QG...SKFKVSL----vwkkppmdsmrggmpphegrgmppplcggpggpgg
HGL_N10009032        KDVDE.I..N......GK....EL..NG...KQIYVG-----qvpkk..............................
HGL_H00000266529-3   -----.-..-......--....--..--...-----------...................................
HGL_H00000260956-2   KAKDA.N..N......GS....--..--...-----------lqlrnkevtwevleggvekealkknrrrs......
HGL_H00000265271     KAISS.-..T......EA....VL..NN...RFIRVLW----hrenn..............................
HGL_H00000369887-3   RCIVH.L..H......QT....EL..HG...-----------...................................
HGL_H00000409667     SVLS-.L..N......GK....EL..LN...RTVTITL----ksp................................
HGL_H00000285814-2   MVAER.-..-......--....--..--...-----------kgwqvplhhpvypa.....................
HGL_H00000351723-1   KCMSI.F..N......KT....KW..KG...GTLQIQLA---ke.................................
HGL_H00000228284     -----.-..-......--....--..--...-----------...................................
HGL_H00000262519     ETVKN.L..H......LT....SV..MG...NIIHA------q..................................
HGL_R00000006780     -----.-..-......--....--..--...-----------k..................................
HGL_H00000343054     QLLQI.L..Q......SLhpplKI..DG...KTIGVDFA---ksarkd.............................
HGL_H00000384357     VAQH-.L..T......NT....VF..VD...RALIVVP----yae................................
HGL_H00000419446-2   QAIFM.F..N......SQ....LL..FD...RLM--------h..................................
HGL_H00000377694     -----.-..-......--....--..--...-----------avikntdtvpllikgksvkvsvpgkkk........
HGL_H00000264867     AALE-.-..N......GY....T-..--...-----------l..................................
HGL_H00000223073     RALRH.I..N......NNp...EV..FG...-----------phkrpivefsledrrklkmk...............
HGL_H00000387531     KAISS.-..T......EA....VL..NN...RFIKVYW----hregs..............................
HGL_H00000285814-3   IVAET.M..H......NY....LF..GE...RLLVLYPA---vkrynhk............................
HGL_H00000401946     KAQTA.L..H......MC....VL..GN...TTILAEFA---tdde...............................
HGL_N10012356        EAVKL.C..D......SY....EIr.PG...NHLGVCI----svannglfvgstlknktkenileefskvtglteal
HGL_H00000379654     GAVNS.L..H......RH....KI..GN...KKILVSLA---tga................................
HGL_H00000379144-1   KAQKS.L..H......MC....VL..GN...TTILAEFA---...................................
HGL_H00000334538     VAQH-.L..T......NT....VF..ID...RALIVVP----caeg...............................
HGL_N10012285        ASKEA.M..E......DG....EI..DR...NKVTSDWA---kpkvk..............................
HGL_H00000260956-6   KFVET.-..P......GQ....KY..KD...TDLLI------lfkedyfakkngerk....................
HGL_H00000316638     DAVKS.A..D......GY....KL..DKq..HTFRV------nlftd..............................
HGL_H00000379144-2   KAQKS.L..H......MC....VL..GN...TTILAEFA---...................................
HGL_H00000260956-5   -----.-..-......--....--..--...-----------ervipfkekvkealdkakdanngtlqlrnkevmwe
HGL_H00000358799     AAKHA.R..G......RL....VL..YD...RPLKIE-----...................................
HGL_H00000354021-1   KIVLQ.-..K......YH....TI..NG...YNAEVRKA---lsrqetqevqssrsgrggnfgfgdsggggrn....
HGL_H00000377694     SMYNF.L..K......RHpq..NI..GD...HVLICTL----ss.................................
HGL_H00000295470-4   KLLES.-..K......YH....QI..GS...AKCEIRVA---qpkevywqqrqqqkgrrgaaaggqggtrgrgq...
HGL_H00000420195-1   DALHN.L..D......RK....WI..CG...RQIEIQFA---qgdrktpnqmkak......................
HGL_N10011773        QAVIQ.-..-......--....--..--...-----------kshpvtshscavrkalcrqelasasssqrgrstsg
HGL_H00000262710     ATRTA.L..H......GV....KW..PQ...-----------snpkflcadyaeqde....................
HGL_H00000382239     RAISR.-..S......GG....FI..KD...SSVELF-----lsskaemqktiemkr....................
HGL_H00000260956-1   KFVET.L..G......QK....--..--...-----------ykdtdllilfkegyfakk.................
HGL_H00000344950     GIMNR.-..-......--....--..--...-----------hteikkkhswelevltgdheqrywqkilvdrqakl
HGL_H00000266022     GCMEA.N..Q......GTv...MI..HD...KEITLEY----...................................
HGL_H00000222956     -----.-..-......--....--..--...-----------a..................................
HGL_H00000284073     KVCEI.-..H......FH....EI..NN...KMVECKKA---qpkevmfppgtrgrarglpytmdafmlgmgmlgyp
HGL_H00000258729     QALDK.L..N......GF....QL..EN...FTLKVAY----ipdevaaqqtpsqqprgrrglgqrgssrqgs....
HGL_H00000418748     AALRR.H..K......G-....--..--...-----------mla................................
HGL_H00000364912     KALTA.S..K......GK....LF..FG...MQIEVT-----awigp..............................
HGL_H00000377694     SMVKF.Y..T......CF....PIsmDG...NQLSIS-----vape...............................
HGL_H00000294428     SAIQV.L..H......RS....SF..RG...EDLIVQL----qpt................................
HGL_H00000352668     LGMMR.-..T......GG....TI..KG...SKVTL------llssktemqnmielsr...................
HGL_H00000387531     AAAV-.-..H......GA....RF..KG...QDLKLAW----n..................................
HGL_H00000265866-1   AAMSK.-..D......KN....NM..QH...RYIELF-----lnstprgg...........................
HGL_H00000384160     AFQQK.F..H......RH....MI..DL...SHI--------nv.................................
HGL_H00000320401     KIVIQ.-..K......YH....TV..DD...HNCEVRKA---llkqemasaassqrgrsgsgkfggghgvdfg....
HGL_H00000321449-1   AAL--.-..-......--....--..--...-----------i..................................
HGL_H00000261723-1   KAV--.-..-......--....--..--...-----------s..................................
HGL_N10005061        RACQI.M..S......GM....KL..SG...R----------...................................
HGL_N10021697        -----.-..-......--....--..--...-----------...................................
HGL_H00000266022     RVVKI.L..Q......NLdppfSI..DG...KMVAVNLA---tgkrrnds...........................
HGL_H00000295119-1   KALSK.-..D......GR....IF..GE...SI---------migvkpcidksvm......................
HGL_H00000291688     LARK-.-..-......--....--..--...-----------k..................................
HGL_H00000330813     SFYTA.C..N......GR....QF..N-...-----------s..................................
HGL_H00000274849     RVAAS.L..H......NT....PM..G-...-----------ar.................................
HGL_N10021697        -----.-..-......--....--..--...-----------kng................................
HGL_H00000321449-2   -----.-..-......--....--..--...-----------ekp................................
HGL_H00000265753-2   -----.-..-......--....--..--...-----------s..................................
HGL_H00000379654     RAQKR.M..E......NE....DV..FG...NRIIVSF----tpknrelc...........................
HGL_H00000419242     IAKKK.M..D......EQ....SF..FG...GLLHVCYA---p..................................
HGL_H00000324827-3   KAMES.L..R......GM....KL..--...-----------mlkgddgkalacn......................
HGL_N10014876        KAHKG.T..N......IK....DI..KG...WTVAMDW----tlakdklndt.........................
HGL_H00000413303-2   KAMDE.M..N......GK....EI..EG...EEIEIVIA---kppdkkrkdrqaarqtsrntayedyy.........
HGL_H00000413303-2   EAVKL.C..D......SY....EI..--...-----------...................................
HGL_H00000220496     LAVQ-.-..N......EV....GL..VD...NPLKISW----legqprgm...........................
HGL_H00000415464-2   QAFKY.L..R......EEvk..TF..QG...KPIMAR-----ikai...............................
HGL_H00000293273     RAQQA.C..D......GR....PL..--...-----------a..................................
HGL_H00000243563-1   NVLCS.M..Q......EF....PF..YD...KPMCIQYA---ktnsdiivkmkgt......................
HGL_H00000345412-1   -----.-..-......--....--..--...-----------...................................
HGL_H00000324827-2   QAMSA.L..R......GM....KL..M-...-----------ykgedgkavacnik.....................
HGL_H00000299213     KAHEF.-..-......--....--..--...-----------m..................................
HGL_H00000331211     SV---.-..-......--....--..--...-----------trq................................
HGL_H00000326128     QAYKY.L..R......EEvk..TF..QG...KPIKAR-----i..................................
HGL_H00000314491     EICWN.L..Q......NI....R-..--...-----------lre................................
HGL_H00000260956-1   -----.-..-......--....--..--...-----------kekakealdkakdanngtlqlrnkeilegevekea
HGL_H00000312649     LSLQ-.-..N......G-....--..--...-----------talr...............................
HGL_H00000292672     KAQTA.L..H......EQk...TL..PGma.RPIQVKPA---dsesrg.............................
HGL_H00000287202     KAQSA.L..H......EQk...TLpgMN...RPIQVKPA---asegrge............................
HGL_H00000238688-2   YAVQH.-..E......NY....VI..DG...VKVYVQI----qnpkilqgdq.........................
HGL_H00000324827-1   QAMRA.L..Q......GV....KL..M-...-----------ykgkdg.............................
HGL_H00000221419     ETLGF.L..N......HY....QM..--...-----------k..................................


                                                                                                    
                                                                                                    
d1hl6a_                .............................................................................
HGL_H00000361949-2   .............................................................................
HGL_H00000255136     .............................................................................
HGL_H00000271628-1   .............................................................................
HGL_H00000361949-2   .............................................................................
HGL_H00000308012     desiddeklkeefssfgsisrakvmmevgqgkgfgvvcfssfeeatkavdemngrlvgskalhvtlg..........
HGL_H00000393248-2   .............................................................................
HGL_H00000255136     .............................................................................
HGL_H00000358089     .............................................................................
HGL_H00000408239     .............................................................................
HGL_H00000271628-2   .............................................................................
HGL_H00000352612     .............................................................................
HGL_H00000416340-1   dyfekygktetmevmedrqsgkkrgfafatfddhdtvdkivq...................................
HGL_H00000360886     .............................................................................
HGL_H00000408239     .............................................................................
HGL_H00000352162     iitsrilvdqvtgvsrgvgfirfdkrieaeeaikglngqkp....................................
HGL_H00000264073-2   .............................................................................
HGL_H00000389951     .............................................................................
HGL_H00000355089     .............................................................................
HGL_H00000287202     .............................................................................
HGL_H00000313007-2   .............................................................................
HGL_H00000308012     .............................................................................
HGL_H00000414859-2   .............................................................................
HGL_H00000313007-1   ddgidderlrkefspfgtitsaknseeatkavtemngrivatkplyvalaqrkeer.....................
HGL_H00000316042     .............................................................................
HGL_H00000414859-1   .............................................................................
HGL_H00000414859-3   .............................................................................
HGL_H00000412831     .............................................................................
HGL_H00000401336     vvsglppsgswqdlkdhmreagdvcyadvyrdgtgvvefvrkedmtyavrkldntkfrshe................
HGL_H00000373277     .............................................................................
HGL_H00000402734     .............................................................................
HGL_H00000343966     vvddrgratgkgfvefaakpparkalerc................................................
HGL_H00000264073-1   iinsrvlvdqttgss..............................................................
HGL_H00000362900     .............................................................................
HGL_H00000326806     .............................................................................
HGL_H00000229390-2   gswqdlkdhmreagdvcyadvqkdgmgmveylrkedmeyalrklddtkfrsheg.......................
HGL_H00000365950-3   .............................................................................
HGL_H00000416340-2   edteaynlrddfekygkieiievmedrqsgkksefa.........................................
HGL_H00000294172-1   .............................................................................
HGL_H00000253363     marlaegtglqippaaqqalqmsgslafgavaefsfvidlqtrlsqqteasalaaaasvqplatqcfqlsnmfnpqt
HGL_H00000349748-2   ivddrgrstgkgivefaskpaarkafer.................................................
HGL_H00000297071     .............................................................................
HGL_H00000276079     ivddrgrpsgkgivefsgkpaarkaldr.................................................
HGL_H00000294172-2   .............................................................................
HGL_H00000393937     .............................................................................
HGL_H00000376344     ntlfmgpnavadaiarkynatksqvfdhetkgsvavrvalgetqlvqevrrflldngvcldsfsqaaaersktvila
HGL_H00000402114     sifvtpsvvpysv................................................................
HGL_H00000276201-1   .............................................................................
HGL_H00000276201-2   .............................................................................
HGL_H00000359645-2   .............................................................................
HGL_H00000376290-4   .............................................................................
HGL_H00000376290-3   .............................................................................
HGL_H00000341826     .............................................................................
HGL_D0073543         .............................................................................
HGL_H00000383298-1   .............................................................................
HGL_H00000387996     .............................................................................
HGL_H00000309166-3   ecdivkd......................................................................
HGL_H00000364912     vvfdrlkgmalilyneieyaqaavketkgrkiggnkikvdfanrd................................
HGL_H00000393248-1   .............................................................................
HGL_H00000332444     .............................................................................
HGL_H00000376290-2   .............................................................................
HGL_H00000313007-1   .............................................................................
HGL_H00000313890-1   dhvkgdsfayiqyesldaaqaacakmrgfplggpdrrlrvdf...................................
HGL_H00000376290-5   .............................................................................
HGL_H00000359645-1   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000221448     .............................................................................
HGL_H00000266529-8   .............................................................................
HGL_H00000333001     .............................................................................
HGL_H00000364448     .............................................................................
HGL_H00000360886     .............................................................................
HGL_H00000281722     ivypsatdktknrgfafvkyeshrepamarrklipgtfqlwghtiqvdwadpe........................
HGL_H00000383298-6   kni..........................................................................
HGL_H00000352612     .............................................................................
HGL_H00000352956     .............................................................................
HGL_H00000293677     savhsptfcqlacgqdgqlkgfavleyetaemaeaaqqradglalgdshlrvsfcapg...................
HGL_H00000295470-1   .............................................................................
HGL_H00000322016     avagaavlgtlatpglvspaltlaqplgalpqavmaaqapgvitgvtparppipvtipsvgvvnpilaspptlglle
HGL_H00000402503     qalmqqqaalvaahsaylspmatmaavqmqhmaainangliatpitpssgtstppaiaatpvsaipaalgvngyspv
HGL_H00000233078     .............................................................................
HGL_H00000351108     .............................................................................
HGL_H00000253329     .............................................................................
HGL_H00000257552     .............................................................................
HGL_H00000341826     .............................................................................
HGL_H00000243563-3   kavqggaaapvvgavqgpvpgmppmtqaprimhhmpgqppympppgmipppglapgqmppgamppqqlmpgqmppaq
HGL_H00000416340-3   .............................................................................
HGL_H00000371212     asaadkmknrgfafveyeshraaamarrklmpgriqlwghqiavdwaep............................
HGL_H00000307863     tevlclmnmvlpeellddeeyeeivedvrdecskyglvksieiprpvdgvevpgcgkifveftsvfdcqkamqgltg
HGL_H00000361924     .............................................................................
HGL_H00000266529-6   .............................................................................
HGL_H00000331817     .............................................................................
HGL_H00000266529-7   .............................................................................
HGL_H00000365950-2   .............................................................................
HGL_H00000376290-1   .............................................................................
HGL_H00000313199-1   .............................................................................
HGL_H00000233078     .............................................................................
HGL_H00000383298-2   .............................................................................
HGL_H00000358799     idyrkgdswayiqyesldaahaawthmrgfplggpdrrlrvdfa.................................
HGL_H00000264073-2   .............................................................................
HGL_H00000354021-2   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000376117     .............................................................................
HGL_H00000416340-4   .............................................................................
HGL_H00000246071-1   ankkpgqgisttntqgnattnpqvpdyppnyilflnnlpeetnemmlsmlfnqfpgfkevrlvpgrhdiafvefend
HGL_H00000285814-6   .............................................................................
HGL_H00000383298-8   .............................................................................
HGL_H00000216727-1   .............................................................................
HGL_H00000313199-1   .............................................................................
HGL_H00000318195     d............................................................................
HGL_H00000362936     .............................................................................
HGL_H00000266529-9   .............................................................................
HGL_H00000320768     .............................................................................
HGL_H00000413035     .............................................................................
HGL_H00000386226     .............................................................................
HGL_H00000309117     .............................................................................
HGL_H00000266529-1   .............................................................................
HGL_H00000363105     .............................................................................
HGL_H00000223073     .............................................................................
HGL_M00000038256     ecdm.........................................................................
HGL_H00000354021-2   .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000383298-2   .............................................................................
HGL_H00000333170     .............................................................................
HGL_H00000351108     .............................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000363516     .............................................................................
HGL_H00000294428     srvhtpvfcqlaqdegccmgrfavveysspehaeearqaaaglsiggsatqvsfcapg...................
HGL_H00000354719     .............................................................................
HGL_H00000253108     .............................................................................
HGL_H00000313890-2   dhikgddfayiqfetldaaevacaemrgfpvggphrrlrvg....................................
HGL_H00000266529-10  .............................................................................
HGL_H00000346120     ekwhdsrrwqlav................................................................
HGL_H00000365950-5   .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000295470-1   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000290341     .............................................................................
HGL_H00000362820-2   .............................................................................
HGL_H00000309558     .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000365950-4   .............................................................................
HGL_H00000262633     .............................................................................
HGL_H00000420195-3   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000294904     .............................................................................
HGL_H00000265753-1   .............................................................................
HGL_H00000325905     .............................................................................
HGL_H00000364639-2   .............................................................................
HGL_H00000363105     .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000316950     .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000252542     .............................................................................
HGL_H00000243563-2   .............................................................................
HGL_H00000401371     .............................................................................
HGL_H00000354021-1   .............................................................................
HGL_H00000409315     .............................................................................
HGL_H00000313199-2   .............................................................................
HGL_H00000361927     .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000358089     .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000361949-1   l............................................................................
HGL_H00000228284     .............................................................................
HGL_H00000355089     .............................................................................
HGL_H00000362687     tteserlqaewhdsdwil...........................................................
HGL_H00000250863     .............................................................................
HGL_H00000365950-1   .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000322016     .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000414921     .............................................................................
HGL_N10016780        .............................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000310471-3   .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000352162     .............................................................................
HGL_H00000262031     .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000292672     .............................................................................
HGL_H00000218364     .............................................................................
HGL_H00000313199-2   .............................................................................
HGL_H00000338477-1   .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000216727-2   .............................................................................
HGL_H00000285814-5   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_H00000338477-1   .............................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000309166-1   .............................................................................
HGL_H00000327539     .............................................................................
HGL_H00000265866-2   .............................................................................
HGL_H00000265866-2   .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000265997     mdgsqpldprktifvggvprplravelamimdrlyggvcyagidtdpelkypkgagrvafsnqqsyiaaisa.....
HGL_H00000361557     .............................................................................
HGL_H00000311747     .............................................................................
HGL_H00000259997     mdgsqpldprktifvggvprplravelamimdrlyggvcyagidtdpelkypkgagrvafsnqqsyiaais......
HGL_H00000352668     .............................................................................
HGL_H00000229390-1   .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_N10004544        .............................................................................
HGL_H00000240185     .............................................................................
HGL_H00000285814-4   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000383298-7   .............................................................................
HGL_H00000265085     mdgsqpldprktifvggvprplravelamimdrlyggvcyagidtdpelkypkgagrvafsnqqsyiaaisa.....
HGL_H00000404545-2   .............................................................................
HGL_H00000396578-3   .............................................................................
HGL_M00000078602     .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000383298-4   .............................................................................
HGL_H00000338095-2   .............................................................................
HGL_H00000361927     .............................................................................
HGL_H00000366829     aeqklplgarmdsqalplggrelsqgllplpqpyqaqgvlasqalsqgsepssenandtiilrnlnphstmdsilga
HGL_H00000295470-3   .............................................................................
HGL_R00000023552     .............................................................................
HGL_H00000285814-1   .............................................................................
HGL_N10004520        .............................................................................
HGL_H00000246194-3   .............................................................................
HGL_H00000414859-2   .............................................................................
HGL_H00000402503     .............................................................................
HGL_H00000199814-2   .............................................................................
HGL_H00000325376     .............................................................................
HGL_H00000262031     awprsgdmgg...................................................................
HGL_H00000383298-5   .............................................................................
HGL_H00000390913     .............................................................................
HGL_H00000344950     .............................................................................
HGL_H00000334538     .............................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000310471-3   .............................................................................
HGL_H00000400142     aavewfdgrv...................................................................
HGL_H00000294904     pwhreg.......................................................................
HGL_N10006621        .............................................................................
HGL_H00000310471-2   .............................................................................
HGL_M00000111283     .............................................................................
HGL_H00000369887-2   .............................................................................
HGL_H00000362820-1   .............................................................................
HGL_H00000223073     .............................................................................
HGL_H00000383298-3   rgnfggggg....................................................................
HGL_H00000343054     .............................................................................
HGL_H00000364639-1   .............................................................................
HGL_H00000371212     .............................................................................
HGL_H00000389951     .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000379069     .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000315859     .............................................................................
HGL_H00000393937     .............................................................................
HGL_H00000414921     .............................................................................
HGL_H00000369887-1   .............................................................................
HGL_H00000361927     .............................................................................
HGL_N10001384        .............................................................................
HGL_H00000360425     .............................................................................
HGL_H00000240185     ggfgnqggfgnsr................................................................
HGL_H00000396578-2   .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000281722     .............................................................................
HGL_H00000338095-1   .............................................................................
HGL_H00000238688-1   .............................................................................
HGL_H00000352956     .............................................................................
HGL_H00000413532     .............................................................................
HGL_H00000310471-2   .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_N10024532        .............................................................................
HGL_H00000253363     .............................................................................
HGL_H00000348578     .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000338477-5   .............................................................................
HGL_H00000338477-4   .............................................................................
HGL_H00000310471-1   .............................................................................
HGL_H00000349428-2   .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000377738     .............................................................................
HGL_H00000338477-3   .............................................................................
HGL_H00000318195     .............................................................................
HGL_H00000307863     .............................................................................
HGL_H00000356154     .............................................................................
HGL_H00000338477-2   .............................................................................
HGL_H00000416340-3   .............................................................................
HGL_H00000414921     .............................................................................
HGL_H00000414859-1   .............................................................................
HGL_H00000295470-4   .............................................................................
HGL_M00000094956     .............................................................................
HGL_H00000286835     .............................................................................
HGL_H00000391432     .............................................................................
HGL_H00000266529-2   .............................................................................
HGL_H00000349428-1   .............................................................................
HGL_H00000295470-2   .............................................................................
HGL_N10021125        .............................................................................
HGL_H00000257552     .............................................................................
HGL_H00000265866-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000420270-2   .............................................................................
HGL_H00000254799     .............................................................................
HGL_H00000260956-8   .............................................................................
HGL_H00000311747     .............................................................................
HGL_H00000358479     .............................................................................
HGL_H00000339090     .............................................................................
HGL_H00000291552-1   .............................................................................
HGL_H00000358635-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000382296     .............................................................................
HGL_H00000376344     .............................................................................
HGL_H00000405738     .............................................................................
HGL_H00000396578-4   .............................................................................
HGL_H00000261723-3   .............................................................................
HGL_H00000261723-2   .............................................................................
HGL_H00000358532     .............................................................................
HGL_H00000409088     .............................................................................
HGL_H00000405738     .............................................................................
HGL_H00000267197     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000218364     .............................................................................
HGL_H00000312675     .............................................................................
HGL_H00000413303-1   .............................................................................
HGL_H00000254799     .............................................................................
HGL_H00000369887-4   .............................................................................
HGL_H00000260956-6   wkskg........................................................................
HGL_H00000246194-1   .............................................................................
HGL_H00000352668     .............................................................................
HGL_H00000260956-8   wkskg........................................................................
HGL_H00000309166-2   .............................................................................
HGL_H00000415054     .............................................................................
HGL_H00000413532     .............................................................................
HGL_H00000293677     .............................................................................
HGL_H00000390625     .............................................................................
HGL_H00000418748     .............................................................................
HGL_H00000221419     .............................................................................
HGL_H00000262563     .............................................................................
HGL_N10014200        .............................................................................
HGL_H00000260956-2   .............................................................................
HGL_H00000386226     .............................................................................
HGL_H00000260956-4   wkskg........................................................................
HGL_H00000377738     .............................................................................
HGL_H00000382239     .............................................................................
HGL_H00000396578-1   .............................................................................
HGL_H00000358635-2   .............................................................................
HGL_H00000199814-1   .......