SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Metalloproteases ("zincins"), catalytic domain alignments in Homo sapiens 76_38

These alignments are sequences aligned to the 0043540 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  vcttpgcviaaarilqnmdpttepcddfyqfacggwlrrhvipetnsrysifdvlrdelevilkavlenstakdrpaveka
ENSP00000484606  vcttpgcviaaarilqnmdpttepcddfyqfacggwlrrhvipetnsrysifdvlrdelevilkavlenstakdrpaveka
ENSP00000405088  vclseacvsvtssilssmdptvdpchdffsyacggwikanpvpdghsrwgtfsnlwehnqaiikhllenstasvseaerka
ENSP00000349581  vclseacvsvtssilssmdptvdpchdffsyacggwikanpvpdghsrwgtfsnlwehnqaiikhllenstasvseaerka
ENSP00000264205  vclseacvsvtssilssmdptvdpchdffsyacggwikanpvpdghsrwgtfsnlwehnqaiikhllenstasvseaerka
ENSP00000364028  vclseacvsvtssilssmdptvdpchdffsyacggwikanpvpdghsrwgtfsnlwehnqaiikhllenstasvseaerka
ENSP00000353679  ickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdelevvlkdvlqepktedivavqka
ENSP00000417079  ickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdelevvlkdvlqepktedivavqka
ENSP00000418525  ickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdelevvlkdvlqepktedivavqka
ENSP00000419653  ickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdelevvlkdvlqepktedivavqka
ENSP00000420389  ickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdelevvlkdvlqepktedivavqka
ENSP00000478173  ickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdelevvlkdvlqepktedivavqka
ENSP00000352052  tclteacirvagkilesldrgvspcedfyqfscggwirrnplpdgrsrwntfnslwdqnqailkhllenttfnssseaeqk
ENSP00000385846  tclteacirvagkilesldrgvspcedfyqfscggwirrnplpdgrsrwntfnslwdqnqailkhllenttfnssseaeqk
ENSP00000350066  tclteacirvagkilesldrgvspcedfyqfscggwirrnplpdgrsrwntfnslwdqnqailkhllenttfnssseaeqk
ENSP00000384223  tclteacirvagkilesldrgvspcedfyqfscggwirrnplpdgrsrwntfnslwdqnqailkhllenttfnssseaeqk
ENSP00000290863  eaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqarkfdvnqlqnttikriikkvqd
ENSP00000387760  eaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqarkfdvnqlqnttikriikkvqd
ENSP00000464149  eaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqarkfdvnqlqnttikriikkvqd
ENSP00000397593  eaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqarkfdvnqlqnttikriikkvqd
ENSP00000290866  eaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqarkfdvnqlqnttikriikkvqd
ENSP00000388439  vclseacvsvtssilssmdptvdpchdffsyacggwikanpvpdghsrwgtfsnlwehnqaiikhllenstasvseaerka
ENSP00000397593  aqsynssaeqvlfqsvaaswahdtnitaenarrqeeaallsqefaeawgqkakelyepiwqnftdpqlrriigavrtlgsa
ENSP00000290866  aqsynssaeqvlfqsvaaswahdtnitaenarrqeeaallsqefaeawgqkakelyepiwqnftdpqlrriigavrtlgsa
ENSP00000302051  afaraarflaanldasidpcqdfysfacggwlrrhaipddkltygtiaaigeqneerlrrllarpgggpggaaqrkvraff
ENSP00000386333  afaraarflaanldasidpcqdfysfacggwlrrhaipddkltygtiaaigeqneerlrrllarpgggpggaaqrkvraff
ENSP00000368682  yclkpecieaaaailskvnlsvdpcdnffrfacdgwisnnpipedmpsygvypwlrhnvdlklkelleksisrrrdteaiq
ENSP00000398444  tclteacirvagkilesldrgvspcedfyqfscggwirrnplpdgrsrwntfnslwdqnqailkhllenttfnssseaeqk
ENSP00000252519  eeqaktfldkfnheaedlfyqsslaswnyntniteenvqnmnnagdkwsaflkeqstlaqmyplqeiqnltvklqlqalqq
ENSP00000389326  eeqaktfldkfnheaedlfyqsslaswnyntniteenvqnmnnagdkwsaflkeqstlaqmyplqeiqnltvklqlqalqq
ENSP00000392247  eaeaskfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqarkfdvnqlqnttikriikkvqd
ENSP00000304467  rwdlsaqqieertrelieqtkrvydqvgtqefedvsyestlkaladvevtytvqrnildfpqhvspskdirtasteadkkl
ENSP00000370372  mssytvagrnvlrwdlspeqiktrteelivqtkqvydavgmlgieevtyenclqaladvevkyivertmldfpqhvssdke
ENSP00000422492  nstakatvpqeerhdvialyhrmgleelqsqfglkgfnwtlfiqtvlssvkikllpdeevvvygipylqnleniidtysar
ENSP00000482173  nstakatvpqeerhdvialyhrmgleelqsqfglkgfnwtlfiqtvlssvkikllpdeevvvygipylqnleniidtysar
ENSP00000423214  ldfpqhvssdkevraasteadkrlsrfdiemsmrgdiferivhlqetcdlgkikpearryleksikmgkrnglhlpeqvqn
ENSP00000467226  qekvqkdslrpeaarylerliklgrrnglhlpretqenikrikkklsllcidfnknlnedttflpftlqelgglpedflns
ENSP00000347409  pcetsvcldlrdhylasgntsvapctdffsfacgraketnnsfqelatknknrlrrilevqnswhpgsgeekafqfynscm
ENSP00000477793  pcetsvcldlrdhylasgntsvapctdffsfacgraketnnsfqelatknknrlrrilevqnswhpgsgeekafqfynscm
ENSP00000425477  vcttpgcviaaarilqnmdpttepcddfyqfacggwlrrhvipetnsrysifdvlrdelevilkavlenstakdrpaveka
ENSP00000410926  gssppcrhhvpsdtevinkvhlkanhvvkrdvdehlriktvydksveellpekknlvknklfpqaisylektfqvrrpagt
ENSP00000418324  vinkvhlkanhvvkrdvdehlriktvydksveellpekknlvknklfpqaisylektfqvrrpagtillsrqcatnqylrk
ENSP00000371607  apegfhiaqekalrktellvdracstppgpqtvlifdelsdslcrvadladfvkiahpepafreaaeeacrsigtmvekln
ENSP00000328829  gssppcrhhvpsdtevinkvhlkanhvvkrdvdehlriktvydksveellpekknlvknklfpqaisylektfqvrrpagt
ENSP00000328611  vinkvhlkanhvvkrdvdehlriktvydksveellpekknlvknklfpqaisylektfqvrrpagtillsrqcatnqylrk
ENSP00000462909  dmettysvatvchpngsclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyvelinqaarlngyvdagdswr
ENSP00000427417  eentiilqqllplrtkvakllgysthadfvlemntakstsrvtaflddlsqklkplgeaerefilnlkkkeckdrgfeydg
ENSP00000433287  rskdgvcvrvytpvgkaeqgkfalevaaktlpfykdyfnvpyplpkidliaiadfaagamenwglvtyretallidpknsc
ENSP00000320324  rskdgvcvrvytpvgkaeqgkfalevaaktlpfykdyfnvpyplpkidliaiadfaagamenwglvtyretallidpknsc
ENSP00000265162  snsgkpltiyvqpeqkhtaeyaanitksvfdyfeeyfamnyslpkldkiaipdfgtgamenwglityretnllydpkesas
ENSP00000300060  ngvliriwarpsaiaaghgdyalnvtgpilnffaghydtpyplpksdqiglpdfnagamenwglvtyrensllfdplsss.
ENSP00000406304  tksgvkvsvyavpdkinqadyaldaavtlle..................................................
ENSP00000296754  tksgvkvsvyavpdkinqadyaldaavtlle..................................................
ENSP00000231368  dvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssm
ENSP00000379117  dvngtlvsiyavpekigqvhyalettvklleffqnyfeiqyplkkldlvaipdfeagamenwglltfreetllydsntssm
ENSP00000426959  glsfeqmtdahvwnksvtlytvkdkatgevlgqfyldlypregkynhaacfglqpgcllpdgsrmmavaalvv........
ENSP00000228740  gprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllag..........
ENSP00000421175  tssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssa
ENSP00000400376  tssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssa
ENSP00000369235  pkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssasdkl
ENSP00000261180  ttksgvvvrlyarpdairrgsgdyalhitkrliefyedyfkvpyslpkldllavpkhpyaamenwglsifveqrilldpsv
ENSP00000395051  qigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllag........
ENSP00000449958  qigprtlvwsekeqveksayefsetesmlkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllag........
ENSP00000421849  tssgvkvsiyaspdkrnqthyalqaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssa
ENSP00000465855  egkyghaacfglqpgclrqdgsrqiaiaamvanftkptadapsll....................................
ENSP00000462280  qtkeeaallsqefaeawgqkakelyepiwqnftdpqlrriigavrtlgsanlplakrqqynallsnmsriystakvclpnk
ENSP00000423604  tergkeiriwarkdaiangsadfalnitgpifsfledlfnisyslpktdi...............................
ENSP00000378899  tergkeiriwarkdaiangsadfalnitgpifsfledlfnisyslpktdi...............................
ENSP00000350541  tergkeiriwarkdaiangsadfalnitgpifsfledlfnisyslpktdi...............................
ENSP00000309968  pmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntswdnagfkgygiqieqirilkspqevkpgekhynm
ENSP00000412683  gilqptlydpdfpqslnyggigtiighelthgyddwggqydrsgnl...................................
ENSP00000393699  hekyieyylvldngefkrynenqdeirkrvfemanyvnmlykklnthvalvgmeiwtdkdkikitpnasftlenfskwrgs
ENSP00000265769  hekyieyylvldngefkrynenqdeirkrvfemanyvnmlykklnthvalvgmeiwtdkdkikitpnasftlenfskwrgs
ENSP00000295640  gprsrvwaepclidaakeeyngvieeflatgeklfgpyvwgrydllfmppsfpfggmenpcltfvtpcllagdr.......
ENSP00000357665  atkyvelvivadnrefqrqgkdlekvkqrlieianhvdkfyrplnirivlvgvevwndmdkcsvsqdpftslhefldwrkm
ENSP00000357668  atkyvelvivadnrefqrqgkdlekvkqrlieianhvdkfyrplnirivlvgvevwndmdkcsvsqdpftslhefldwrkm
ENSP00000389602  gprsrvwaepclidaakeeyngvieeflatgeklfgpyvwgrydllfmppsfpfggmenpcltfvtpcllagdr.......
ENSP00000418737  tryvelfivvdkerydmmgrnqtavreemillanyldsmyimlnirivlvgleiwtngnlinivggagdvlgnfvqwrekf
ENSP00000369249  tryvelfivvdkerydmmgrnqtavreemillanyldsmyimlnirivlvgleiwtngnlinivggagdvlgnfvqwrekf
ENSP00000418437  tryvelfivvdkerydmmgrnqtavreemillanyldsmyimlnirivlvgleiwtngnlinivggagdvlgnfvqwrekf
ENSP00000419446  tryvelfivvdkerydmmgrnqtavreemillanyldsmyimlnirivlvgleiwtngnlinivggagdvlgnfvqwrekf
ENSP00000453043  etryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsqdrfhvspdpsvtlenlltwqarq
ENSP00000453855  etryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsqdrfhvspdpsvtlenlltwqarq
ENSP00000453302  etryvelyvvvdnaefqmlgseaavrhrvlevvnhvdklyqklnfrvvlvgleiwnsqdrfhvspdpsvtlenlltwqarq
ENSP00000322550  rkylelyivadhtlfltrhrnlnhtkqrllevanyvdqllrtldiqvaltglevwterdrsrvtqdanatlwaflqwrrgl
ENSP00000348912  rkylelyivadhtlfltrhrnlnhtkqrllevanyvdqllrtldiqvaltglevwterdrsrvtqdanatlwaflqwrrgl
ENSP00000369190  rkylelyivadhtlfltrhrnlnhtkqrllevanyvdqllrtldiqvaltglevwterdrsrvtqdanatlwaflqwrrgl
ENSP00000270357  igprsrvwaepcllptatsklsgaveqwlsaaerlygpymwgrydivflppsfpivamenpcltfiissilesdeflvidv
ENSP00000422937  tsrteriwpg.......................................................................
ENSP00000257527  nsmkyvelylvadylefqknrrdqdatkhklieianyvdkfyrslnirialvglevwthgnmcevsenpystlwsflswrr
ENSP00000428654  nsmkyvelylvadylefqknrrdqdatkhklieianyvdkfyrslnirialvglevwthgnmcevsenpystlwsflswrr
ENSP00000061240  srteriwpgg.......................................................................
ENSP00000426082  srteriwpgg.......................................................................
ENSP00000373472  skekwvetlvvadakmveyhgqpqvesyvltimnmvaglfhdpsignpihitivrlvlledeeedlkithhadntlksfck
ENSP00000175238  ekyvelfivaddtvyrrnghphnklrnriwgmvnfvnmiyktlnihvtlvgieiwthedkielysniettllrfsfwqeki
ENSP00000370166  ekyvelfivaddtvyrrnghphnklrnriwgmvnfvnmiyktlnihvtlvgieiwthedkielysniettllrfsfwqeki
ENSP00000466653  heegasawhedvrl...................................................................
ENSP00000350630  rteriwpgg........................................................................
ENSP00000428665  rpervwpdgvipfvig.................................................................
ENSP00000430406  rpervwpdgvipfvig.................................................................
ENSP00000306121  rpervwpdgvipfvig.................................................................
ENSP00000428332  rpervwpdgvipfvig.................................................................
ENSP00000482883  vf...............................................................................
ENSP00000299855  rtfpg............................................................................
ENSP00000370443  sierfvetlvvadkmmvgyhgrkdiehyilsvmnivaklyrdsslgnvvniivarlivltedqpnleinhhadksldsfck
ENSP00000305714  rpervwpdgvipfvig.................................................................
ENSP00000260302  vf...............................................................................
ENSP00000339672  vf...............................................................................
ENSP00000356255  prydllfmppsfpfggmenpcltfvtpcllagdr...............................................
ENSP00000322788  te...............................................................................
ENSP00000435639  menwglvtyretallidpknscsssrqwvalvvghelahqwfgnlvtmewwthlwlneg......................
ENSP00000418735  syprfvevlvvadnrmvsyhgenlqhyiltlmsivasiykdpsignlinivivnlivihneqdgpsisfnaqttlknfcqw
ENSP00000260228  rlf..............................................................................
ENSP00000458585  emp..............................................................................
ENSP00000270328  sreryvetlvvadkmmvayhgrrdveqyvlaimnivaklfqdsslgstvnilvtrlilltedqptleithhagksldsfck
ENSP00000471851  sreryvetlvvadkmmvayhgrrdveqyvlaimnivaklfqdsslgstvnilvtrlilltedqptleithhagksldsfck
ENSP00000476000  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000353892  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000271836  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000357397  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000432347  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000434227  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000432927  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000349436  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000403843  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000348227  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000352226  tktvelvivadhseaqkyrdfqhllnrtlevallldtffrplnvrvalvgleawtqrdlveispnpavtlenflhwrrahl
ENSP00000246186  q................................................................................
ENSP00000344847  skerwvetlvvadtkmieyhgsenvesyiltimnmvtglfhnpsignaihivvvrlilleeeeqglkivhhaektlssfck
ENSP00000422554  skerwvetlvvadtkmieyhgsenvesyiltimnmvtglfhnpsignaihivvvrlilleeeeqglkivhhaektlssfck
ENSP00000401004  lt...............................................................................
ENSP00000427573  qthyalqaslklldfyekyfdiyyplskldliaipdfapgamenwglityretsllfdpktssasdkl.............
ENSP00000279441  fpgm.............................................................................
ENSP00000260227  lf...............................................................................
ENSP00000236826  lt...............................................................................
ENSP00000300762  pgr..............................................................................
ENSP00000369753  pgr..............................................................................
ENSP00000378911  sypryieimvtadakvvsahgsnlqnyiltlmsivatiykdpsignlihivvvklvmihreeegpvinfdgattlknfcsw
ENSP00000448341  sypryieimvtadakvvsahgsnlqnyiltlmsivatiykdpsignlihivvvklvmihreeegpvinfdgattlknfcsw
ENSP00000484172  sypryieimvtadakvvsahgsnlqnyiltlmsivatiykdpsignlihivvvklvmihreeegpvinfdgattlknfcsw
ENSP00000374071  sypryieimvtadakvvsahgsnlqnyiltlmsivatiykdpsignlihivvvklvmihreeegpvinfdgattlknfcsw
ENSP00000256389  hqrfvelvvvvdnirylfsqsnattvqhevfnvvnivdsfyhplevdviltgidiwtasnplptsgdldnvledfsiwkny
ENSP00000286614  rya..............................................................................
ENSP00000308208  q................................................................................
ENSP00000465895  dapsllqh.........................................................................
ENSP00000421631  eelnvetlvvvdkkmmqnhghenittyvltilnmvsalfkdgtiggniniaivglilledeqpglvishhadhtlssfcqw
ENSP00000419217  syprfvevlvvadnrmvsyhgenlqhyiltlmsivasiykdpsignlinivivnlivihneqdgpsisfnaqttlknfcqw
ENSP00000282849  nvetlvvadkkmvekhgkgnvttyiltvmnmvsglfkdgtigsdinvvvvslilleqepggllinhhadqslnsfcqwqsa
ENSP00000260229  ytl..............................................................................
ENSP00000215743  rp...............................................................................
ENSP00000483349  rp...............................................................................
ENSP00000274181  eelnvetlvvvdkkmmqnhghenittyvltilnmvsalfkdgtiggniniaivglilledeqpglvishhadhtlssfcqw
ENSP00000299164  sipryvetlvvadesmvkfhgadlehylltllataarlyrhpsilnpinivvvkvlllrdrdsgpkvtgnaaltlrnfcaw
ENSP00000284987  rarqvelllvadasmarlygrglqhylltlasianrlyshasienhirlavvkvvvlgdkdkslevsknaattlknfckwq
ENSP00000474385  hawflelvvvvnhdffiysqsniskvqedvflvvnivdsmykqlgtyiiligieiwnqgnvfpmts...............
ENSP00000284984  sshryvetmlvadqsmaefhgsglkhylltlfsvaarlykhpsirnsvslvvvkilvihdeqkgpevtsnaaltlrnfcnw
ENSP00000435966  menwglvtyssfiaiyp................................................................
ENSP00000219271  gr...............................................................................
ENSP00000369238  plylemhivvdktlydywgsdsmivtnkvieivglansmft........................................
ENSP00000484817  plylemhivvdktlydywgsdsmivtnkvieivglansmft........................................
ENSP00000407614  vieeflatgeklfgpyvwgrydllfmppsfpfggmenpcltfvtpcllagdr.............................
ENSP00000269202  ekyrwphtipyvledslemnakgvilnaferyrlktcidfkpwagetnyisvfkgsgcwssvgnrrvgkqelsiga.....
ENSP00000463280  ekyrwphtipyvledslemnakgvilnaferyrlktcidfkpwagetnyisvfkgsgcwssvgnrrvgkqelsiga.....
ENSP00000260408  ekntcqlyiqtdhlffkyygtreaviaqisshvkaidtiyqttdfsgirnisfmvkririnttadekdptnpfrfpnigve
ENSP00000356975  srfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilgsgeegpqvgpsaaqtlrsfcawqr
ENSP00000430400  mvnfvnmiyktlnihvtlvgieiwthedkielysniettllrfsfwqekilktrkdfdhvvllsgkwlyshvqgisypggm
ENSP00000420101  ickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdelevvlkdvlqepktedivav...
ENSP00000265707  qyleiyiivekalydymgsemmavtqkivqviglvntmftqfklt....................................
ENSP00000482348  qyleiyiivekalydymgsemmavtqkivqviglvntmftqfklt....................................
ENSP00000352177  hfriveivvvidnylyiryerndsklledlyvivnivdsildvigvkvllfgleiwtnknlivvddvrksvhlyckwksen
ENSP00000384229  hfriveivvvidnylyiryerndsklledlyvivnivdsildvigvkvllfgleiwtnknlivvddvrksvhlyckwksen
ENSP00000414544  hfriveivvvidnylyiryerndsklledlyvivnivdsildvigvkvllfgleiwtnknlivvddvrksvhlyckwksen
ENSP00000423517  hfriveivvvidnylyiryerndsklledlyvivnivdsildvigvkvllfgleiwtnknlivvddvrksvhlyckwksen
ENSP00000478469  hfriveivvvidnylyiryerndsklledlyvivnivdsildvigvkvllfgleiwtnknlivvddvrksvhlyckwksen
ENSP00000484862  hfriveivvvidnylyiryerndsklledlyvivnivdsildvigvkvllfgleiwtnknlivvddvrksvhlyckwksen
ENSP00000268070  tsehtvetlvvadadmvqyhgaeaaqrfiltvmnmvynmfqhqslgikiniqvtklvllrqrpaklsighhgerslesfch
ENSP00000428993  raqkyidlylvldnafyknynenltlirsfvfdvmnllnv.........................................
ENSP00000256412  raqkyidlylvldnafyknynenltlirsfvfdvmnllnv.........................................
ENSP00000429352  kyiemhvivekqlynhmgsdttvvaqkvfqligltnaifvsfnitiilsslelwidenkiattgeanellht.........
ENSP00000478636  kyiemhvivekqlynhmgsdttvvaqkvfqligltnaifvsfnitiilsslelwidenkiattgeanellht.........
ENSP00000483607  kyiemhvivekqlynhmgsdttvvaqkvfqligltnaifvsfnitiilsslelwidenkiattgeanellht.........
ENSP00000265708  kyiemhvivekqlynhmgsdttvvaqkvfqligltnaifvsfnitiilsslelwidenkiattgeanellht.........
ENSP00000482337  kyiemhvivekqlynhmgsdttvvaqkvfqligltnaifvsfnitiilsslelwidenkiattgeanellht.........
ENSP00000257359  searfvetllvadasmaafygadlqnhiltlmsvaariykhpsiknsinlmvvkvlivedekwgpevsdnggltlrnfcnw
ENSP00000408070  nrqk.............................................................................
ENSP00000274487  pqeynietvvvadpamvsyhgadaarrfiltilnmvfnlfqhkslsvqvnlrviklillhetppelyighhgekmlesfck
ENSP00000362304  ysievllvvddsvvrfhgkehvqnyvltlmnivdeiyhdeslgvhinialvrlimvgyrqslsliergnpsrsleqvcrwa
ENSP00000464428  rtqgdfdpgakfhipssvpyiryfvsfiiqfqfhealcqaaghtgpl..................................
ENSP00000343674  tsnkwpmggsgvvevpf................................................................
ENSP00000274609  ynievllgvddsvvqfhgkehvqkylltlmnivneiyhdeslgahinvvlvriillsygksmslieignpsqslenvcrwa
ENSP00000465537  tkyvelivindhqlfeqmrq.............................................................
ENSP00000295903  syprfvevlvvadnrmvsyhgenlqhyiltlmsidgpsisfnaqttlknfcqwqhsknspggihhdtavlltrqdicrahd
ENSP00000230588  rwtfpipyiladnlglnakga............................................................
ENSP00000443773  tkyvelivindhqlfeqmrq.............................................................
ENSP00000480465  rwtfpipyiladnlglnakga............................................................
ENSP00000251582  ynievllgvddsvvqfhgkehvqkylltlmnivneiyhdeslgahinvvlvriillsygksmslieignpsqslenvcrwa
ENSP00000200557  tkyvelivindhqlfeqmrq.............................................................
ENSP00000362303  ysievllvvddsvvrfhgkehvqnyvltlmnivdeiyhdeslgvhinialvrlimvgyrqslsliergnpsrsleqvcrwa
ENSP00000264377  mkylelmivndhktykkhrsshahtnnfaksvvnlvdsiykeqlntrvvlvavetwtekdqidit................
ENSP00000363536  mkylelmivndhktykkhrsshahtnnfaksvvnlvdsiykeqlntrvvlvavetwtekdqidit................
ENSP00000378638  fsgthverdfveapsqmlenwvweqepllrmsrhyrtgsavprellekliesrqantglfnlrqivlakvdqalhtqtdad
ENSP00000286657  ynievllgvddsvvrfhgkehvqnylltlmnivneiyhdeslgvhinvvlvrmimlgyaksisliergnpsrslenvcrwa
ENSP00000480055  ynievllgvddsvvrfhgkehvqnylltlmnivneiyhdeslgvhinvvlvrmimlgyaksisliergnpsrslenvcrwa
ENSP00000337816  klrdaikvmqrfaglpetgrmdpgtva......................................................
ENSP00000464786  fsgthverdfveapsqmlenwvweqepllrmsrhyrtgsavprellekliesrqantglfnlrqivlakvdqalhtqtdad
ENSP00000381261  tkyielmivndhlmfkkhrlsvvhtntyaksvvnmadliykdqlkt...................................
ENSP00000381260  tkyielmivndhlmfkkhrlsvvhtntyaksvvnmadliykdqlkt...................................
ENSP00000381262  tkyielmivndhlmfkkhrlsvvhtntyaksvvnmadliykdqlkt...................................
ENSP00000265727  tkyielmivndhlmfkkhrlsvvhtntyaksvvnmadliykdqlkt...................................
ENSP00000381267  tkyielmivndhlmfkkhrlsvvhtntyaksvvnmadliykdqlkt...................................
ENSP00000343854  ynhmgsdttvvaqkvfqligltnaifvsfnitiilsslelwidenkiattgeanellhtflrwkt................
ENSP00000484999  ynhmgsdttvvaqkvfqligltnaifvsfnitiilsslelwidenkiattgeanellhtflrwkt................
ENSP00000358407  hpkylelillfdqsryrfvnnnlsqvihdailltgimdty.........................................
ENSP00000313437  r................................................................................
ENSP00000353767  t................................................................................
ENSP00000479124  rfak.............................................................................
ENSP00000483299  rfak.............................................................................
ENSP00000348308  r................................................................................
ENSP00000482367  r................................................................................
ENSP00000403404  sshryvetmlvadqsmaefhgsglkhylltlfsvaarlykhpsirnsvslvvvkilvihdeqkgpevtsnaaltlrnfcnw
ENSP00000401854  iphrvfapvcltgacqetllrlippclsaahsvlgahpfsrldvlivpanfpslgmasphimflsqsiltggnhlcgtr..
ENSP00000481051  rfak.............................................................................
ENSP00000473853  rfak.............................................................................
ENSP00000484430  rfak.............................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  t................................................................................
ENSP00000364464  iphrvfapvcltgacqetllrlippclsaahsvlgahpfsrldvlivpanfpslgmasphimflsqsiltggnhlcgtr..
ENSP00000347927  lhlellvavgpdvfqahqedteryvltnlnigaellrdpslgaqfrvhlvkmviltepegapnitanltssllsvcgwsqt
ENSP00000360997  lhlellvavgpdvfqahqedteryvltnlnigaellrdpslgaqfrvhlvkmviltepegapnitanltssllsvcgwsqt
ENSP00000429557  mlvadqsmaefhgsglkhylltlfsvaarlykhpsirnsvslvvvkilvihdeqkgpevtsnaaltlrnfcnwqkqhnpps
ENSP00000361405  l................................................................................
ENSP00000360979  lhlellvavgpdvfqahqedteryvltnlnigaellrdpslgaqfrvhlvkmviltepegapnitanltssllsvcgwsqt
ENSP00000435274  lhlellvavgpdvfqahqedteryvltnlnigaellrdpslgaqfrvhlvkmviltepegapnitanltssllsvcgwsqt
ENSP00000346941  rpervwpdgvipfvig.................................................................
ENSP00000428249  rpervwpdgvipfvig.................................................................
ENSP00000348997  lhlellvavgpdvfqahqedteryvltnlnigaellrdpslgaqfrvhlvkmviltepegapnitanltssllsvcgwsqt
ENSP00000369195  yleiyiivekalmftqfklt.............................................................
ENSP00000446979  lla..............................................................................
ENSP00000329614  lvirnlqrvipirraplrskieivrrilgvqkfdlgiicvdnkniqhinriyrdrnvptdvlsfpfhehlkagefpqpd..
ENSP00000380805  lvirnlqrvipirraplrskieivrrilgvqkfdlgiicvdnkniqhinriyrdrnvptdvlsfpfhehlkagefpqpd..
ENSP00000380813  lvirnlqrvipirraplrskieivrrilgvqkfdlgiicvdnkniqhinriyrdrnvptdvlsfpfhehlkagefpqpd..
ENSP00000219070  dldqnti..........................................................................
ENSP00000444143  ldqnti...........................................................................
ENSP00000461421  ldqnti...........................................................................
ENSP00000394237  dldqnti..........................................................................
ENSP00000436733  menwglvtyretallidpknscsssrqwvalvvghelahqwfgnlvtmew...............................
ENSP00000442104  y................................................................................
ENSP00000456096  nf...............................................................................
ENSP00000357798  s................................................................................
ENSP00000429422  fplylemhivvdktlydywgsdsmivtnkvieivglans..........................................
ENSP00000483377  fplylemhivvdktlydywgsdsmivtnkvieivglans..........................................
ENSP00000405978  fplylemhivvdktlydywgsdsmivtnkvieivglans..........................................
ENSP00000420011  pcetsvcldlrdhylasgntsvapctdffsfacgraketnnsfqelatknknrlrrilevqnswhpgsge...........
ENSP00000453952  gdrdfddgvlglawvgapsgssggiceksklysdgkkkslntgiitvqnygshvp..........................
ENSP00000417595  ickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdelevvlkd................
ENSP00000423780  pr...............................................................................
ENSP00000435305  lhlellvavgpdvfqahqedteryvltnlnigaellrdpslgaqfrvhlvkmviltepegapnitanltssllsvcgwsqt
ENSP00000340675  lvirnlqrvipirraplrskieivrrilgvqkfdlgiicvdnkniqhinriyrdrnvptdvlsfp................
ENSP00000426265  vttpdeitsvfdgisyskgssilrmledwikpenfqkgcqmylek....................................
ENSP00000465545  rwdlsaqqieertrelieqtkrvydqvgtqefedvsyestlkaladv..................................
ENSP00000482854  tm...............................................................................
ENSP00000277198  iphrvfapvcltgacqetllrlippclsaahsvlgahpfsrldvlivp.................................
ENSP00000457949  nf...............................................................................
ENSP00000484562  qvpkaptstrfsdairafqwvsqlpvsgvldratlrqmtrprcgvtdtnsyaawaerisdlfarhrtkmrrkk........
ENSP00000431856  mdptvdpchdffsyacggwikanpvpdghsrwgtfs.............................................
ENSP00000462599  eaeaskfveey......................................................................
ENSP00000405867  al...............................................................................
ENSP00000457084  h................................................................................
ENSP00000431065  sshryvetmlvadqsmaefhgsglkhylltlfsvaarlykhpsirnsvslvvvkilvihdeqkgpe...............
ENSP00000419889  pcetsvcldlrdhylasgntsvapctdffsfacgraketnn........................................
ENSP00000461938  vwcgsyrpefaiqsiktdvh.............................................................
ENSP00000427418  tseiqelfdiftyskgasmarmlscflnehlfvsalksylktfsysnaeqddlwrhfqmaiddqstvilp...........
ENSP00000427500  tseiqelfdiftyskgasmarmlscflnehlfvsalksylktfsysnaeqddlwrhfqmaiddqstvilp...........
ENSP00000422492  vcttpgcviaaarilqnmdpttepcddfyqfacggwlrrhvi.......................................
ENSP00000482173  vcttpgcviaaarilqnmdpttepcddfyqfacggwlrrhvi.......................................
ENSP00000427574  tseiqelfdiftyskgasmarmlscflnehlfvsalksylktfsysnaeqddlwrhfqmaiddqstvilp...........
ENSP00000456518  d................................................................................
ENSP00000418886  pcetsvcldlrdhylasgntsvapctdffsfacgraketnn........................................
ENSP00000441485  fpgm.............................................................................
ENSP00000380808  f................................................................................
ENSP00000391334  tkyielmivndhlmfkkhrlsvvhtntyaksvvnmadliykd.......................................
ENSP00000391268  tkyvelvivadnrefqrqgkdlekvkqrlieianhvdkfy.........................................
ENSP00000418791  ickssdciksaarliqnmdattepctdffkyacg...............................................
ENSP00000463673  qagssrpwqevlkdmvgldaldaqpllkyfqpvtqwlqe..........................................
ENSP00000402171  iphrvfapvcltgacqetllrlippclsaahsvlgahpfsrldvlivpanfpslgmarpskdktghtsdsg..........
ENSP00000369182  isleslavilaqllslsmgityddinkc.....................................................
ENSP00000480574  isleslavilaqllslsmgityddinkc.....................................................
ENSP00000297979  iphrvfapvcltgacqetllrlippclsaahsvlgahpfsrldvlivpanfpslgmarpskdktghtsdsg..........
ENSP00000447822  fsqtplmstyylawaicnftyretttksgvvgaalirmlan........................................
ENSP00000436633  vclseacvsvtssilssmdptvdp.........................................................
ENSP00000453545  ndlwlnegfasyveylgadyaeptwnlkd....................................................
ENSP00000386625  r................................................................................
ENSP00000356974  srfvetlvvaddkmaafhgaglkrylltvmaaaakafkhpsirnpvslvvtrlvilgsg......................
ENSP00000352976  yikwltgyckayfyglrvkllepvpvsvtrcsfrvnenthnlqihagdilkflkkkkpedafcvvgitmidlyprdswnfv
ENSP00000376481  yikwltgyckayfyglrvkllepvpvsvtrcsfrvnenthnlqihagdilkflkkkkpedafcvvgitmidlyprdswnfv
ENSP00000463012  yikwltgyckayfyglrvkllepvpvsvtrcsfrvnenthnlqihagdilkflkkkkpedafcvvgitmidlyprdswnfv
ENSP00000464133  yikwltgyckayfyglrvkllepvpvsvtrcsfrvnenthnlqihagdilkflkkkkpedafcvvgitmidlyprdswnfv
ENSP00000464635  yikwltgyckayfyglrvkllepvpvsvtrcsfrvnenthnlqihagdilkflkkkkpedafcvvgitmidlyprdswnfv
ENSP00000483162  yikwltgyckayfyglrvkllepvpvsvtrcsfrvnenthnlqihagdilkflkkkkpedafcvvgitmidlyprdswnfv
ENSP00000441710  mk...............................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  hevthfclpqllpllkhttsylhevfefyeeiltcrypyscfktvfideayvevaayasmsifstnllhsamiidetpltr
ENSP00000423748  tsrteri..........................................................................
ENSP00000352831  pedafcvvgitmidlyprdswnfvfgqasltdgvgifsfarygsdfysmhykgk...........................
ENSP00000330658  hknptvtreqvdfqhhqlaeafkqynisweldvlevsnsslrrrlilancdiskigdencdpecnhtltghdggdcrhlrh
ENSP00000446989  q................................................................................
ENSP00000367945  r................................................................................
ENSP00000482664  r................................................................................
ENSP00000380915  rpervwpdgvipfvig.................................................................
ENSP00000427950  rpervwpdgvipfvig.................................................................
ENSP00000428798  rpervwpdgvipfvig.................................................................
ENSP00000430977  rpervwpdgvipfvig.................................................................
ENSP00000390872  inkvhlkanhvvkrdvdehlriktvydksveellpekknlvknklfpqaisylektfqvrrpagtillsr...........
ENSP00000484600  trkylelyivadhtlfltrhrnlnhtkqrlle.................................................
ENSP00000418728  pmkntckllvvadhrfyrymgrgeestttnylielidr...........................................
ENSP00000462038  ekyrwphtipyvledslemnakg..........................................................
ENSP00000356634  hflniyfassvred...................................................................
ENSP00000380806  v................................................................................
ENSP00000420542  ickssdciksaarliqnmd..............................................................
ENSP00000356633  ecnnmlndfddgdccdpqvadvrktcfdpdspkraymsvkelkealqlnsthflniyfassv...................
ENSP00000430832  pqllpllkhttsylhevfefyeeiltcrypyscfktvfideayvevaayasmsifrsdewvlkgisgyiyglwmkktfgvn
ENSP00000462995  faqsyns..........................................................................
ENSP00000356633  pivseeqirlqhealneafsryniswqlsvhqvhnstlrhrvvlvncepskigndhcdpecehpltgydggdcrlqgrcys
ENSP00000356634  pivseeqirlqhealneafsryniswqlsvhqvhnstlrhrvvlvncepskigndhcdpecehpltgydggdcrlqgrcys
ENSP00000425758  tssgvkvsiyaspd...................................................................
ENSP00000469559  sreryvetlvvadkmmvay..............................................................
ENSP00000469901  sreryvetlvvadkmmvay..............................................................
ENSP00000414661  llgedspvsklqayvekykftsvvaqdllds..................................................
ENSP00000411451  detyfsflrkfvhtfhgqlilsqd.........................................................
ENSP00000462002  eaeaskfveeydrtsqvvwn.............................................................
ENSP00000308149  vqcck............................................................................


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  rtlyrscmnqsviekrgsqplldilevvggwpvamdrwnetvglewelerqlalmnsqfnrrvlidlfiwnddqnssrhii
ENSP00000484606  rtlyrscmnqsviekrgsqplldilevvggwpvamdrwnetvglewelerqlalmnsqfnrrvlidlfiwnddqnssrhii
ENSP00000405088  qvyyracmnetrieelrakplmelierlggwnitgpwakdnfqdtlqvvtahyrtspffsvyvsadsknsnsnviqvdqsg
ENSP00000349581  qvyyracmnetrieelrakplmelierlggwnitgpwakdnfqdtlqvvtahyrtspffsvyvsadsknsnsnviqvdqsg
ENSP00000264205  qvyyracmnetrieelrakplmelierlggwnitgpwakdnfqdtlqvvtahyrtspffsvyvsadsknsnsnviqvdqsg
ENSP00000364028  qvyyracmnetrieelrakplmelierlggwnitgpwakdnfqdtlqvvtahyrtspffsvyvsadsknsnsnviqvdqsg
ENSP00000353679  kalyrscinesaidsrggepllkllpdiygwpvatenweqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvi
ENSP00000417079  kalyrscinesaidsrggepllkllpdiygwpvatenweqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvi
ENSP00000418525  kalyrscinesaidsrggepllkllpdiygwpvatenweqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvi
ENSP00000419653  kalyrscinesaidsrggepllkllpdiygwpvatenweqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvi
ENSP00000420389  kalyrscinesaidsrggepllkllpdiygwpvatenweqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvi
ENSP00000478173  kalyrscinesaidsrggepllkllpdiygwpvatenweqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvi
ENSP00000352052  tqrfylsclqverieelgaqplrdliekiggwnitgpwdqdnfmevlkavagtyratpfftvyisadskssnsnviqvdqs
ENSP00000385846  tqrfylsclqverieelgaqplrdliekiggwnitgpwdqdnfmevlkavagtyratpfftvyisadskssnsnviqvdqs
ENSP00000350066  tqrfylsclqverieelgaqplrdliekiggwnitgpwdqdnfmevlkavagtyratpfftvyisadskssnsnviqvdqs
ENSP00000384223  tqrfylsclqverieelgaqplrdliekiggwnitgpwdqdnfmevlkavagtyratpfftvyisadskssnsnviqvdqs
ENSP00000290863  leraalpaqeleeynkilldmettysvatvchpngsclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyve
ENSP00000387760  leraalpaqeleeynkilldmettysvatvchpngsclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyve
ENSP00000464149  leraalpaqeleeynkilldmettysvatvchpngsclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyve
ENSP00000397593  leraalpaqeleeynkilldmettysvatvchpngsclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyve
ENSP00000290866  leraalpaqeleeynkilldmettysvatvchpngsclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyve
ENSP00000388439  qvyyracmnetrieelrakplmelierlggwnitgpwakdnfqdtlqvvtahyrtspffsvyvsadsknsnsnviqvdqsg
ENSP00000397593  nlplakrqqynallsnmsriystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftals
ENSP00000290866  nlplakrqqynallsnmsriystakvclpnktatcwsldpdltnilassrsyamllfawegwhnaagiplkplyedftals
ENSP00000302051  rscldmreierlgprpmleviedcggwdlggaeerpgvaarwdlnrllykaqgvysaaalfsltvslddrnssryviridq
ENSP00000386333  rscldmreierlgprpmleviedcggwdlggaeerpgvaarwdlnrllykaqgvysaaalfsltvslddrnssryviridq
ENSP00000368682  kakilysscmnekaiekadakpllhilrhspfrwpvlesnigpegvwserkfsllqtlatfrgqysnsvfirlyvspddka
ENSP00000398444  tqrfylsclqverieelgaqplrdliekiggwnitgpwdqdnfmevlkavagtyratpfftvyisadskssnsnviqvdqs
ENSP00000252519  ngssvlsedkskrlntilntmstiystgkvcnpdnpqeclllepglneimansldynerlwaweswrsevgkqlrplyeey
ENSP00000389326  ngssvlsedkskrlntilntmstiystgkvcnpdnpqeclllepglneimansldynerlwaweswrsevgkqlrplyeey
ENSP00000392247  leraalpaqeleeynkilldmettysvatvchpngsclqlepdltnvmatsrkyedllwawegwrdkagrailqfypkyve
ENSP00000304467  sefdvemsmredvyqrivwlqekvqkdslrpeaarylerliklgrrnglhlpretqenikrikkklsllcidfnknlnedt
ENSP00000370372  vraasteadkrlsrfdiemsmrgdiferivhlqetcdlgkikpearryleksikmgkrnglhlpeqvqneiksmkkrmsel
ENSP00000422492  tiqnylvwrlvldrigslsqrfkdtrvnyrkalfgtmveevrwrecvgyvnsnmenavgslyvreafpgdsksmvrelidk
ENSP00000482173  tiqnylvwrlvldrigslsqrfkdtrvnyrkalfgtmveevrwrecvgyvnsnmenavgslyvreafpgdsksmvrelidk
ENSP00000423214  eiksmkkrmselcidfnknlneddtflvfskaelgalpddfidslektdddkykitlkyphyfpvmkkccipetrrrmema
ENSP00000467226  lekmedgklkvtlkyphyfpllkkchvpetrrkveeafncrckeencailkelvtlraqksrllgfhthadyvlemnmakt
ENSP00000347409  dtlaieaagtgplrqvieelggwrisgkwtslnfnrtlrllmsqyghfpffraylgphpasphtpviqidqpefdvplkqd
ENSP00000477793  dtlaieaagtgplrqvieelggwrisgkwtslnfnrtlrllmsqyghfpffraylgphpasphtpviqidqpefdvplkqd
ENSP00000425477  rtlyrscmnqsviekrgsqplldilevvggwpvamdrwnetvglewelerqlalmnsqfnrrvlidlfiwnddqnssrhii
ENSP00000410926  illsrqcatnqylrkendphryctgecaahtkcgpvivpeehlqqcrvyrggkwphgavgvpdqegisdadfvlyvgalat
ENSP00000418324  endphryctgecaahtkcgpvivpeehlqqcrvyrggkwphgavgvpdqegisdadfvlyvgalatercsheniisyaayc
ENSP00000371607  tnvdlyqslqklladkklvdsldpetrrvaelfmfdfeisgihldkekrkravdlnvkildlsstflmgtnfpnkiekhll
ENSP00000328829  illsrqcatnqylrkendphryctgecaahtkcgpvivpeehlqqcrvyrggkwphgavgvpdqegisdadfvlyvgalat
ENSP00000328611  endphryctgecaahtkcgpvivpeehlqqcrvyrggkwphgavgvpdqegisdadfvlyvgalatercsheniisyaayc
ENSP00000462909  smyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmwaqtwsniydlvvp..........
ENSP00000427417  kin..............................................................................
ENSP00000433287  sssrqwvalvvghelahqwfgnlvtme......................................................
ENSP00000320324  sssrqwvalvvghelahqwfgnlvtme......................................................
ENSP00000265162  snqq.............................................................................
ENSP00000300060  .................................................................................
ENSP00000406304  .................................................................................
ENSP00000296754  .................................................................................
ENSP00000231368  adrklvtkiiahelahqwfgnlvtmkwwndlwlnegfatfmeyf.....................................
ENSP00000379117  adrklvtkiiahelahqwfgnlvtmkwwndlwlnegfatfmeyf.....................................
ENSP00000426959  .................................................................................
ENSP00000228740  .................................................................................
ENSP00000421175  sdklw............................................................................
ENSP00000400376  sdklw............................................................................
ENSP00000369235  wv...............................................................................
ENSP00000261180  ssisy............................................................................
ENSP00000395051  .................................................................................
ENSP00000449958  .................................................................................
ENSP00000421849  sdklw............................................................................
ENSP00000465855  .................................................................................
ENSP00000462280  tatcwsldpdltn....................................................................
ENSP00000423604  .................................................................................
ENSP00000378899  .................................................................................
ENSP00000350541  .................................................................................
ENSP00000309968  aksypneekdawdvkmlleqfsfdiaeeaskvclahlftyqdfdmgtlglayvgspranshggvcp...............
ENSP00000412683  .................................................................................
ENSP00000393699  vlsrrkrhdiaqlitatel..............................................................
ENSP00000265769  vlsrrkrhdiaqlitatel..............................................................
ENSP00000295640  .................................................................................
ENSP00000357665  kllprkshdnaqlvsgvyfqgttigm.......................................................
ENSP00000357668  kllprkshdnaqlvsgvyfqgttigm.......................................................
ENSP00000389602  .................................................................................
ENSP00000418737  litrrrhdsaqlvlk..................................................................
ENSP00000369249  litrrrhdsaqlvlk..................................................................
ENSP00000418437  litrrrhdsaqlvlk..................................................................
ENSP00000419446  litrrrhdsaqlvlk..................................................................
ENSP00000453043  rtrrhlhdnvqlitg..................................................................
ENSP00000453855  rtrrhlhdnvqlitg..................................................................
ENSP00000453302  rtrrhlhdnvqlitg..................................................................
ENSP00000322550  waqrphdsaqlltgrafqgatvglapvegmcraessggvstdhsel...................................
ENSP00000348912  waqrphdsaqlltgrafqgatvglapvegmcraessggvstdhsel...................................
ENSP00000369190  waqrphdsaqlltgrafqgatvglapvegmcraessggvstdhsel...................................
ENSP00000270357  ihevahs..........................................................................
ENSP00000422937  .................................................................................
ENSP00000257527  kllaqkyhdnaqlitgmsfhgttiglaplmamcsvy.............................................
ENSP00000428654  kllaqkyhdnaqlitgmsfhgttiglaplmamcsvy.............................................
ENSP00000061240  .................................................................................
ENSP00000426082  .................................................................................
ENSP00000373472  wqksinmkgdahplhhdtailltrkdlcaamnrpcetlglshvagmcqph...............................
ENSP00000175238  lktrkdfdhvvllsgkwlyshvqgisypggmclpyystsiikdllpdtniianr...........................
ENSP00000370166  lktrkdfdhvvllsgkwlyshvqgisypggmclpyystsiikdllpdtniianr...........................
ENSP00000466653  .................................................................................
ENSP00000350630  .................................................................................
ENSP00000428665  .................................................................................
ENSP00000430406  .................................................................................
ENSP00000306121  .................................................................................
ENSP00000428332  .................................................................................
ENSP00000482883  .................................................................................
ENSP00000299855  .................................................................................
ENSP00000370443  wqksilshqsdgntipengiahh..........................................................
ENSP00000305714  .................................................................................
ENSP00000260302  .................................................................................
ENSP00000339672  .................................................................................
ENSP00000356255  .................................................................................
ENSP00000322788  .................................................................................
ENSP00000435639  .................................................................................
ENSP00000418735  qhsknspggihhdtavlltrqdicrahdkcdtlglaelgticdpyr...................................
ENSP00000260228  .................................................................................
ENSP00000458585  .................................................................................
ENSP00000270328  wqksivnhsghgnaipengvan...........................................................
ENSP00000471851  wqksivnhsghgnaipengvan...........................................................
ENSP00000476000  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000353892  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000271836  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000357397  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000432347  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000434227  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000432927  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000349436  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000403843  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000348227  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000352226  lprlphdsaqlvtgtsfsgp.............................................................
ENSP00000246186  .................................................................................
ENSP00000344847  wqksinpksdlnpvhhdvavlltrkdicagfnrpcetlglshlsgmcq.................................
ENSP00000422554  wqksinpksdlnpvhhdvavlltrkdicagfnrpcetlglshlsgmcq.................................
ENSP00000401004  .................................................................................
ENSP00000427573  .................................................................................
ENSP00000279441  .................................................................................
ENSP00000260227  .................................................................................
ENSP00000236826  .................................................................................
ENSP00000300762  .................................................................................
ENSP00000369753  .................................................................................
ENSP00000378911  qqtqndlddvhpshhdtavlitrydicsskekcnmlglsylgticdplqscfin...........................
ENSP00000448341  qqtqndlddvhpshhdtavlitredicsskekcnmlglsylgticdplqscfin...........................
ENSP00000484172  qqtqndlddvhpshhdtavlitredicsskekcnmlglsylgticdplqscfin...........................
ENSP00000374071  qqtqndlddvhpshhdtavlitredicsskekcnmlglsylgticdplqscfin...........................
ENSP00000256389  nlnnrlqhdvahlfi..................................................................
ENSP00000286614  .................................................................................
ENSP00000308208  .................................................................................
ENSP00000465895  .................................................................................
ENSP00000421631  qsglmgkdgtrh.....................................................................
ENSP00000419217  qhsknspggihhdtavlltrqdicrahdkcdtlglaelgticdpyr...................................
ENSP00000282849  ligkngkrh........................................................................
ENSP00000260229  .................................................................................
ENSP00000215743  .................................................................................
ENSP00000483349  .................................................................................
ENSP00000274181  qsglmgkdgtrh.....................................................................
ENSP00000299164  qkklnkvsdkhpeywdtailftrqdlcgattcdtlgmadvgtmcdpkrscsvieddglps.....................
ENSP00000284987  hqhnqlgddheehydaailftredlcghhscdtlgmadvgt........................................
ENSP00000474385  .................................................................................
ENSP00000284984  qkqhnppsdrdaehydtailftrqdlcgsqtcdtlgmadvgtvcdpsrscsviedd.........................
ENSP00000435966  .................................................................................
ENSP00000219271  .................................................................................
ENSP00000369238  .................................................................................
ENSP00000484817  .................................................................................
ENSP00000407614  .................................................................................
ENSP00000269202  .................................................................................
ENSP00000463280  .................................................................................
ENSP00000260408  kflelnseqnhddyclayvftdrdfddgvlglawvgapsgssggiceksklysdgkkkslntgiitvqnygsh........
ENSP00000356975  glntpedsdpdhfdtailftrqdlcgvstcdtlgmadvgtvcdparscaive.............................
ENSP00000430400  clpyystsiikdllpdtniianr..........................................................
ENSP00000420101  .................................................................................
ENSP00000265707  .................................................................................
ENSP00000482348  .................................................................................
ENSP00000352177  itprmqhdtshlfttlglrglsgigafrgmctp................................................
ENSP00000384229  itprmqhdtshlfttlglrglsgigafrgmctp................................................
ENSP00000414544  itprmqhdtshlfttlglrglsgigafrgmctp................................................
ENSP00000423517  itprmqhdtshlfttlglrglsgigafrgmctp................................................
ENSP00000478469  itprmqhdtshlfttlglrglsgigafrgmctp................................................
ENSP00000484862  itprmqhdtshlfttlglrglsgigafrgmctp................................................
ENSP00000268070  wqneeyggarylgnnqvpggkddpplvdaa...................................................
ENSP00000428993  .................................................................................
ENSP00000256412  .................................................................................
ENSP00000429352  .................................................................................
ENSP00000478636  .................................................................................
ENSP00000483607  .................................................................................
ENSP00000265708  .................................................................................
ENSP00000482337  .................................................................................
ENSP00000257359  qrrfnqpsdrhpehydtailltrqnfcgqeglcdtlgvadigticdpnkscsvie..........................
ENSP00000408070  .................................................................................
ENSP00000274487  wqheefgkkndihlemstnwgedm.........................................................
ENSP00000362304  hsqqrqdpshaehhdhvvfltrqdfgpsgmqgyapvtgmchplrsca..................................
ENSP00000464428  .................................................................................
ENSP00000343674  .................................................................................
ENSP00000274609  ylqqkpdtghdeyhdhaifltrqdfg.......................................................
ENSP00000465537  .................................................................................
ENSP00000295903  kcdtlglaelgticdpyr...............................................................
ENSP00000230588  .................................................................................
ENSP00000443773  .................................................................................
ENSP00000480465  .................................................................................
ENSP00000251582  ylqqkpdtghdeyhdhaifltrqdfg.......................................................
ENSP00000200557  .................................................................................
ENSP00000362303  hsqqrqdpshaehhdhvvfltrqdfgpsgyapvtgmchplrscaln...................................
ENSP00000264377  .................................................................................
ENSP00000363536  .................................................................................
ENSP00000378638  paeeyarlcqeilgvpatpgtnmpatfghlaggydaqyygylwsevysm................................
ENSP00000286657  sqqqrsdlnhsehhdhaifltrqdfg.......................................................
ENSP00000480055  sqqqrsdlnhsehhdhaifltrqdfg.......................................................
ENSP00000337816  .................................................................................
ENSP00000464786  paeeyarlcqeilgvpatpgtnmpatfg.....................................................
ENSP00000381261  .................................................................................
ENSP00000381260  .................................................................................
ENSP00000381262  .................................................................................
ENSP00000265727  .................................................................................
ENSP00000381267  .................................................................................
ENSP00000343854  .................................................................................
ENSP00000484999  .................................................................................
ENSP00000358407  .................................................................................
ENSP00000313437  .................................................................................
ENSP00000353767  .................................................................................
ENSP00000479124  .................................................................................
ENSP00000483299  .................................................................................
ENSP00000348308  .................................................................................
ENSP00000482367  .................................................................................
ENSP00000403404  qkqhnppsdrdaehydtailftrqdlcgsqtcdtlgmadvgtvcdpsrscsviedd.........................
ENSP00000401854  .................................................................................
ENSP00000481051  .................................................................................
ENSP00000473853  .................................................................................
ENSP00000484430  .................................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  .................................................................................
ENSP00000364464  .................................................................................
ENSP00000347927  inpeddtdpghadlvlyitrfdlelpdgnrqvrgvtqlgga........................................
ENSP00000360997  inpeddtdpghadlvlyitrfdlelpdgnrqvrgvtqlgga........................................
ENSP00000429557  drdaehydtailftrqdlcgsqtcdtlgmadvgtvcdpsrscsviedd.................................
ENSP00000361405  .................................................................................
ENSP00000360979  inpeddtdpghadlvlyitrfdlelpdgnrqvrgvtqlgga........................................
ENSP00000435274  inpeddtdpghadlvlyitrfdlelpdgnrqvrgvtqlgga........................................
ENSP00000346941  .................................................................................
ENSP00000428249  .................................................................................
ENSP00000348997  inpeddtdpghadlvlyitrfdlelpdgnrqvrgvtqlgga........................................
ENSP00000369195  .................................................................................
ENSP00000446979  .................................................................................
ENSP00000329614  .................................................................................
ENSP00000380805  .................................................................................
ENSP00000380813  .................................................................................
ENSP00000219070  .................................................................................
ENSP00000444143  .................................................................................
ENSP00000461421  .................................................................................
ENSP00000394237  .................................................................................
ENSP00000436733  .................................................................................
ENSP00000442104  .................................................................................
ENSP00000456096  .................................................................................
ENSP00000357798  .................................................................................
ENSP00000429422  .................................................................................
ENSP00000483377  .................................................................................
ENSP00000405978  .................................................................................
ENSP00000420011  .................................................................................
ENSP00000453952  .................................................................................
ENSP00000417595  .................................................................................
ENSP00000423780  .................................................................................
ENSP00000435305  inpeddtdpghadlvlyitrfdlelpdgnrqvrgvtql...........................................
ENSP00000340675  .................................................................................
ENSP00000426265  .................................................................................
ENSP00000465545  .................................................................................
ENSP00000482854  .................................................................................
ENSP00000277198  .................................................................................
ENSP00000457949  .................................................................................
ENSP00000484562  .................................................................................
ENSP00000431856  .................................................................................
ENSP00000462599  .................................................................................
ENSP00000405867  .................................................................................
ENSP00000457084  .................................................................................
ENSP00000431065  .................................................................................
ENSP00000419889  .................................................................................
ENSP00000461938  .................................................................................
ENSP00000427418  .................................................................................
ENSP00000427500  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000427574  .................................................................................
ENSP00000456518  .................................................................................
ENSP00000418886  .................................................................................
ENSP00000441485  .................................................................................
ENSP00000380808  .................................................................................
ENSP00000391334  .................................................................................
ENSP00000391268  .................................................................................
ENSP00000418791  .................................................................................
ENSP00000463673  .................................................................................
ENSP00000402171  .................................................................................
ENSP00000369182  .................................................................................
ENSP00000480574  .................................................................................
ENSP00000297979  .................................................................................
ENSP00000447822  .................................................................................
ENSP00000436633  .................................................................................
ENSP00000453545  .................................................................................
ENSP00000386625  .................................................................................
ENSP00000356974  .................................................................................
ENSP00000352976  fgqasltdgvgifsfarygsdfysmhykgk...................................................
ENSP00000376481  fgqasltdgvgifsfarygsdfysmhykgk...................................................
ENSP00000463012  fgqasltdgvgifsfarygsdfysmhykgk...................................................
ENSP00000464133  fgqasltdgvgifsfarygsdfysmhykgk...................................................
ENSP00000464635  fgqasltdgvgifsfarygsdfysmhykgk...................................................
ENSP00000483162  fgqasltdgvgifsfarygsdfysmhykgk...................................................
ENSP00000441710  .................................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  rclaqslaqqffgcfisrmswsdewvlkgisgyiyglwmk.........................................
ENSP00000423748  .................................................................................
ENSP00000352831  .................................................................................
ENSP00000330658  pafvkkqhngvcdmdcnyerfnfdggeccdpeitnvtqtcfdpdsphrayldvnelknilkldgsthlniffakss.....
ENSP00000446989  .................................................................................
ENSP00000367945  .................................................................................
ENSP00000482664  .................................................................................
ENSP00000380915  .................................................................................
ENSP00000427950  .................................................................................
ENSP00000428798  .................................................................................
ENSP00000430977  .................................................................................
ENSP00000390872  .................................................................................
ENSP00000484600  .................................................................................
ENSP00000418728  .................................................................................
ENSP00000462038  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000380806  .................................................................................
ENSP00000420542  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000430832  eyrhwikeeldkivayelktggvllhpifgggk................................................
ENSP00000462995  .................................................................................
ENSP00000356633  wnrrdglchvecnnmlndfddgdccdpqvadvrktcfdpdspkraymsvkelkealqlnsthflniyfassvr........
ENSP00000356634  wnrrdglchvecnnmlndfddgdccdpqvadvrktcfdpdspkraymsvkelkealqlnsthflniyfassvr........
ENSP00000425758  .................................................................................
ENSP00000469559  .................................................................................
ENSP00000469901  .................................................................................
ENSP00000414661  .................................................................................
ENSP00000411451  .................................................................................
ENSP00000462002  .................................................................................
ENSP00000308149  .................................................................................


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  yidqptlgmpsreyyfnggsnrkvreaylqfmvsvatllredanlprdsclvqedmvqvleletqlakatvpqeerhdvia
ENSP00000484606  yidqptlgmpsreyyfnggsnrkvreaylqfmvsvatllredanlprdsclvqedmvqvleletqlakatvpqeerhdvia
ENSP00000405088  lglpsrdyylnktenekvltgylnymvqlgkllgggdeeairpqmqqildfetalanitipqekrrdeeliyhkvtaaelq
ENSP00000349581  lglpsrdyylnktenekvltgylnymvqlgkllgggdeeairpqmqqildfetalanitipqekrrdeeliyhkvtaaelq
ENSP00000264205  lglpsrdyylnktenekvltgylnymvqlgkllgggdeeairpqmqqildfetalanitipqekrrdeeliyhkvtaaelq
ENSP00000364028  lglpsrdyylnktenekvltgylnymvqlgkllgggdeeairpqmqqildfetalanitipqekrrdeeliyhkvtaaelq
ENSP00000353679  hidqprlglpsrdyyectgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrndpml
ENSP00000417079  hidqprlglpsrdyyectgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrndpml
ENSP00000418525  hidqprlglpsrdyyectgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrndpml
ENSP00000419653  hidqprlglpsrdyyectgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrndpml
ENSP00000420389  hidqprlglpsrdyyectgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrndpml
ENSP00000478173  hidqprlglpsrdyyectgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrndpml
ENSP00000352052  glflpsrdyylnrtanekvltayldymeelgmllggrptstreqmqqvleleiqlanitvpqdqrrdeekiyhkmsiselq
ENSP00000385846  glflpsrdyylnrtanekvltayldymeelgmllggrptstreqmqqvleleiqlanitvpqdqrrdeekiyhkmsiselq
ENSP00000350066  glflpsrdyylnrtanekvltayldymeelgmllggrptstreqmqqvleleiqlanitvpqdqrrdeekiyhkmsiselq
ENSP00000384223  glflpsrdyylnrtanekvltayldymeelgmllggrptstreqmqqvleleiqlanitvpqdqrrdeekiyhkmsiselq
ENSP00000290863  linqaarlngyvdagdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmwaqtw
ENSP00000387760  linqaarlngyvdagdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmwaqtw
ENSP00000464149  linqaarlngyvdagdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmwaqtw
ENSP00000397593  linqaarlngyvdagdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmwaqtw
ENSP00000290866  linqaarlngyvdagdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmwaqtw
ENSP00000388439  lglpsrdyylnktenekvltgylnymvqlgkllgggdeeairpqmqqildfetalanitipqekrrdeeliyhkvtaaelq
ENSP00000397593  neaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryinlrgpipahllgdmwaqswen
ENSP00000290866  neaykqdgftdtgaywrswynsptfeddlehlyqqleplylnlhafvrralhrrygdryinlrgpipahllgdmwaqswen
ENSP00000302051  dgltlpertlylaqdedsekilaayrvfmervlsllgadaveqkaqeilqveqqlanitvsehddlrrdvssmynkvtlgq
ENSP00000386333  dgltlpertlylaqdedsekilaayrvfmervlsllgadaveqkaqeilqveqqlanitvsehddlrrdvssmynkvtlgq
ENSP00000368682  snehilkldqatlslavredyldnsteaksyrdalykfmvdtavllganssraehdmksvlrleikiaeimiphenrtsea
ENSP00000398444  glflpsrdyylnrtanekvltayldymeelgmllggrptstreqmqqvleleiqlanitvpqdqrrdeekiyhkmsiselq
ENSP00000252519  vvlknemaranhyedygdywrgdyevngvdgydysrgqliedvehtfeeikplyehlhayvraklmnaypsyispigclpa
ENSP00000389326  vvlknemaranhyedygdywrgdyevngvdgydysrgqliedvehtfeeikplyehlhayvraklmnaypsyispigclpa
ENSP00000392247  linqaarlngyvdagdswrsmyetpsleqdlerlfqelqplylnlhayvrralhrhygaqhinlegpipahllgnmwaqtw
ENSP00000304467  tflpftlqelgglpedflnslekmedgklkvtlkyphyfpllkkchvpetrrkveeafncrckeencailkelvtlraqks
ENSP00000370372  cidfnknlneddtflvfskaelgalpddfidslektdddkykitlkyphyfpvmkkccipetrrrmemafntrckeentii
ENSP00000422492  vrtvfvetldelgwmdeeskkkaqekamsireqighpdyileemnrrldeeysnlnfsedlyfenslqnlkvgaqrslrkl
ENSP00000482173  vrtvfvetldelgwmdeeskkkaqekamsireqighpdyileemnrrldeeysnlnfsedlyfenslqnlkvgaqrslrkl
ENSP00000423214  fntrckeentiilqqllplrtkvakllgysthadfvlemntakstsrvtaflddlsqklkplgeaerefilnlkkkeckdr
ENSP00000467226  sqtvatfldelaqklkplgeqeravilelkraecerrglpfdgrirawdmryymnqveetrycvdqnllkeyfpvqvvthg
ENSP00000347409  qeqkiyaqifreyltylnqlgtllggdpskvqehsslsisitsrlfqflrpleqrraqgklfqmvtidqlkemapaidwls
ENSP00000477793  qeqkiyaqifreyltylnqlgtllggdpskvqehsslsisitsrlfqflrpleqrraqgklfqmvtidqlkemapaidwls
ENSP00000425477  yidqptl..........................................................................
ENSP00000410926  ercsheniisyaaycqqeanmdrpiagyanlcpnmistqp.........................................
ENSP00000418324  qqeanmdrpiagyanlcpnmistqp........................................................
ENSP00000371607  pehirrnftsagdhiiidglhaespddlvreaaykiflypnagqlkcleellssrdllaklvgystfshralqgtiaknpe
ENSP00000328829  ercsheniisyaaycqqeanmdrpiagyanlcpnmistqp.........................................
ENSP00000328611  qqeanmdrpiagyanlcpnmistqp........................................................
ENSP00000462909  .................................................................................
ENSP00000427417  .................................................................................
ENSP00000433287  .................................................................................
ENSP00000320324  .................................................................................
ENSP00000265162  .................................................................................
ENSP00000300060  .................................................................................
ENSP00000406304  .................................................................................
ENSP00000296754  .................................................................................
ENSP00000231368  .................................................................................
ENSP00000379117  .................................................................................
ENSP00000426959  .................................................................................
ENSP00000228740  .................................................................................
ENSP00000421175  .................................................................................
ENSP00000400376  .................................................................................
ENSP00000369235  .................................................................................
ENSP00000261180  .................................................................................
ENSP00000395051  .................................................................................
ENSP00000449958  .................................................................................
ENSP00000421849  .................................................................................
ENSP00000465855  .................................................................................
ENSP00000462280  .................................................................................
ENSP00000423604  .................................................................................
ENSP00000378899  .................................................................................
ENSP00000350541  .................................................................................
ENSP00000309968  .................................................................................
ENSP00000412683  .................................................................................
ENSP00000393699  .................................................................................
ENSP00000265769  .................................................................................
ENSP00000295640  .................................................................................
ENSP00000357665  .................................................................................
ENSP00000357668  .................................................................................
ENSP00000389602  .................................................................................
ENSP00000418737  .................................................................................
ENSP00000369249  .................................................................................
ENSP00000418437  .................................................................................
ENSP00000419446  .................................................................................
ENSP00000453043  .................................................................................
ENSP00000453855  .................................................................................
ENSP00000453302  .................................................................................
ENSP00000322550  .................................................................................
ENSP00000348912  .................................................................................
ENSP00000369190  .................................................................................
ENSP00000270357  .................................................................................
ENSP00000422937  .................................................................................
ENSP00000257527  .................................................................................
ENSP00000428654  .................................................................................
ENSP00000061240  .................................................................................
ENSP00000426082  .................................................................................
ENSP00000373472  .................................................................................
ENSP00000175238  .................................................................................
ENSP00000370166  .................................................................................
ENSP00000466653  .................................................................................
ENSP00000350630  .................................................................................
ENSP00000428665  .................................................................................
ENSP00000430406  .................................................................................
ENSP00000306121  .................................................................................
ENSP00000428332  .................................................................................
ENSP00000482883  .................................................................................
ENSP00000299855  .................................................................................
ENSP00000370443  .................................................................................
ENSP00000305714  .................................................................................
ENSP00000260302  .................................................................................
ENSP00000339672  .................................................................................
ENSP00000356255  .................................................................................
ENSP00000322788  .................................................................................
ENSP00000435639  .................................................................................
ENSP00000418735  .................................................................................
ENSP00000260228  .................................................................................
ENSP00000458585  .................................................................................
ENSP00000270328  .................................................................................
ENSP00000471851  .................................................................................
ENSP00000476000  .................................................................................
ENSP00000353892  .................................................................................
ENSP00000271836  .................................................................................
ENSP00000357397  .................................................................................
ENSP00000432347  .................................................................................
ENSP00000434227  .................................................................................
ENSP00000432927  .................................................................................
ENSP00000349436  .................................................................................
ENSP00000403843  .................................................................................
ENSP00000348227  .................................................................................
ENSP00000352226  .................................................................................
ENSP00000246186  .................................................................................
ENSP00000344847  .................................................................................
ENSP00000422554  .................................................................................
ENSP00000401004  .................................................................................
ENSP00000427573  .................................................................................
ENSP00000279441  .................................................................................
ENSP00000260227  .................................................................................
ENSP00000236826  .................................................................................
ENSP00000300762  .................................................................................
ENSP00000369753  .................................................................................
ENSP00000378911  .................................................................................
ENSP00000448341  .................................................................................
ENSP00000484172  .................................................................................
ENSP00000374071  .................................................................................
ENSP00000256389  .................................................................................
ENSP00000286614  .................................................................................
ENSP00000308208  .................................................................................
ENSP00000465895  .................................................................................
ENSP00000421631  .................................................................................
ENSP00000419217  .................................................................................
ENSP00000282849  .................................................................................
ENSP00000260229  .................................................................................
ENSP00000215743  .................................................................................
ENSP00000483349  .................................................................................
ENSP00000274181  .................................................................................
ENSP00000299164  .................................................................................
ENSP00000284987  .................................................................................
ENSP00000474385  .................................................................................
ENSP00000284984  .................................................................................
ENSP00000435966  .................................................................................
ENSP00000219271  .................................................................................
ENSP00000369238  .................................................................................
ENSP00000484817  .................................................................................
ENSP00000407614  .................................................................................
ENSP00000269202  .................................................................................
ENSP00000463280  .................................................................................
ENSP00000260408  .................................................................................
ENSP00000356975  .................................................................................
ENSP00000430400  .................................................................................
ENSP00000420101  .................................................................................
ENSP00000265707  .................................................................................
ENSP00000482348  .................................................................................
ENSP00000352177  .................................................................................
ENSP00000384229  .................................................................................
ENSP00000414544  .................................................................................
ENSP00000423517  .................................................................................
ENSP00000478469  .................................................................................
ENSP00000484862  .................................................................................
ENSP00000268070  .................................................................................
ENSP00000428993  .................................................................................
ENSP00000256412  .................................................................................
ENSP00000429352  .................................................................................
ENSP00000478636  .................................................................................
ENSP00000483607  .................................................................................
ENSP00000265708  .................................................................................
ENSP00000482337  .................................................................................
ENSP00000257359  .................................................................................
ENSP00000408070  .................................................................................
ENSP00000274487  .................................................................................
ENSP00000362304  .................................................................................
ENSP00000464428  .................................................................................
ENSP00000343674  .................................................................................
ENSP00000274609  .................................................................................
ENSP00000465537  .................................................................................
ENSP00000295903  .................................................................................
ENSP00000230588  .................................................................................
ENSP00000443773  .................................................................................
ENSP00000480465  .................................................................................
ENSP00000251582  .................................................................................
ENSP00000200557  .................................................................................
ENSP00000362303  .................................................................................
ENSP00000264377  .................................................................................
ENSP00000363536  .................................................................................
ENSP00000378638  .................................................................................
ENSP00000286657  .................................................................................
ENSP00000480055  .................................................................................
ENSP00000337816  .................................................................................
ENSP00000464786  .................................................................................
ENSP00000381261  .................................................................................
ENSP00000381260  .................................................................................
ENSP00000381262  .................................................................................
ENSP00000265727  .................................................................................
ENSP00000381267  .................................................................................
ENSP00000343854  .................................................................................
ENSP00000484999  .................................................................................
ENSP00000358407  .................................................................................
ENSP00000313437  .................................................................................
ENSP00000353767  .................................................................................
ENSP00000479124  .................................................................................
ENSP00000483299  .................................................................................
ENSP00000348308  .................................................................................
ENSP00000482367  .................................................................................
ENSP00000403404  .................................................................................
ENSP00000401854  .................................................................................
ENSP00000481051  .................................................................................
ENSP00000473853  .................................................................................
ENSP00000484430  .................................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  .................................................................................
ENSP00000364464  .................................................................................
ENSP00000347927  .................................................................................
ENSP00000360997  .................................................................................
ENSP00000429557  .................................................................................
ENSP00000361405  .................................................................................
ENSP00000360979  .................................................................................
ENSP00000435274  .................................................................................
ENSP00000346941  .................................................................................
ENSP00000428249  .................................................................................
ENSP00000348997  .................................................................................
ENSP00000369195  .................................................................................
ENSP00000446979  .................................................................................
ENSP00000329614  .................................................................................
ENSP00000380805  .................................................................................
ENSP00000380813  .................................................................................
ENSP00000219070  .................................................................................
ENSP00000444143  .................................................................................
ENSP00000461421  .................................................................................
ENSP00000394237  .................................................................................
ENSP00000436733  .................................................................................
ENSP00000442104  .................................................................................
ENSP00000456096  .................................................................................
ENSP00000357798  .................................................................................
ENSP00000429422  .................................................................................
ENSP00000483377  .................................................................................
ENSP00000405978  .................................................................................
ENSP00000420011  .................................................................................
ENSP00000453952  .................................................................................
ENSP00000417595  .................................................................................
ENSP00000423780  .................................................................................
ENSP00000435305  .................................................................................
ENSP00000340675  .................................................................................
ENSP00000426265  .................................................................................
ENSP00000465545  .................................................................................
ENSP00000482854  .................................................................................
ENSP00000277198  .................................................................................
ENSP00000457949  .................................................................................
ENSP00000484562  .................................................................................
ENSP00000431856  .................................................................................
ENSP00000462599  .................................................................................
ENSP00000405867  .................................................................................
ENSP00000457084  .................................................................................
ENSP00000431065  .................................................................................
ENSP00000419889  .................................................................................
ENSP00000461938  .................................................................................
ENSP00000427418  .................................................................................
ENSP00000427500  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000427574  .................................................................................
ENSP00000456518  .................................................................................
ENSP00000418886  .................................................................................
ENSP00000441485  .................................................................................
ENSP00000380808  .................................................................................
ENSP00000391334  .................................................................................
ENSP00000391268  .................................................................................
ENSP00000418791  .................................................................................
ENSP00000463673  .................................................................................
ENSP00000402171  .................................................................................
ENSP00000369182  .................................................................................
ENSP00000480574  .................................................................................
ENSP00000297979  .................................................................................
ENSP00000447822  .................................................................................
ENSP00000436633  .................................................................................
ENSP00000453545  .................................................................................
ENSP00000386625  .................................................................................
ENSP00000356974  .................................................................................
ENSP00000352976  .................................................................................
ENSP00000376481  .................................................................................
ENSP00000463012  .................................................................................
ENSP00000464133  .................................................................................
ENSP00000464635  .................................................................................
ENSP00000483162  .................................................................................
ENSP00000441710  .................................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  .................................................................................
ENSP00000423748  .................................................................................
ENSP00000352831  .................................................................................
ENSP00000330658  .................................................................................
ENSP00000446989  .................................................................................
ENSP00000367945  .................................................................................
ENSP00000482664  .................................................................................
ENSP00000380915  .................................................................................
ENSP00000427950  .................................................................................
ENSP00000428798  .................................................................................
ENSP00000430977  .................................................................................
ENSP00000390872  .................................................................................
ENSP00000484600  .................................................................................
ENSP00000418728  .................................................................................
ENSP00000462038  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000380806  .................................................................................
ENSP00000420542  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000430832  .................................................................................
ENSP00000462995  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000425758  .................................................................................
ENSP00000469559  .................................................................................
ENSP00000469901  .................................................................................
ENSP00000414661  .................................................................................
ENSP00000411451  .................................................................................
ENSP00000462002  .................................................................................
ENSP00000308149  .................................................................................


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  lyhrmgleelqsqfglkgfnwtlfiqtvlssvkikllpdeevvvygipylqnleniidtysartiqnylvwrlvldrigsl
ENSP00000484606  lyhrmgleelqsqfglkgfnwtlfiqtvlssvkikllpdeevvvygipylqnleniidtysartiqnylvwrlvldrigsl
ENSP00000405088  tlapainwlpflntifypveinesepivvydkeyleqistlinttdrcllnnymiwnlvrktssfldqrfqdadekfmevm
ENSP00000349581  tlapainwlpflntifypveinesepivvydkeyleqistlinttdrcllnnymiwnlvrktssfldqrfqdadekfmevm
ENSP00000264205  tlapainwlpflntifypveinesepivvydkeyleqistlinttdrcllnnymiwnlvrktssfldqrfqdadekfmevm
ENSP00000364028  tlapainwlpflntifypveinesepivvydkeyleqistlinttdrcllnnymiwnlvrktssfldqrfqdadekfmevm
ENSP00000353679  lynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltklkpiltkysardlqnlmswrfimdl
ENSP00000417079  lynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltklkpiltkysardlqnlmswrfimdl
ENSP00000418525  lynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltklkpiltkysardlqnlmswrfimdl
ENSP00000419653  lynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltklkpiltkysardlqnlmswrfimdl
ENSP00000420389  lynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltklkpiltkysardlqnlmswrfimdl
ENSP00000478173  lynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltklkpiltkysardlqnlmswrfimdl
ENSP00000352052  alapsmdwleflsfllsplelsdsepvvvygmdylqqvselinrtepsilnnyliwnlvqkttssldrrfesaqeklletl
ENSP00000385846  alapsmdwleflsfllsplelsdsepvvvygmdylqqvselinrtepsilnnyliwnlvqkttssldrrfesaqeklletl
ENSP00000350066  alapsmdwleflsfllsplelsdsepvvvygmdylqqvselinrtepsilnnyliwnlvqkttssldrrfesaqeklletl
ENSP00000384223  alapsmdwleflsfllsplelsdsepvvvygmdylqqvselinrtepsilnnyliwnlvqkttssldrrfesaqeklletl
ENSP00000290863  sniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnksmlekptdgrevvchasawdfyngkd
ENSP00000387760  sniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnksmlekptdgrevvchasawdfyngkd
ENSP00000464149  sniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnksmlekptdgrevvchasawdfyngkd
ENSP00000397593  sniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnksmlekptdgrevvchasawdfyngkd
ENSP00000290866  sniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnksmlekptdgrevvchasawdfyngkd
ENSP00000388439  tlapainwlpflntifypveinesepivvydkeyleqistlinttdrcllnnymiwnlvrktssfldqrfqdadekfmevm
ENSP00000397593  iydmvvpfpdkpnldvtstmlqqgwnathmfrvaeefftslelspmppefwegsmlekpadgrevvchasawdfynrkdfr
ENSP00000290866  iydmvvpfpdkpnldvtstmlqqgwnathmfrvaeefftslelspmppefwegsmlekpadgrevvchasawdfynrkdfr
ENSP00000302051  lqkitphlrwkwlldqifqedfseeeevvllatdymqqvsqlirstphrvlhnyl..........................
ENSP00000386333  lqkitphlrwkwlldqifqedfseeeevvllatdymqqvsqlirstphr................................
ENSP00000368682  mynkmniselsamipqfdwlgyikkvidtrlyphlkdispsenvvvrvpqyfkdlfrilgserkktianylvwrmvysrip
ENSP00000398444  alapsmdwleflsfllsplelsdsepvvvygmdylqqvselinrtepsilnnyliwnlvqkttssldrrfesaqeklletl
ENSP00000252519  hllgdmwgrfwtnlysltvpfgqkpnidvtdamvdqawdaqrifkeaekffvsvglpnmtqgfwensmltdpgnvqkavch
ENSP00000389326  hllgdmwgrfwtnlysltvpfgqkpnidvtdamvdqawdaqrifkeaekffvsvglpnmtqgfwensmltdpgnvqkavch
ENSP00000392247  sniydlvvpfpsapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnksmlekptdgrevvchasawdfyngkd
ENSP00000304467  rllgfhthadyvlemnmaktsqtvatfldelaqklkplgeqeravilelkraecerrglpfdgrirawdmryymnqveetr
ENSP00000370372  lqqllplrtkvakllgysthadfvlemntakstsrvtaflddlsqklkplgeaerefilnlkkkeckdrgfeydgkin...
ENSP00000422492  rekvdpnlwiigaavvnafyspnrnqivfpagilqppffskeqpqalnfggigmvigheithgfddngrnfd.........
ENSP00000482173  rekvdpnlwiigaavvnafyspnrnqivfpagilqppffskeqpqalnfggigmvigheithgfddngrnfd.........
ENSP00000423214  gfeydgkin........................................................................
ENSP00000467226  llgiyqellglafhheegasawhedvrlyta..................................................
ENSP00000347409  clqatftpmslspsqslvvhdveylknmsqlveemllkqrdflqshmilglvvtlspaldsqfqearrklsqklrelteqp
ENSP00000477793  clqatftpmslspsqslvvhdveylknmsqlveemllkqrdflqshmilglvvtlspaldsqfqearrklsqklrelteqp
ENSP00000425477  .................................................................................
ENSP00000410926  .................................................................................
ENSP00000418324  .................................................................................
ENSP00000371607  tvmqfleklsdklsertlkdfemirgmkmklnpqnsevmpwdppyysgviraeryniepslycpffslgacmeglnillnr
ENSP00000328829  .................................................................................
ENSP00000328611  .................................................................................
ENSP00000462909  .................................................................................
ENSP00000427417  .................................................................................
ENSP00000433287  .................................................................................
ENSP00000320324  .................................................................................
ENSP00000265162  .................................................................................
ENSP00000300060  .................................................................................
ENSP00000406304  .................................................................................
ENSP00000296754  .................................................................................
ENSP00000231368  .................................................................................
ENSP00000379117  .................................................................................
ENSP00000426959  .................................................................................
ENSP00000228740  .................................................................................
ENSP00000421175  .................................................................................
ENSP00000400376  .................................................................................
ENSP00000369235  .................................................................................
ENSP00000261180  .................................................................................
ENSP00000395051  .................................................................................
ENSP00000449958  .................................................................................
ENSP00000421849  .................................................................................
ENSP00000465855  .................................................................................
ENSP00000462280  .................................................................................
ENSP00000423604  .................................................................................
ENSP00000378899  .................................................................................
ENSP00000350541  .................................................................................
ENSP00000309968  .................................................................................
ENSP00000412683  .................................................................................
ENSP00000393699  .................................................................................
ENSP00000265769  .................................................................................
ENSP00000295640  .................................................................................
ENSP00000357665  .................................................................................
ENSP00000357668  .................................................................................
ENSP00000389602  .................................................................................
ENSP00000418737  .................................................................................
ENSP00000369249  .................................................................................
ENSP00000418437  .................................................................................
ENSP00000419446  .................................................................................
ENSP00000453043  .................................................................................
ENSP00000453855  .................................................................................
ENSP00000453302  .................................................................................
ENSP00000322550  .................................................................................
ENSP00000348912  .................................................................................
ENSP00000369190  .................................................................................
ENSP00000270357  .................................................................................
ENSP00000422937  .................................................................................
ENSP00000257527  .................................................................................
ENSP00000428654  .................................................................................
ENSP00000061240  .................................................................................
ENSP00000426082  .................................................................................
ENSP00000373472  .................................................................................
ENSP00000175238  .................................................................................
ENSP00000370166  .................................................................................
ENSP00000466653  .................................................................................
ENSP00000350630  .................................................................................
ENSP00000428665  .................................................................................
ENSP00000430406  .................................................................................
ENSP00000306121  .................................................................................
ENSP00000428332  .................................................................................
ENSP00000482883  .................................................................................
ENSP00000299855  .................................................................................
ENSP00000370443  .................................................................................
ENSP00000305714  .................................................................................
ENSP00000260302  .................................................................................
ENSP00000339672  .................................................................................
ENSP00000356255  .................................................................................
ENSP00000322788  .................................................................................
ENSP00000435639  .................................................................................
ENSP00000418735  .................................................................................
ENSP00000260228  .................................................................................
ENSP00000458585  .................................................................................
ENSP00000270328  .................................................................................
ENSP00000471851  .................................................................................
ENSP00000476000  .................................................................................
ENSP00000353892  .................................................................................
ENSP00000271836  .................................................................................
ENSP00000357397  .................................................................................
ENSP00000432347  .................................................................................
ENSP00000434227  .................................................................................
ENSP00000432927  .................................................................................
ENSP00000349436  .................................................................................
ENSP00000403843  .................................................................................
ENSP00000348227  .................................................................................
ENSP00000352226  .................................................................................
ENSP00000246186  .................................................................................
ENSP00000344847  .................................................................................
ENSP00000422554  .................................................................................
ENSP00000401004  .................................................................................
ENSP00000427573  .................................................................................
ENSP00000279441  .................................................................................
ENSP00000260227  .................................................................................
ENSP00000236826  .................................................................................
ENSP00000300762  .................................................................................
ENSP00000369753  .................................................................................
ENSP00000378911  .................................................................................
ENSP00000448341  .................................................................................
ENSP00000484172  .................................................................................
ENSP00000374071  .................................................................................
ENSP00000256389  .................................................................................
ENSP00000286614  .................................................................................
ENSP00000308208  .................................................................................
ENSP00000465895  .................................................................................
ENSP00000421631  .................................................................................
ENSP00000419217  .................................................................................
ENSP00000282849  .................................................................................
ENSP00000260229  .................................................................................
ENSP00000215743  .................................................................................
ENSP00000483349  .................................................................................
ENSP00000274181  .................................................................................
ENSP00000299164  .................................................................................
ENSP00000284987  .................................................................................
ENSP00000474385  .................................................................................
ENSP00000284984  .................................................................................
ENSP00000435966  .................................................................................
ENSP00000219271  .................................................................................
ENSP00000369238  .................................................................................
ENSP00000484817  .................................................................................
ENSP00000407614  .................................................................................
ENSP00000269202  .................................................................................
ENSP00000463280  .................................................................................
ENSP00000260408  .................................................................................
ENSP00000356975  .................................................................................
ENSP00000430400  .................................................................................
ENSP00000420101  .................................................................................
ENSP00000265707  .................................................................................
ENSP00000482348  .................................................................................
ENSP00000352177  .................................................................................
ENSP00000384229  .................................................................................
ENSP00000414544  .................................................................................
ENSP00000423517  .................................................................................
ENSP00000478469  .................................................................................
ENSP00000484862  .................................................................................
ENSP00000268070  .................................................................................
ENSP00000428993  .................................................................................
ENSP00000256412  .................................................................................
ENSP00000429352  .................................................................................
ENSP00000478636  .................................................................................
ENSP00000483607  .................................................................................
ENSP00000265708  .................................................................................
ENSP00000482337  .................................................................................
ENSP00000257359  .................................................................................
ENSP00000408070  .................................................................................
ENSP00000274487  .................................................................................
ENSP00000362304  .................................................................................
ENSP00000464428  .................................................................................
ENSP00000343674  .................................................................................
ENSP00000274609  .................................................................................
ENSP00000465537  .................................................................................
ENSP00000295903  .................................................................................
ENSP00000230588  .................................................................................
ENSP00000443773  .................................................................................
ENSP00000480465  .................................................................................
ENSP00000251582  .................................................................................
ENSP00000200557  .................................................................................
ENSP00000362303  .................................................................................
ENSP00000264377  .................................................................................
ENSP00000363536  .................................................................................
ENSP00000378638  .................................................................................
ENSP00000286657  .................................................................................
ENSP00000480055  .................................................................................
ENSP00000337816  .................................................................................
ENSP00000464786  .................................................................................
ENSP00000381261  .................................................................................
ENSP00000381260  .................................................................................
ENSP00000381262  .................................................................................
ENSP00000265727  .................................................................................
ENSP00000381267  .................................................................................
ENSP00000343854  .................................................................................
ENSP00000484999  .................................................................................
ENSP00000358407  .................................................................................
ENSP00000313437  .................................................................................
ENSP00000353767  .................................................................................
ENSP00000479124  .................................................................................
ENSP00000483299  .................................................................................
ENSP00000348308  .................................................................................
ENSP00000482367  .................................................................................
ENSP00000403404  .................................................................................
ENSP00000401854  .................................................................................
ENSP00000481051  .................................................................................
ENSP00000473853  .................................................................................
ENSP00000484430  .................................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  .................................................................................
ENSP00000364464  .................................................................................
ENSP00000347927  .................................................................................
ENSP00000360997  .................................................................................
ENSP00000429557  .................................................................................
ENSP00000361405  .................................................................................
ENSP00000360979  .................................................................................
ENSP00000435274  .................................................................................
ENSP00000346941  .................................................................................
ENSP00000428249  .................................................................................
ENSP00000348997  .................................................................................
ENSP00000369195  .................................................................................
ENSP00000446979  .................................................................................
ENSP00000329614  .................................................................................
ENSP00000380805  .................................................................................
ENSP00000380813  .................................................................................
ENSP00000219070  .................................................................................
ENSP00000444143  .................................................................................
ENSP00000461421  .................................................................................
ENSP00000394237  .................................................................................
ENSP00000436733  .................................................................................
ENSP00000442104  .................................................................................
ENSP00000456096  .................................................................................
ENSP00000357798  .................................................................................
ENSP00000429422  .................................................................................
ENSP00000483377  .................................................................................
ENSP00000405978  .................................................................................
ENSP00000420011  .................................................................................
ENSP00000453952  .................................................................................
ENSP00000417595  .................................................................................
ENSP00000423780  .................................................................................
ENSP00000435305  .................................................................................
ENSP00000340675  .................................................................................
ENSP00000426265  .................................................................................
ENSP00000465545  .................................................................................
ENSP00000482854  .................................................................................
ENSP00000277198  .................................................................................
ENSP00000457949  .................................................................................
ENSP00000484562  .................................................................................
ENSP00000431856  .................................................................................
ENSP00000462599  .................................................................................
ENSP00000405867  .................................................................................
ENSP00000457084  .................................................................................
ENSP00000431065  .................................................................................
ENSP00000419889  .................................................................................
ENSP00000461938  .................................................................................
ENSP00000427418  .................................................................................
ENSP00000427500  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000427574  .................................................................................
ENSP00000456518  .................................................................................
ENSP00000418886  .................................................................................
ENSP00000441485  .................................................................................
ENSP00000380808  .................................................................................
ENSP00000391334  .................................................................................
ENSP00000391268  .................................................................................
ENSP00000418791  .................................................................................
ENSP00000463673  .................................................................................
ENSP00000402171  .................................................................................
ENSP00000369182  .................................................................................
ENSP00000480574  .................................................................................
ENSP00000297979  .................................................................................
ENSP00000447822  .................................................................................
ENSP00000436633  .................................................................................
ENSP00000453545  .................................................................................
ENSP00000386625  .................................................................................
ENSP00000356974  .................................................................................
ENSP00000352976  .................................................................................
ENSP00000376481  .................................................................................
ENSP00000463012  .................................................................................
ENSP00000464133  .................................................................................
ENSP00000464635  .................................................................................
ENSP00000483162  .................................................................................
ENSP00000441710  .................................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  .................................................................................
ENSP00000423748  .................................................................................
ENSP00000352831  .................................................................................
ENSP00000330658  .................................................................................
ENSP00000446989  .................................................................................
ENSP00000367945  .................................................................................
ENSP00000482664  .................................................................................
ENSP00000380915  .................................................................................
ENSP00000427950  .................................................................................
ENSP00000428798  .................................................................................
ENSP00000430977  .................................................................................
ENSP00000390872  .................................................................................
ENSP00000484600  .................................................................................
ENSP00000418728  .................................................................................
ENSP00000462038  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000380806  .................................................................................
ENSP00000420542  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000430832  .................................................................................
ENSP00000462995  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000425758  .................................................................................
ENSP00000469559  .................................................................................
ENSP00000469901  .................................................................................
ENSP00000414661  .................................................................................
ENSP00000411451  .................................................................................
ENSP00000462002  .................................................................................
ENSP00000308149  .................................................................................


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  sqrfkdtrvnyrkalfgtmveevrwrecvgyvnsnmenavgslyvreafpgdsksmvrelidkvrtvfvetldelgwmdee
ENSP00000484606  sqrfkdtrvnyrkalfgtmveevrwrecvgyvnsnmenavgslyvreafpgdsksmvrelidkvrtvfvetldelgwmdee
ENSP00000405088  ygtkktclprwkfcvsdtennlgfalgpmfvkatfaedsksiateiileikkafeeslstlkwmdeetrksakekadaiyn
ENSP00000349581  ygtkktclprwkfcvsdtennlgfalgpmfvkatfaedsksiateiileikkafeeslstlkwmdeetrksakekadaiyn
ENSP00000264205  ygtkktclprwkfcvsdtennlgfalgpmfvkatfaedsksiateiileikkafeeslstlkwmdeetrksakekadaiyn
ENSP00000364028  ygtkktclprwkfcvsdtennlgfalgpmfvkatfaedsksiateiileikkafeeslstlkwmdeetrksakekadaiyn
ENSP00000353679  vsslsrtykesrnafrkalygttsetatwrrcanyvngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltw
ENSP00000417079  vsslsrtykesrnafrkalygttsetatwrrcanyvngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltw
ENSP00000418525  vsslsrtykesrnafrkalygttsetatwrrcanyvngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltw
ENSP00000419653  vsslsrtykesrnafrkalygttsetatwrrcanyvngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltw
ENSP00000420389  vsslsrtykesrnafrkalygttsetatwrrcanyvngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltw
ENSP00000478173  vsslsrtykesrnafrkalygttsetatwrrcanyvngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltw
ENSP00000352052  ygtkkscvprwqtcisntddalgfalgslfvkatfdrqskeiaegmiseirtafeealgqlvwmdektrqaakekadaiyd
ENSP00000385846  ygtkkscvprwqtcisntddalgfalgslfvkatfdrqskeiaegmiseirtafeealgqlvwmdektrqaakekadaiyd
ENSP00000350066  ygtkkscvprwqtcisntddalgfalgslfvkatfdrqskeiaegmiseirtafeealgqlvwmdektrqaakekadaiyd
ENSP00000384223  ygtkkscvprwqtcisntddalgfalgslfvkatfdrqskeiaegmiseirtafeealgqlvwmdektrqaakekadaiyd
ENSP00000290863  frikqcttv........................................................................
ENSP00000387760  frikqcttv........................................................................
ENSP00000464149  frikqcttv........................................................................
ENSP00000397593  frikqcttv........................................................................
ENSP00000290866  frikqcttv........................................................................
ENSP00000388439  ygtkktclprwkfcvsdtennlgfalgpmfvkatfaedsksiateiileikkafeeslstlkwmdeetrksakekadaiyn
ENSP00000397593  ikqctrv..........................................................................
ENSP00000290866  ikqctrv..........................................................................
ENSP00000302051  .................................................................................
ENSP00000386333  .................................................................................
ENSP00000368682  nlsrrfqyrwlefsrviqgtttllpqwdkcvnfiesalpyvvgkmfvdvyfqedkkemmeelvegvrwafidmlekenewm
ENSP00000398444  ygtkkscvprwqtcisntddalgfalgslfvkatfdrqskeiaegmiseirtafeealgqlvwmdektrqaakekadaiyd
ENSP00000252519  ptawdlgkgdfrilmctkv..............................................................
ENSP00000389326  ptawdlgkgdfrilmctkv..............................................................
ENSP00000392247  frikqcttv........................................................................
ENSP00000304467  ycvdqnllkeyfpvqvvthgllgiyqellglafhheegasawhedvrlytar.............................
ENSP00000370372  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000423214  .................................................................................
ENSP00000467226  .................................................................................
ENSP00000347409  pmparprwmkcveetgtffeptlaalfvreafgpstrsaamklftairda...............................
ENSP00000477793  pmparprwmkcveetgtffeptlaalfvreafgpstrsaamklftairda...............................
ENSP00000425477  .................................................................................
ENSP00000410926  .................................................................................
ENSP00000418324  .................................................................................
ENSP00000371607  llgislyaeqpakgevwsedvrklavvhesegllgyiycdffqradkphqdchftirggrlkedgdyqlpvvvlmlnlprs
ENSP00000328829  .................................................................................
ENSP00000328611  .................................................................................
ENSP00000462909  .................................................................................
ENSP00000427417  .................................................................................
ENSP00000433287  .................................................................................
ENSP00000320324  .................................................................................
ENSP00000265162  .................................................................................
ENSP00000300060  .................................................................................
ENSP00000406304  .................................................................................
ENSP00000296754  .................................................................................
ENSP00000231368  .................................................................................
ENSP00000379117  .................................................................................
ENSP00000426959  .................................................................................
ENSP00000228740  .................................................................................
ENSP00000421175  .................................................................................
ENSP00000400376  .................................................................................
ENSP00000369235  .................................................................................
ENSP00000261180  .................................................................................
ENSP00000395051  .................................................................................
ENSP00000449958  .................................................................................
ENSP00000421849  .................................................................................
ENSP00000465855  .................................................................................
ENSP00000462280  .................................................................................
ENSP00000423604  .................................................................................
ENSP00000378899  .................................................................................
ENSP00000350541  .................................................................................
ENSP00000309968  .................................................................................
ENSP00000412683  .................................................................................
ENSP00000393699  .................................................................................
ENSP00000265769  .................................................................................
ENSP00000295640  .................................................................................
ENSP00000357665  .................................................................................
ENSP00000357668  .................................................................................
ENSP00000389602  .................................................................................
ENSP00000418737  .................................................................................
ENSP00000369249  .................................................................................
ENSP00000418437  .................................................................................
ENSP00000419446  .................................................................................
ENSP00000453043  .................................................................................
ENSP00000453855  .................................................................................
ENSP00000453302  .................................................................................
ENSP00000322550  .................................................................................
ENSP00000348912  .................................................................................
ENSP00000369190  .................................................................................
ENSP00000270357  .................................................................................
ENSP00000422937  .................................................................................
ENSP00000257527  .................................................................................
ENSP00000428654  .................................................................................
ENSP00000061240  .................................................................................
ENSP00000426082  .................................................................................
ENSP00000373472  .................................................................................
ENSP00000175238  .................................................................................
ENSP00000370166  .................................................................................
ENSP00000466653  .................................................................................
ENSP00000350630  .................................................................................
ENSP00000428665  .................................................................................
ENSP00000430406  .................................................................................
ENSP00000306121  .................................................................................
ENSP00000428332  .................................................................................
ENSP00000482883  .................................................................................
ENSP00000299855  .................................................................................
ENSP00000370443  .................................................................................
ENSP00000305714  .................................................................................
ENSP00000260302  .................................................................................
ENSP00000339672  .................................................................................
ENSP00000356255  .................................................................................
ENSP00000322788  .................................................................................
ENSP00000435639  .................................................................................
ENSP00000418735  .................................................................................
ENSP00000260228  .................................................................................
ENSP00000458585  .................................................................................
ENSP00000270328  .................................................................................
ENSP00000471851  .................................................................................
ENSP00000476000  .................................................................................
ENSP00000353892  .................................................................................
ENSP00000271836  .................................................................................
ENSP00000357397  .................................................................................
ENSP00000432347  .................................................................................
ENSP00000434227  .................................................................................
ENSP00000432927  .................................................................................
ENSP00000349436  .................................................................................
ENSP00000403843  .................................................................................
ENSP00000348227  .................................................................................
ENSP00000352226  .................................................................................
ENSP00000246186  .................................................................................
ENSP00000344847  .................................................................................
ENSP00000422554  .................................................................................
ENSP00000401004  .................................................................................
ENSP00000427573  .................................................................................
ENSP00000279441  .................................................................................
ENSP00000260227  .................................................................................
ENSP00000236826  .................................................................................
ENSP00000300762  .................................................................................
ENSP00000369753  .................................................................................
ENSP00000378911  .................................................................................
ENSP00000448341  .................................................................................
ENSP00000484172  .................................................................................
ENSP00000374071  .................................................................................
ENSP00000256389  .................................................................................
ENSP00000286614  .................................................................................
ENSP00000308208  .................................................................................
ENSP00000465895  .................................................................................
ENSP00000421631  .................................................................................
ENSP00000419217  .................................................................................
ENSP00000282849  .................................................................................
ENSP00000260229  .................................................................................
ENSP00000215743  .................................................................................
ENSP00000483349  .................................................................................
ENSP00000274181  .................................................................................
ENSP00000299164  .................................................................................
ENSP00000284987  .................................................................................
ENSP00000474385  .................................................................................
ENSP00000284984  .................................................................................
ENSP00000435966  .................................................................................
ENSP00000219271  .................................................................................
ENSP00000369238  .................................................................................
ENSP00000484817  .................................................................................
ENSP00000407614  .................................................................................
ENSP00000269202  .................................................................................
ENSP00000463280  .................................................................................
ENSP00000260408  .................................................................................
ENSP00000356975  .................................................................................
ENSP00000430400  .................................................................................
ENSP00000420101  .................................................................................
ENSP00000265707  .................................................................................
ENSP00000482348  .................................................................................
ENSP00000352177  .................................................................................
ENSP00000384229  .................................................................................
ENSP00000414544  .................................................................................
ENSP00000423517  .................................................................................
ENSP00000478469  .................................................................................
ENSP00000484862  .................................................................................
ENSP00000268070  .................................................................................
ENSP00000428993  .................................................................................
ENSP00000256412  .................................................................................
ENSP00000429352  .................................................................................
ENSP00000478636  .................................................................................
ENSP00000483607  .................................................................................
ENSP00000265708  .................................................................................
ENSP00000482337  .................................................................................
ENSP00000257359  .................................................................................
ENSP00000408070  .................................................................................
ENSP00000274487  .................................................................................
ENSP00000362304  .................................................................................
ENSP00000464428  .................................................................................
ENSP00000343674  .................................................................................
ENSP00000274609  .................................................................................
ENSP00000465537  .................................................................................
ENSP00000295903  .................................................................................
ENSP00000230588  .................................................................................
ENSP00000443773  .................................................................................
ENSP00000480465  .................................................................................
ENSP00000251582  .................................................................................
ENSP00000200557  .................................................................................
ENSP00000362303  .................................................................................
ENSP00000264377  .................................................................................
ENSP00000363536  .................................................................................
ENSP00000378638  .................................................................................
ENSP00000286657  .................................................................................
ENSP00000480055  .................................................................................
ENSP00000337816  .................................................................................
ENSP00000464786  .................................................................................
ENSP00000381261  .................................................................................
ENSP00000381260  .................................................................................
ENSP00000381262  .................................................................................
ENSP00000265727  .................................................................................
ENSP00000381267  .................................................................................
ENSP00000343854  .................................................................................
ENSP00000484999  .................................................................................
ENSP00000358407  .................................................................................
ENSP00000313437  .................................................................................
ENSP00000353767  .................................................................................
ENSP00000479124  .................................................................................
ENSP00000483299  .................................................................................
ENSP00000348308  .................................................................................
ENSP00000482367  .................................................................................
ENSP00000403404  .................................................................................
ENSP00000401854  .................................................................................
ENSP00000481051  .................................................................................
ENSP00000473853  .................................................................................
ENSP00000484430  .................................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  .................................................................................
ENSP00000364464  .................................................................................
ENSP00000347927  .................................................................................
ENSP00000360997  .................................................................................
ENSP00000429557  .................................................................................
ENSP00000361405  .................................................................................
ENSP00000360979  .................................................................................
ENSP00000435274  .................................................................................
ENSP00000346941  .................................................................................
ENSP00000428249  .................................................................................
ENSP00000348997  .................................................................................
ENSP00000369195  .................................................................................
ENSP00000446979  .................................................................................
ENSP00000329614  .................................................................................
ENSP00000380805  .................................................................................
ENSP00000380813  .................................................................................
ENSP00000219070  .................................................................................
ENSP00000444143  .................................................................................
ENSP00000461421  .................................................................................
ENSP00000394237  .................................................................................
ENSP00000436733  .................................................................................
ENSP00000442104  .................................................................................
ENSP00000456096  .................................................................................
ENSP00000357798  .................................................................................
ENSP00000429422  .................................................................................
ENSP00000483377  .................................................................................
ENSP00000405978  .................................................................................
ENSP00000420011  .................................................................................
ENSP00000453952  .................................................................................
ENSP00000417595  .................................................................................
ENSP00000423780  .................................................................................
ENSP00000435305  .................................................................................
ENSP00000340675  .................................................................................
ENSP00000426265  .................................................................................
ENSP00000465545  .................................................................................
ENSP00000482854  .................................................................................
ENSP00000277198  .................................................................................
ENSP00000457949  .................................................................................
ENSP00000484562  .................................................................................
ENSP00000431856  .................................................................................
ENSP00000462599  .................................................................................
ENSP00000405867  .................................................................................
ENSP00000457084  .................................................................................
ENSP00000431065  .................................................................................
ENSP00000419889  .................................................................................
ENSP00000461938  .................................................................................
ENSP00000427418  .................................................................................
ENSP00000427500  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000427574  .................................................................................
ENSP00000456518  .................................................................................
ENSP00000418886  .................................................................................
ENSP00000441485  .................................................................................
ENSP00000380808  .................................................................................
ENSP00000391334  .................................................................................
ENSP00000391268  .................................................................................
ENSP00000418791  .................................................................................
ENSP00000463673  .................................................................................
ENSP00000402171  .................................................................................
ENSP00000369182  .................................................................................
ENSP00000480574  .................................................................................
ENSP00000297979  .................................................................................
ENSP00000447822  .................................................................................
ENSP00000436633  .................................................................................
ENSP00000453545  .................................................................................
ENSP00000386625  .................................................................................
ENSP00000356974  .................................................................................
ENSP00000352976  .................................................................................
ENSP00000376481  .................................................................................
ENSP00000463012  .................................................................................
ENSP00000464133  .................................................................................
ENSP00000464635  .................................................................................
ENSP00000483162  .................................................................................
ENSP00000441710  .................................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  .................................................................................
ENSP00000423748  .................................................................................
ENSP00000352831  .................................................................................
ENSP00000330658  .................................................................................
ENSP00000446989  .................................................................................
ENSP00000367945  .................................................................................
ENSP00000482664  .................................................................................
ENSP00000380915  .................................................................................
ENSP00000427950  .................................................................................
ENSP00000428798  .................................................................................
ENSP00000430977  .................................................................................
ENSP00000390872  .................................................................................
ENSP00000484600  .................................................................................
ENSP00000418728  .................................................................................
ENSP00000462038  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000380806  .................................................................................
ENSP00000420542  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000430832  .................................................................................
ENSP00000462995  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000425758  .................................................................................
ENSP00000469559  .................................................................................
ENSP00000469901  .................................................................................
ENSP00000414661  .................................................................................
ENSP00000411451  .................................................................................
ENSP00000462002  .................................................................................
ENSP00000308149  .................................................................................


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  skkkaqekamsireqighpdyileemnrrldeeysnlnfsedlyfenslqnlkvgaqrslrklrekvdpnlwiigaavvna
ENSP00000484606  skkkaqekamsireqighpdyileemnrrldeeysnlnfsedlyfenslqnlkvgaqrslrklrekvdpnlwiigaavvna
ENSP00000405088  migypnfimdpkeldkvfndytavpdlyfenamrffnfswrvtadqlrkapnrdqwsmtppmvnayysptkneivfpagil
ENSP00000349581  migypnfimdpkeldkvfndytavpdlyfenamrffnfswrvtadqlrkapnrdqwsmtppmvnayysptkneivfpagil
ENSP00000264205  migypnfimdpkeldkvfndytavpdlyfenamrffnfswrvtadqlrkapnrdqwsmtppmvnayysptkneivfpagil
ENSP00000364028  migypnfimdpkeldkvfndytavpdlyfenamrffnfswrvtadqlrkapnrdqwsmtppmvnayysptkneivfpagil
ENSP00000353679  mdaetkkraeekalaikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkdewisgaav
ENSP00000417079  mdaetkkraeekalaikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkdewisgaav
ENSP00000418525  mdaetkkraeekalaikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkdewisgaav
ENSP00000419653  mdaetkkraeekalaikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkdewisgaav
ENSP00000420389  mdaetkkraeekalaikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkdewisgaav
ENSP00000478173  mdaetkkraeekalaikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkdewisgaav
ENSP00000352052  migfpdfilepkelddvydgyeisedsffqnmlnlynfsakvmadqlrkppsrdq..........................
ENSP00000385846  migfpdfilepkelddvydgyeisedsffqnmlnlynfsakvmadqlrkppsrdq..........................
ENSP00000350066  migfpdfilepkelddvydgyeisedsffqnmlnlynfsakvmadqlrkppsrdq..........................
ENSP00000384223  migfpdfilepkelddvydgyeisedsffqnmlnlynfsakvmadqlrkppsrdq..........................
ENSP00000290863  .................................................................................
ENSP00000387760  .................................................................................
ENSP00000464149  .................................................................................
ENSP00000397593  .................................................................................
ENSP00000290866  .................................................................................
ENSP00000388439  migypnfimdpkeldkvfndytavpdlyfenamrffnfswrvtadqlrkapnrdqwsmtppmvnayysptkneivfpagil
ENSP00000397593  .................................................................................
ENSP00000290866  .................................................................................
ENSP00000302051  .................................................................................
ENSP00000386333  .................................................................................
ENSP00000368682  dagtkrkakekaravlakvgypefimndthvnedlkaikfseadyfgnvlqtrkylaqsdffwlrkavpktewf.......
ENSP00000398444  migfpdfilepkelddvydgyeisedsffqnmlnlynfsakvmadqlr.................................
ENSP00000252519  .................................................................................
ENSP00000389326  .................................................................................
ENSP00000392247  .................................................................................
ENSP00000304467  .................................................................................
ENSP00000370372  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000423214  .................................................................................
ENSP00000467226  .................................................................................
ENSP00000347409  .................................................................................
ENSP00000477793  .................................................................................
ENSP00000425477  .................................................................................
ENSP00000410926  .................................................................................
ENSP00000418324  .................................................................................
ENSP00000371607  srssptlltpsmmen..................................................................
ENSP00000328829  .................................................................................
ENSP00000328611  .................................................................................
ENSP00000462909  .................................................................................
ENSP00000427417  .................................................................................
ENSP00000433287  .................................................................................
ENSP00000320324  .................................................................................
ENSP00000265162  .................................................................................
ENSP00000300060  .................................................................................
ENSP00000406304  .................................................................................
ENSP00000296754  .................................................................................
ENSP00000231368  .................................................................................
ENSP00000379117  .................................................................................
ENSP00000426959  .................................................................................
ENSP00000228740  .................................................................................
ENSP00000421175  .................................................................................
ENSP00000400376  .................................................................................
ENSP00000369235  .................................................................................
ENSP00000261180  .................................................................................
ENSP00000395051  .................................................................................
ENSP00000449958  .................................................................................
ENSP00000421849  .................................................................................
ENSP00000465855  .................................................................................
ENSP00000462280  .................................................................................
ENSP00000423604  .................................................................................
ENSP00000378899  .................................................................................
ENSP00000350541  .................................................................................
ENSP00000309968  .................................................................................
ENSP00000412683  .................................................................................
ENSP00000393699  .................................................................................
ENSP00000265769  .................................................................................
ENSP00000295640  .................................................................................
ENSP00000357665  .................................................................................
ENSP00000357668  .................................................................................
ENSP00000389602  .................................................................................
ENSP00000418737  .................................................................................
ENSP00000369249  .................................................................................
ENSP00000418437  .................................................................................
ENSP00000419446  .................................................................................
ENSP00000453043  .................................................................................
ENSP00000453855  .................................................................................
ENSP00000453302  .................................................................................
ENSP00000322550  .................................................................................
ENSP00000348912  .................................................................................
ENSP00000369190  .................................................................................
ENSP00000270357  .................................................................................
ENSP00000422937  .................................................................................
ENSP00000257527  .................................................................................
ENSP00000428654  .................................................................................
ENSP00000061240  .................................................................................
ENSP00000426082  .................................................................................
ENSP00000373472  .................................................................................
ENSP00000175238  .................................................................................
ENSP00000370166  .................................................................................
ENSP00000466653  .................................................................................
ENSP00000350630  .................................................................................
ENSP00000428665  .................................................................................
ENSP00000430406  .................................................................................
ENSP00000306121  .................................................................................
ENSP00000428332  .................................................................................
ENSP00000482883  .................................................................................
ENSP00000299855  .................................................................................
ENSP00000370443  .................................................................................
ENSP00000305714  .................................................................................
ENSP00000260302  .................................................................................
ENSP00000339672  .................................................................................
ENSP00000356255  .................................................................................
ENSP00000322788  .................................................................................
ENSP00000435639  .................................................................................
ENSP00000418735  .................................................................................
ENSP00000260228  .................................................................................
ENSP00000458585  .................................................................................
ENSP00000270328  .................................................................................
ENSP00000471851  .................................................................................
ENSP00000476000  .................................................................................
ENSP00000353892  .................................................................................
ENSP00000271836  .................................................................................
ENSP00000357397  .................................................................................
ENSP00000432347  .................................................................................
ENSP00000434227  .................................................................................
ENSP00000432927  .................................................................................
ENSP00000349436  .................................................................................
ENSP00000403843  .................................................................................
ENSP00000348227  .................................................................................
ENSP00000352226  .................................................................................
ENSP00000246186  .................................................................................
ENSP00000344847  .................................................................................
ENSP00000422554  .................................................................................
ENSP00000401004  .................................................................................
ENSP00000427573  .................................................................................
ENSP00000279441  .................................................................................
ENSP00000260227  .................................................................................
ENSP00000236826  .................................................................................
ENSP00000300762  .................................................................................
ENSP00000369753  .................................................................................
ENSP00000378911  .................................................................................
ENSP00000448341  .................................................................................
ENSP00000484172  .................................................................................
ENSP00000374071  .................................................................................
ENSP00000256389  .................................................................................
ENSP00000286614  .................................................................................
ENSP00000308208  .................................................................................
ENSP00000465895  .................................................................................
ENSP00000421631  .................................................................................
ENSP00000419217  .................................................................................
ENSP00000282849  .................................................................................
ENSP00000260229  .................................................................................
ENSP00000215743  .................................................................................
ENSP00000483349  .................................................................................
ENSP00000274181  .................................................................................
ENSP00000299164  .................................................................................
ENSP00000284987  .................................................................................
ENSP00000474385  .................................................................................
ENSP00000284984  .................................................................................
ENSP00000435966  .................................................................................
ENSP00000219271  .................................................................................
ENSP00000369238  .................................................................................
ENSP00000484817  .................................................................................
ENSP00000407614  .................................................................................
ENSP00000269202  .................................................................................
ENSP00000463280  .................................................................................
ENSP00000260408  .................................................................................
ENSP00000356975  .................................................................................
ENSP00000430400  .................................................................................
ENSP00000420101  .................................................................................
ENSP00000265707  .................................................................................
ENSP00000482348  .................................................................................
ENSP00000352177  .................................................................................
ENSP00000384229  .................................................................................
ENSP00000414544  .................................................................................
ENSP00000423517  .................................................................................
ENSP00000478469  .................................................................................
ENSP00000484862  .................................................................................
ENSP00000268070  .................................................................................
ENSP00000428993  .................................................................................
ENSP00000256412  .................................................................................
ENSP00000429352  .................................................................................
ENSP00000478636  .................................................................................
ENSP00000483607  .................................................................................
ENSP00000265708  .................................................................................
ENSP00000482337  .................................................................................
ENSP00000257359  .................................................................................
ENSP00000408070  .................................................................................
ENSP00000274487  .................................................................................
ENSP00000362304  .................................................................................
ENSP00000464428  .................................................................................
ENSP00000343674  .................................................................................
ENSP00000274609  .................................................................................
ENSP00000465537  .................................................................................
ENSP00000295903  .................................................................................
ENSP00000230588  .................................................................................
ENSP00000443773  .................................................................................
ENSP00000480465  .................................................................................
ENSP00000251582  .................................................................................
ENSP00000200557  .................................................................................
ENSP00000362303  .................................................................................
ENSP00000264377  .................................................................................
ENSP00000363536  .................................................................................
ENSP00000378638  .................................................................................
ENSP00000286657  .................................................................................
ENSP00000480055  .................................................................................
ENSP00000337816  .................................................................................
ENSP00000464786  .................................................................................
ENSP00000381261  .................................................................................
ENSP00000381260  .................................................................................
ENSP00000381262  .................................................................................
ENSP00000265727  .................................................................................
ENSP00000381267  .................................................................................
ENSP00000343854  .................................................................................
ENSP00000484999  .................................................................................
ENSP00000358407  .................................................................................
ENSP00000313437  .................................................................................
ENSP00000353767  .................................................................................
ENSP00000479124  .................................................................................
ENSP00000483299  .................................................................................
ENSP00000348308  .................................................................................
ENSP00000482367  .................................................................................
ENSP00000403404  .................................................................................
ENSP00000401854  .................................................................................
ENSP00000481051  .................................................................................
ENSP00000473853  .................................................................................
ENSP00000484430  .................................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  .................................................................................
ENSP00000364464  .................................................................................
ENSP00000347927  .................................................................................
ENSP00000360997  .................................................................................
ENSP00000429557  .................................................................................
ENSP00000361405  .................................................................................
ENSP00000360979  .................................................................................
ENSP00000435274  .................................................................................
ENSP00000346941  .................................................................................
ENSP00000428249  .................................................................................
ENSP00000348997  .................................................................................
ENSP00000369195  .................................................................................
ENSP00000446979  .................................................................................
ENSP00000329614  .................................................................................
ENSP00000380805  .................................................................................
ENSP00000380813  .................................................................................
ENSP00000219070  .................................................................................
ENSP00000444143  .................................................................................
ENSP00000461421  .................................................................................
ENSP00000394237  .................................................................................
ENSP00000436733  .................................................................................
ENSP00000442104  .................................................................................
ENSP00000456096  .................................................................................
ENSP00000357798  .................................................................................
ENSP00000429422  .................................................................................
ENSP00000483377  .................................................................................
ENSP00000405978  .................................................................................
ENSP00000420011  .................................................................................
ENSP00000453952  .................................................................................
ENSP00000417595  .................................................................................
ENSP00000423780  .................................................................................
ENSP00000435305  .................................................................................
ENSP00000340675  .................................................................................
ENSP00000426265  .................................................................................
ENSP00000465545  .................................................................................
ENSP00000482854  .................................................................................
ENSP00000277198  .................................................................................
ENSP00000457949  .................................................................................
ENSP00000484562  .................................................................................
ENSP00000431856  .................................................................................
ENSP00000462599  .................................................................................
ENSP00000405867  .................................................................................
ENSP00000457084  .................................................................................
ENSP00000431065  .................................................................................
ENSP00000419889  .................................................................................
ENSP00000461938  .................................................................................
ENSP00000427418  .................................................................................
ENSP00000427500  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000427574  .................................................................................
ENSP00000456518  .................................................................................
ENSP00000418886  .................................................................................
ENSP00000441485  .................................................................................
ENSP00000380808  .................................................................................
ENSP00000391334  .................................................................................
ENSP00000391268  .................................................................................
ENSP00000418791  .................................................................................
ENSP00000463673  .................................................................................
ENSP00000402171  .................................................................................
ENSP00000369182  .................................................................................
ENSP00000480574  .................................................................................
ENSP00000297979  .................................................................................
ENSP00000447822  .................................................................................
ENSP00000436633  .................................................................................
ENSP00000453545  .................................................................................
ENSP00000386625  .................................................................................
ENSP00000356974  .................................................................................
ENSP00000352976  .................................................................................
ENSP00000376481  .................................................................................
ENSP00000463012  .................................................................................
ENSP00000464133  .................................................................................
ENSP00000464635  .................................................................................
ENSP00000483162  .................................................................................
ENSP00000441710  .................................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  .................................................................................
ENSP00000423748  .................................................................................
ENSP00000352831  .................................................................................
ENSP00000330658  .................................................................................
ENSP00000446989  .................................................................................
ENSP00000367945  .................................................................................
ENSP00000482664  .................................................................................
ENSP00000380915  .................................................................................
ENSP00000427950  .................................................................................
ENSP00000428798  .................................................................................
ENSP00000430977  .................................................................................
ENSP00000390872  .................................................................................
ENSP00000484600  .................................................................................
ENSP00000418728  .................................................................................
ENSP00000462038  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000380806  .................................................................................
ENSP00000420542  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000430832  .................................................................................
ENSP00000462995  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000425758  .................................................................................
ENSP00000469559  .................................................................................
ENSP00000469901  .................................................................................
ENSP00000414661  .................................................................................
ENSP00000411451  .................................................................................
ENSP00000462002  .................................................................................
ENSP00000308149  .................................................................................


                                                                   10        20        30          4
                                                                    |         |         |           
d1sata2            ........................................TGYDAVDDLLHYHERGNGIQINGKDSFSNEQAG..LFITRE
ENSP00000367668  fyspnrnqivfpagilqppffskeqpqalnfggigmvigh---------------------------------..------
ENSP00000484606  fyspnrnqivfpagilqppffskeqpqalnfggigmvigh---------------------------------..------
ENSP00000405088  ....................qapfytrsspkalnfggigv---------------------------------..------
ENSP00000349581  ....................qapfytrsspkalnfggigv---------------------------------..------
ENSP00000264205  ....................qapfytrsspkalnfggigv---------------------------------..------
ENSP00000364028  ....................qapfytrsspkalnfggigv---------------------------------..------
ENSP00000353679  ....................................vnaf---------------------------------..------
ENSP00000417079  ....................................vnaf---------------------------------..------
ENSP00000418525  ....................................vnaf---------------------------------..------
ENSP00000419653  ....................................vnaf---------------------------------..------
ENSP00000420389  ....................................vnaf---------------------------------..------
ENSP00000478173  ....................................vnaf---------------------------------..------
ENSP00000352052  ........................................-----------------------------W---..------
ENSP00000385846  ........................................-----------------------------W---..------
ENSP00000350066  ........................................-----------------------------W---..------
ENSP00000384223  ........................................-----------------------------W---..------
ENSP00000290863  ........................................---------------------------------..------
ENSP00000387760  ........................................---------------------------------..------
ENSP00000464149  ........................................---------------------------------..------
ENSP00000397593  ........................................---------------------------------..------
ENSP00000290866  ........................................---------------------------------..------
ENSP00000388439  ....................qapfytrsspkalnfggigv---------------------------------..------
ENSP00000397593  ........................................---------------------------------..------
ENSP00000290866  ........................................---------------------------------..------
ENSP00000302051  ........................................---------------------------------..------
ENSP00000386333  ........................................---------------------------------..------
ENSP00000368682  ........................................---------------------------------..------
ENSP00000398444  ........................................----------------------K----------..------
ENSP00000252519  ........................................---------------------------------..------
ENSP00000389326  ........................................---------------------------------..------
ENSP00000392247  ........................................---------------------------------..------
ENSP00000304467  ........................................---------------------------------..------
ENSP00000370372  ........................................---------------------------------..------
ENSP00000422492  ........................................---------------------------------..------
ENSP00000482173  ........................................---------------------------------..------
ENSP00000423214  ........................................---------------------------------..------
ENSP00000467226  ........................................---------------------------------..------
ENSP00000347409  ........................................---------------------------------..------
ENSP00000477793  ........................................---------------------------------..------
ENSP00000425477  ........................................---------------------------G-----..------
ENSP00000410926  ........................................---------------------------------..------
ENSP00000418324  ........................................---------------------------------..------
ENSP00000371607  ........................................---------------------------------..------
ENSP00000328829  ........................................---------------------------------..------
ENSP00000328611  ........................................---------------------------------..------
ENSP00000462909  ........................................-------------------------F-------..------
ENSP00000427417  ........................................---------------------------------..------
ENSP00000433287  ........................................---------------------------------..------
ENSP00000320324  ........................................---------------------------------..------
ENSP00000265162  ........................................---------------------------------..------
ENSP00000300060  ........................................---------------------------------..------
ENSP00000406304  ........................................---------------------------------..------
ENSP00000296754  ........................................---------------------------------..------
ENSP00000231368  ........................................---------------------------------..------
ENSP00000379117  ........................................---------------------------------..------
ENSP00000426959  ........................................---------------------------------..------
ENSP00000228740  ........................................---------------------------------..------
ENSP00000421175  ........................................---------------------------------..------
ENSP00000400376  ........................................---------------------------------..------
ENSP00000369235  ........................................---------------------------------..------
ENSP00000261180  ........................................---------------------------------..------
ENSP00000395051  ........................................---------------------------------..------
ENSP00000449958  ........................................---------------------------------..------
ENSP00000421849  ........................................---------------------------------..------
ENSP00000465855  ........................................---------------------------------..------
ENSP00000462280  ........................................---------------------------------..------
ENSP00000423604  ........................................---------------------------------..------
ENSP00000378899  ........................................---------------------------------..------
ENSP00000350541  ........................................---------------------------------..------
ENSP00000309968  ........................................---------------------------------..------
ENSP00000412683  ........................................---------------------------------..------
ENSP00000393699  ........................................---------------------------------..------
ENSP00000265769  ........................................---------------------------------..------
ENSP00000295640  ........................................---------------------------------..------
ENSP00000357665  ........................................---------------------------------..------
ENSP00000357668  ........................................---------------------------------..------
ENSP00000389602  ........................................---------------------------------..------
ENSP00000418737  ........................................---------------------------------..------
ENSP00000369249  ........................................---------------------------------..------
ENSP00000418437  ........................................---------------------------------..------
ENSP00000419446  ........................................---------------------------------..------
ENSP00000453043  ........................................---------------------------------..------
ENSP00000453855  ........................................---------------------------------..------
ENSP00000453302  ........................................---------------------------------..------
ENSP00000322550  ........................................---------------------------------..------
ENSP00000348912  ........................................---------------------------------..------
ENSP00000369190  ........................................---------------------------------..------
ENSP00000270357  ........................................---------------------------------..------
ENSP00000422937  ........................................---------------------------------..------
ENSP00000257527  ........................................---------------------------------..------
ENSP00000428654  ........................................---------------------------------..------
ENSP00000061240  ........................................---------------------------------..------
ENSP00000426082  ........................................---------------------------------..------
ENSP00000373472  ........................................---------------------------------..------
ENSP00000175238  ........................................---------------------------------..------
ENSP00000370166  ........................................---------------------------------..------
ENSP00000466653  ........................................---------------------------------..------
ENSP00000350630  ........................................---------------------------------..------
ENSP00000428665  ........................................---------------------------------..------
ENSP00000430406  ........................................---------------------------------..------
ENSP00000306121  ........................................---------------------------------..------
ENSP00000428332  ........................................---------------------------------..------
ENSP00000482883  ........................................---------------------------------..------
ENSP00000299855  ........................................---------------------------------..------
ENSP00000370443  ........................................---------------------------------..------
ENSP00000305714  ........................................---------------------------------..------
ENSP00000260302  ........................................---------------------------------..------
ENSP00000339672  ........................................---------------------------------..------
ENSP00000356255  ........................................---------------------------------..------
ENSP00000322788  ........................................---------------------------------..------
ENSP00000435639  ........................................---------------------------------..------
ENSP00000418735  ........................................---------------------------------..------
ENSP00000260228  ........................................---------------------------------..------
ENSP00000458585  ........................................---------------------------------..------
ENSP00000270328  ........................................---------------------------------..------
ENSP00000471851  ........................................---------------------------------..------
ENSP00000476000  ........................................---------------------------------..------
ENSP00000353892  ........................................---------------------------------..------
ENSP00000271836  ........................................---------------------------------..------
ENSP00000357397  ........................................---------------------------------..------
ENSP00000432347  ........................................---------------------------------..------
ENSP00000434227  ........................................---------------------------------..------
ENSP00000432927  ........................................---------------------------------..------
ENSP00000349436  ........................................---------------------------------..------
ENSP00000403843  ........................................---------------------------------..------
ENSP00000348227  ........................................---------------------------------..------
ENSP00000352226  ........................................---------------------------------..------
ENSP00000246186  ........................................---------------------------------..------
ENSP00000344847  ........................................---------------------------------..------
ENSP00000422554  ........................................---------------------------------..------
ENSP00000401004  ........................................---------------------------------..------
ENSP00000427573  ........................................---------------------------------..------
ENSP00000279441  ........................................---------------------------------..------
ENSP00000260227  ........................................---------------------------------..------
ENSP00000236826  ........................................---------------------------------..------
ENSP00000300762  ........................................---------------------------------..------
ENSP00000369753  ........................................---------------------------------..------
ENSP00000378911  ........................................---------------------------------..------
ENSP00000448341  ........................................---------------------------------..------
ENSP00000484172  ........................................---------------------------------..------
ENSP00000374071  ........................................---------------------------------..------
ENSP00000256389  ........................................---------------------------------..------
ENSP00000286614  ........................................---------------------------------..------
ENSP00000308208  ........................................---------------------------------..------
ENSP00000465895  ........................................---------------------------------..------
ENSP00000421631  ........................................---------------------------------..------
ENSP00000419217  ........................................---------------------------------..------
ENSP00000282849  ........................................---------------------------------..------
ENSP00000260229  ........................................---------------------------------..------
ENSP00000215743  ........................................------------------------PRCGVPDPSdgLSARNR
ENSP00000483349  ........................................------------------------PRCGVPDPSdgLSARNR
ENSP00000274181  ........................................---------------------------------..------
ENSP00000299164  ........................................---------------------------------..------
ENSP00000284987  ........................................---------------------------------..------
ENSP00000474385  ........................................---------------------------------..------
ENSP00000284984  ........................................---------------------------------..------
ENSP00000435966  ........................................---------------------------------..------
ENSP00000219271  ........................................---------------------------------..------
ENSP00000369238  ........................................---------------------------------..------
ENSP00000484817  ........................................---------------------------------..------
ENSP00000407614  ........................................---------------------------------..------
ENSP00000269202  ........................................---------------------------------..------
ENSP00000463280  ........................................---------------------------------..------
ENSP00000260408  ........................................---------------------------------..------
ENSP00000356975  ........................................---------------------------------..------
ENSP00000430400  ........................................---------------------------------..------
ENSP00000420101  ........................................---------------------------------..------
ENSP00000265707  ........................................---------------------------------..------
ENSP00000482348  ........................................---------------------------------..------
ENSP00000352177  ........................................---------------------------------..------
ENSP00000384229  ........................................---------------------------------..------
ENSP00000414544  ........................................---------------------------------..------
ENSP00000423517  ........................................---------------------------------..------
ENSP00000478469  ........................................---------------------------------..------
ENSP00000484862  ........................................---------------------------------..------
ENSP00000268070  ........................................---------------------------------..------
ENSP00000428993  ........................................---------------------------------..------
ENSP00000256412  ........................................---------------------------------..------
ENSP00000429352  ........................................---------------------------------..------
ENSP00000478636  ........................................---------------------------------..------
ENSP00000483607  ........................................---------------------------------..------
ENSP00000265708  ........................................---------------------------------..------
ENSP00000482337  ........................................---------------------------------..------
ENSP00000257359  ........................................---------------------------------..------
ENSP00000408070  ........................................---------------------------------..------
ENSP00000274487  ........................................---------------------------------..------
ENSP00000362304  ........................................---------------------------------..------
ENSP00000464428  ........................................---------------------------------..------
ENSP00000343674  ........................................---------------------------------..------
ENSP00000274609  ........................................---------------------------------..------
ENSP00000465537  ........................................---------------------------------..------
ENSP00000295903  ........................................---------------------------------..------
ENSP00000230588  ........................................---------------------------------..------
ENSP00000443773  ........................................---------------------------------..------
ENSP00000480465  ........................................---------------------------------..------
ENSP00000251582  ........................................---------------------------------..------
ENSP00000200557  ........................................---------------------------------..------
ENSP00000362303  ........................................---------------------------------..------
ENSP00000264377  ........................................---------------------------------..------
ENSP00000363536  ........................................---------------------------------..------
ENSP00000378638  ........................................-------D-------------------------..------
ENSP00000286657  ........................................---------------------------------..------
ENSP00000480055  ........................................---------------------------------..------
ENSP00000337816  ........................................--------------------TMRKPRCSLPDVLgvAGLVRR
ENSP00000464786  ........................................---------------------------------..------
ENSP00000381261  ........................................---------------------------------..------
ENSP00000381260  ........................................---------------------------------..------
ENSP00000381262  ........................................---------------------------------..------
ENSP00000265727  ........................................---------------------------------..------
ENSP00000381267  ........................................---------------------------------..------
ENSP00000343854  ........................................---------------------------------..------
ENSP00000484999  ........................................---------------------------------..------
ENSP00000358407  ........................................---------------------------------..------
ENSP00000313437  ........................................-----------------------QPRCGLEDPF..NQKTLK
ENSP00000353767  ........................................------------------------PRCSLPDLP..VLTQAR
ENSP00000479124  ........................................---------------------------------..------
ENSP00000483299  ........................................---------------------------------..------
ENSP00000348308  ........................................---------------------------------..----RR
ENSP00000482367  ........................................---------------------------------..----RR
ENSP00000403404  ........................................---------------------------------..------
ENSP00000401854  ........................................---------------------------------..------
ENSP00000481051  ........................................---------------------------------..------
ENSP00000473853  ........................................---------------------------------..------
ENSP00000484430  ........................................---------------------------------..------
ENSP00000444603  ........................................------------------------PRCSLPDLP..VLTQAR
ENSP00000441106  ........................................------------------------PRCSLPDLP..VLTQAR
ENSP00000364464  ........................................---------------------------------..------
ENSP00000347927  ........................................---------------------------------..------
ENSP00000360997  ........................................---------------------------------..------
ENSP00000429557  ........................................---------------------------------..------
ENSP00000361405  ........................................---------------------------------..------
ENSP00000360979  ........................................---------------------------------..------
ENSP00000435274  ........................................---------------------------------..------
ENSP00000346941  ........................................---------------------------------..------
ENSP00000428249  ........................................---------------------------------..------
ENSP00000348997  ........................................---------------------------------..------
ENSP00000369195  ........................................---------------------------------..------
ENSP00000446979  ........................................---------------------------------..------
ENSP00000329614  ........................................---------------------------------..------
ENSP00000380805  ........................................---------------------------------..------
ENSP00000380813  ........................................---------------------------------..------
ENSP00000219070  ........................................-------------------ETMRKPRCGNPDVA..------
ENSP00000444143  ........................................-------------------ETMRKPRCGNPDVA..------
ENSP00000461421  ........................................-------------------ETMRKPRCGNPDVA..------
ENSP00000394237  ........................................-------------------ETMRKPRCGNPDVA..------
ENSP00000436733  ........................................---------------------------------..------
ENSP00000442104  ........................................---------------------------------..------
ENSP00000456096  ........................................---------------------------------..------
ENSP00000357798  ........................................---------------------------------..------
ENSP00000429422  ........................................---------------------------------..------
ENSP00000483377  ........................................---------------------------------..------
ENSP00000405978  ........................................---------------------------------..------
ENSP00000420011  ........................................---------------------------------..------
ENSP00000453952  ........................................---------------------------------..------
ENSP00000417595  ........................................---------------------------------..------
ENSP00000423780  ........................................---------------------------------..----RR
ENSP00000435305  ........................................---------------------------------..------
ENSP00000340675  ........................................---------------------------------..------
ENSP00000426265  ........................................---------------------------------..------
ENSP00000465545  ........................................---------------------------------..------
ENSP00000482854  ........................................----------------------RKPRCSLPDVLgvAGLVRR
ENSP00000277198  ........................................---------------------------------..------
ENSP00000457949  ........................................---------------------------------..------
ENSP00000484562  ........................................---------------------------------..------
ENSP00000431856  ........................................---------------------------------..------
ENSP00000462599  ........................................-------------DRTSQVVWNEYAEANWNYNT..NITTET
ENSP00000405867  ........................................---------------------------------..------
ENSP00000457084  ........................................---------------------------------..------
ENSP00000431065  ........................................--------------V------------------..------
ENSP00000419889  ........................................---------------------------------..------
ENSP00000461938  ........................................---------------------------------..------
ENSP00000427418  ........................................---------------------------------..------
ENSP00000427500  ........................................---------------------------------..------
ENSP00000422492  ........................................---------------------------------..------
ENSP00000482173  ........................................---------------------------------..------
ENSP00000427574  ........................................---------------------------------..------
ENSP00000456518  ........................................---------------------------------..------
ENSP00000418886  ........................................---------------------------------..------
ENSP00000441485  ........................................---------------------------------..------
ENSP00000380808  ........................................---------------------------------..------
ENSP00000391334  ........................................---------------------------------..------
ENSP00000391268  ........................................---------------------------------..------
ENSP00000418791  ........................................---------------------------------..--G---
ENSP00000463673  ........................................---------------------------------..------
ENSP00000402171  ........................................---------------------------------..------
ENSP00000369182  ........................................---------------------------------..------
ENSP00000480574  ........................................---------------------------------..------
ENSP00000297979  ........................................---------------------------------..------
ENSP00000447822  ........................................---------------------------------..------
ENSP00000436633  ........................................---------------------------------..------
ENSP00000453545  ........................................---------------------------------..------
ENSP00000386625  ........................................-----------------------QPRCGLEDPF..NQKTLK
ENSP00000356974  ........................................-----------------------E---------..------
ENSP00000352976  ........................................---------------------------------..------
ENSP00000376481  ........................................---------------------------------..------
ENSP00000463012  ........................................---------------------------------..------
ENSP00000464133  ........................................---------------------------------..------
ENSP00000464635  ........................................---------------------------------..------
ENSP00000483162  ........................................---------------------------------..------
ENSP00000441710  ........................................-----------------------TPRCSLPDLP..VLTQAR
ENSP00000412107  ........................................---------------------------------..------
ENSP00000367406  ........................................------------------------K--------..------
ENSP00000423748  ........................................---------------------------------..------
ENSP00000352831  ........................................---------------------------------..------
ENSP00000330658  ........................................---------------------------------..------
ENSP00000446989  ........................................---------------------------------..------
ENSP00000367945  ........................................---------------------------------..----RR
ENSP00000482664  ........................................---------------------------------..----RR
ENSP00000380915  ........................................---------------------------------..------
ENSP00000427950  ........................................---------------------------------..------
ENSP00000428798  ........................................---------------------------------..------
ENSP00000430977  ........................................---------------------------------..------
ENSP00000390872  ........................................---------------------------------..------
ENSP00000484600  ........................................----------------------------V----..------
ENSP00000418728  ........................................---------------V-----------------..------
ENSP00000462038  ........................................---------------------------------..------
ENSP00000356634  ........................................---------------------------------..------
ENSP00000380806  ........................................---------------------------------..------
ENSP00000420542  ........................................---------------------------------..------
ENSP00000356633  ........................................---------------------------------..------
ENSP00000430832  ........................................---------------------------------..------
ENSP00000462995  ........................................---------------------------------..------
ENSP00000356633  ........................................---------------------------------..------
ENSP00000356634  ........................................---------------------------------..------
ENSP00000425758  ........................................---------------------------------..------
ENSP00000469559  ........................................---------------------------------..------
ENSP00000469901  ........................................---------------------------------..------
ENSP00000414661  ........................................---------------------------------..------
ENSP00000411451  ........................................---------------------------------..------
ENSP00000462002  ........................................---------------------------------..------
ENSP00000308149  ........................................---------------------------------..------


                   0        50        60        70        80        90           100                
                   |         |         |         |         |         |             |                
d1sata2            NQTWNGYKVFGQPVKLTFSFPDYKFSSTNVAGDTGLSKFSAEQQQQAKLSLQSWADVAN....ITFTEVAA..G.......
ENSP00000367668  -----------------------------------------------------------....--------..-.......
ENSP00000484606  -----------------------------------------------------------....--------..-.......
ENSP00000405088  -----------------------------------------------------------....--------..-.......
ENSP00000349581  -----------------------------------------------------------....--------..-.......
ENSP00000264205  -----------------------------------------------------------....--------..-.......
ENSP00000364028  -----------------------------------------------------------....--------..-.......
ENSP00000353679  -----------------------------------------------------------....--------..-.......
ENSP00000417079  -----------------------------------------------------------....--------..-.......
ENSP00000418525  -----------------------------------------------------------....--------..-.......
ENSP00000419653  -----------------------------------------------------------....--------..-.......
ENSP00000420389  -----------------------------------------------------------....--------..-.......
ENSP00000478173  -----------------------------------------------------------....--------..-.......
ENSP00000352052  -----------------------------------------------------------....--------..-.......
ENSP00000385846  -----------------------------------------------------------....--------..-.......
ENSP00000350066  -----------------------------------------------------------....--------..-.......
ENSP00000384223  -----------------------------------------------------------....--------..-.......
ENSP00000290863  -----------------------------------------------------------....--------..-.......
ENSP00000387760  -----------------------------------------------------------....--------..-.......
ENSP00000464149  -----------------------------------------------------------....--------..-.......
ENSP00000397593  -----------------------------------------------------------....--------..-.......
ENSP00000290866  -----------------------------------------------------------....--------..-.......
ENSP00000388439  -----------------------------------------------------------....--------..-.......
ENSP00000397593  -----------------------------------------------------------....--------..-.......
ENSP00000290866  -----------------------------------------------------------....--------..-.......
ENSP00000302051  ---------V-------------------------------------------------....--------..-.......
ENSP00000386333  ---V-------------------------------------------------------....--------..-.......
ENSP00000368682  -----------------------------------------------------------....--------..-.......
ENSP00000398444  -----------------------------------------------------------....--------..-.......
ENSP00000252519  -----------------------------------------------------------....--------..-.......
ENSP00000389326  -----------------------------------------------------------....--------..-.......
ENSP00000392247  -----------------------------------------------------------....--------..-.......
ENSP00000304467  -----------------------------------------------------------....-------D..A.......
ENSP00000370372  --AWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNT-YQELLGLSFEQMTDAHVwnksVTLYTVKD..K.......
ENSP00000422492  -----------------------------------------------------------....--------..-.......
ENSP00000482173  -----------------------------------------------------------....--------..-.......
ENSP00000423214  --AWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNT-YQELLGLSFEQMTDAHVwnksVTLYTVKD..K.......
ENSP00000467226  -----------------------------------------------------------....------RD..A.......
ENSP00000347409  -----------------------------------------------------------....-L------..-.......
ENSP00000477793  -----------------------------------------------------------....-L------..-.......
ENSP00000425477  -----------------------------------------------------------....--------..-.......
ENSP00000410926  -----------------------------------------------------------....--------..-.......
ENSP00000418324  -----------------------------------------------------------....--------..-.......
ENSP00000371607  -----------------------------------------------------------....--------..-.......
ENSP00000328829  -----------------------------------------------------------....--------..-.......
ENSP00000328611  -----------------------------------------------------------....--------..-.......
ENSP00000462909  -----------------------------------------------------------....--------..-.......
ENSP00000427417  --AWDLYYYMTQTEELKYSIDQEFLKEYFPIEVVTEGLLNT-YQELLGLSFEQMTDAHVwnksVTLYTVKD..K.......
ENSP00000433287  ---------W-------------------------------------------------....--------..-.......
ENSP00000320324  ---------W-------------------------------------------------....--------..-.......
ENSP00000265162  -----------------------------------------------------------....--------..-.......
ENSP00000300060  -----------------------------------------------------------....--------..-.......
ENSP00000406304  -----------------------------------------------------------....--------..-.......
ENSP00000296754  -----------------------------------------------------------....--------..-.......
ENSP00000231368  -----------------------------------------------------------....--------..-.......
ENSP00000379117  -----------------------------------------------------------....--------..-.......
ENSP00000426959  -----------------------------------------------------------....--------..-.......
ENSP00000228740  -----------------------------------------------------------....--------..-.......
ENSP00000421175  -----------------------------------------------------------....--------..-.......
ENSP00000400376  -----------------------------------------------------------....--------..-.......
ENSP00000369235  -----------------------------------------------------------....--------..-.......
ENSP00000261180  -----------------------------------------------------------....--------..-.......
ENSP00000395051  -----------------------------------------------------------....--------..-.......
ENSP00000449958  -----------------------------------------------------------....--------..-.......
ENSP00000421849  -----------------------------------------------------------....--------..-.......
ENSP00000465855  -----------------------------------------------------------....--------..-.......
ENSP00000462280  ------------------------------------ILASSRSYAMLLFAWEGWHNAAG....IPLKPLYE..D.......
ENSP00000423604  -----------------------------------------------------------....--------..-.......
ENSP00000378899  -----------------------------------------------------------....--------..-.......
ENSP00000350541  -----------------------------------------------------------....--------..-.......
ENSP00000309968  -----------------------------------------------------------....--------..-.......
ENSP00000412683  -----------------------------------------------------------....--------..-.......
ENSP00000393699  -----------------------------------------------------------....--------..-.......
ENSP00000265769  -----------------------------------------------------------....--------..-.......
ENSP00000295640  -----------------------------------------------------------....--------..-.......
ENSP00000357665  -----------------------------------------------------------....--------..-.......
ENSP00000357668  -----------------------------------------------------------....--------..-.......
ENSP00000389602  -----------------------------------------------------------....--------..-.......
ENSP00000418737  -----------------------------------------------------------....--------..-.......
ENSP00000369249  -----------------------------------------------------------....--------..-.......
ENSP00000418437  -----------------------------------------------------------....--------..-.......
ENSP00000419446  -----------------------------------------------------------....--------..-.......
ENSP00000453043  -----------------------------------------------------------....--------..-.......
ENSP00000453855  -----------------------------------------------------------....--------..-.......
ENSP00000453302  -----------------------------------------------------------....--------..-.......
ENSP00000322550  -----------------------------------------------------------....--------..-.......
ENSP00000348912  -----------------------------------------------------------....--------..-.......
ENSP00000369190  -----------------------------------------------------------....--------..-.......
ENSP00000270357  -----------------------------------------------------------....--------..-.......
ENSP00000422937  -------------GVIPYVIGG---------------NFTGSQRAMFKQAMRHWEKHTC....VTFIERSD..E.......
ENSP00000257527  -----------------------------------------------------------....--------..-.......
ENSP00000428654  -----------------------------------------------------------....--------..-.......
ENSP00000061240  --------------VIPYVIGG---------------NFTGSQRAMFKQAMRHWEKHTC....VTFIERSD..E.......
ENSP00000426082  --------------VIPYVIGG---------------NFTGSQRAMFKQAMRHWEKHTC....VTFIERSD..E.......
ENSP00000373472  -----------------------------------------------------------....--------..-.......
ENSP00000175238  -----------------------------------------------------------....--------..-.......
ENSP00000370166  -----------------------------------------------------------....--------..-.......
ENSP00000466653  -----------------------------------------------------------....---YTARD..A.......
ENSP00000350630  --------------VIPYVIGG---------------NFTGSQRAIFKQAMRHWEKHTC....VTFIERTD..E.......
ENSP00000428665  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000430406  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000306121  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000428332  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000482883  -----PRTLKWSKMNLTYRIVNYTPD-----------MTHSEVEKAFKKAFKVWSDVTP....LNFTRLHD..G.......
ENSP00000299855  -------IPKWRKTHLTYRIVNYTPD-----------LPKDAVDSAVEKALKVWEEVTP....LTFSRLYE..G.......
ENSP00000370443  -----------------------------------------------------------....--------..-.......
ENSP00000305714  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000260302  -----PRTLKWSKMNLTYRIVNYTPD-----------MTHSEVEKAFKKAFKVWSDVTP....LNFTRLHD..G.......
ENSP00000339672  -----PRTLKWSKMNLTYRIVNYTPD-----------MTHSEVEKAFKKAFKVWSDVTP....LNFTRLHD..G.......
ENSP00000356255  -----------------------------------------------------------....--------..-.......
ENSP00000322788  ------GNPRWEQTHLTYRIENYTPD-----------LPRADVDHAIEKAFQLWSNVTP....LTFTKVSE..G.......
ENSP00000435639  -------------------F---------------------------------------....--------..-.......
ENSP00000418735  -----------------------------------------------------------....--------..-.......
ENSP00000260228  -----PGEPKWKKNTLTYRISKYTPS-----------MSSVEVDKAVEMALQAWSSAVP....LSFVRINS..G.......
ENSP00000458585  ------GGPVWRKHYITYRINNYTPD-----------MNREDVDYAIRKAFQVWSNVTP....LKFSKINT..G.......
ENSP00000270328  -----------------------------------------------------------....--------..-.......
ENSP00000471851  -----------------------------------------------------------....--------..-.......
ENSP00000476000  -----------------------------------------------------------....--------..-.......
ENSP00000353892  -----------------------------------------------------------....--------..-.......
ENSP00000271836  -----------------------------------------------------------....--------..-.......
ENSP00000357397  -----------------------------------------------------------....--------..-.......
ENSP00000432347  -----------------------------------------------------------....--------..-.......
ENSP00000434227  -----------------------------------------------------------....--------..-.......
ENSP00000432927  -----------------------------------------------------------....--------..-.......
ENSP00000349436  -----------------------------------------------------------....--------..-.......
ENSP00000403843  -----------------------------------------------------------....--------..-.......
ENSP00000348227  -----------------------------------------------------------....--------..-.......
ENSP00000352226  -----------------------------------------------------------....--------..-.......
ENSP00000246186  ---------KWRQKHITYSIHNYTPK-----------VGELDTRKAIRQAFDVWQKVTP....LTFEEVPY..H.......
ENSP00000344847  -----------------------------------------------------------....--------..-.......
ENSP00000422554  -----------------------------------------------------------....--------..-.......
ENSP00000401004  -----PGNPKWERTNLTYRIRNYTPQ-----------LSEAEVERAIKDAFELWSVASP....LIFTRISQ..G.......
ENSP00000427573  -----------------------------------------------------------....--------..-.......
ENSP00000279441  --------PKWRKTHLTYRIVNYTPD-----------LPRDAVDSAIEKALKVWEEVTP....LTFSRLYE..G.......
ENSP00000260227  -----PNSPKWTSKVVTYRIVSYTRD-----------LPHITVDRLVSKALNMWGKEIP....LHFRKVVW..G.......
ENSP00000236826  -----PGNPKWERTNLTYRIRNYTPQ-----------LSEAEVERAIKDAFELWSVASP....LIFTRISQ..G.......
ENSP00000300762  --------CKWNKHTLTYRIINYPHD-----------MKPSAVKDSIYNAVSIWSNVTP....LIFQQVQN..G.......
ENSP00000369753  --------CKWNKHTLTYRIINYPHD-----------MKPSAVKDSIYNAVSIWSNVTP....LIFQQVQN..G.......
ENSP00000378911  -----------------------------------------------------------....--------..-.......
ENSP00000448341  -----------------------------------------------------------....--------..-.......
ENSP00000484172  -----------------------------------------------------------....--------..-.......
ENSP00000374071  -----------------------------------------------------------....--------..-.......
ENSP00000256389  -----------------------------------------------------------....--------..-.......
ENSP00000286614  -----LTGQKWQHKHITYSIKNVTPK-----------VGDPETRKAIRRAFDVWQNVTP....LTFEEVPY..S.......
ENSP00000308208  -------GLKWQHNEITFCIQNYTPK-----------VGEYATYEAIRKAFRVWESATP....LRFREVPY..Ayireghe
ENSP00000465895  -----------------------------------------------------------....--------..-.......
ENSP00000421631  -----------------------------------------------------------....--------..-.......
ENSP00000419217  -----------------------------------------------------------....--------..-.......
ENSP00000282849  -----------------------------------------------------------....--------..-.......
ENSP00000260229  --------PGWRKYNLTYRIINYTPD-----------MARAAVDEAIQEGLEVWSKVTP....LKFTKISK..G.......
ENSP00000215743  QKRFVLSGGRWEKTDLTYRILRFPWQ-----------LVQEQVRQTMAEALKVWSDVTP....LTFTEVHE..G.......
ENSP00000483349  QKRFVLSGGRWEKTDLTYRILRFPWQ-----------LVQEQVRQTMAEALKVWSDVTP....LTFTEVHE..G.......
ENSP00000274181  -----------------------------------------------------------....--------..-.......
ENSP00000299164  -----------------------------------------------------------....--------..-.......
ENSP00000284987  -----------------------------------------------------------....--------..-.......
ENSP00000474385  ----------------------------------------------IEQVLNDFSQWKQ....ISLSQLQH..D.......
ENSP00000284984  -----------------------------------------------------------....--------..-.......
ENSP00000435966  -----------------------------------------------------------....--------..-.......
ENSP00000219271  ---------KWNNHHLTFSIQNYTEKLGW-----------YHSMEAVRRAFRVWEQATP....LVFQEVPY..E.......
ENSP00000369238  ----------------------------------------QFKVTIVLSSLELWSDENK....I-------..-.......
ENSP00000484817  ----------------------------------------QFKVTIVLSSLELWSDENK....I-------..-.......
ENSP00000407614  -----------------------------------------------------------....--------..-.......
ENSP00000269202  -----------------------------------------------------------....--------..-.......
ENSP00000463280  -----------------------------------------------------------....--------..-.......
ENSP00000260408  -----------------------------------------------------------....--------..-.......
ENSP00000356975  -----------------------------------------------------------....--------..-.......
ENSP00000430400  -----------------------------------------------------------....--------..-.......
ENSP00000420101  -----------------------------------------------------------....--------..-.......
ENSP00000265707  ---------------------------------------------VILSSLELWSNENQ....IS------..-.......
ENSP00000482348  ---------------------------------------------VILSSLELWSNENQ....IS------..-.......
ENSP00000352177  -----------------------------------------------------------....--------..-.......
ENSP00000384229  -----------------------------------------------------------....--------..-.......
ENSP00000414544  -----------------------------------------------------------....--------..-.......
ENSP00000423517  -----------------------------------------------------------....--------..-.......
ENSP00000478469  -----------------------------------------------------------....--------..-.......
ENSP00000484862  -----------------------------------------------------------....--------..-.......
ENSP00000268070  -----------------------------------------------------------....--------..-.......
ENSP00000428993  -------------------------------------IYNTIDVQVALVGMEIWSDGDK....IKVVPSAS..T.......
ENSP00000256412  -------------------------------------IYNTIDVQVALVGMEIWSDGDK....IKVVPSAS..T.......
ENSP00000429352  -----------------------------------------------------------....--------..-.......
ENSP00000478636  -----------------------------------------------------------....--------..-.......
ENSP00000483607  -----------------------------------------------------------....--------..-.......
ENSP00000265708  -----------------------------------------------------------....--------..-.......
ENSP00000482337  -----------------------------------------------------------....--------..-.......
ENSP00000257359  -----------------------------------------------------------....--------..-.......
ENSP00000408070  ------------------RILRFPWQ-----------LVQEQVRQTMAEALKVWSDVTP....LTFTEVHE..G.......
ENSP00000274487  -----------------------------------------------------------....-------T..S.......
ENSP00000362304  -----------------------------------------------------------....--------..-.......
ENSP00000464428  -----------------------------------------------------------....--------..-.......
ENSP00000343674  ---------------------------------LLSSKYDEPSRQVILEALAEFERSTC....IRFVTYQD..Q.......
ENSP00000274609  -----------------------------------------------------------....--------..-.......
ENSP00000465537  ------------SVVLTSNFAKSVVN------LADVIYKEQLNTRIVLVAMETWADGDK....IQVQ----..-.......
ENSP00000295903  -----------------------------------------------------------....--------..-.......
ENSP00000230588  ----------------------------------------------ILYAFEMFRLKSC....VDF-KPYE..G.......
ENSP00000443773  ------------SVVLTSNFAKSVVN------LADVIYKEQLNTRIVLVAMETWADGDK....IQVQ----..-.......
ENSP00000480465  ----------------------------------------------ILYAFEMFRLKSC....VDF-KPYE..G.......
ENSP00000251582  -----------------------------------------------------------....--------..-.......
ENSP00000200557  ------------SVVLTSNFAKSVVN------LADVIYKEQLNTRIVLVAMETWADGDK....IQVQ----..-.......
ENSP00000362303  -----------------------------------------------------------....--------..-.......
ENSP00000264377  -----------------------------------------------------------....----T---..-.......
ENSP00000363536  -----------------------------------------------------------....----T---..-.......
ENSP00000378638  -----------------------------------------------------------....--------..-.......
ENSP00000286657  -----------------------------------------------------------....--------..-.......
ENSP00000480055  -----------------------------------------------------------....--------..-.......
ENSP00000337816  RRRYALSGSVWKKRTLTWRVRSFPQSSQLSQ---------ETVRVLMSYALMAWGMESG....LTFHEVDSpqG.......
ENSP00000464786  ---------------------H-------------------------------------....--------..-.......
ENSP00000381261  --------------------------------------------RIVLVAMETWATDN-....--------..-.......
ENSP00000381260  --------------------------------------------RIVLVAMETWATDN-....--------..-.......
ENSP00000381262  --------------------------------------------RIVLVAMETWATDN-....--------..-.......
ENSP00000265727  --------------------------------------------RIVLVAMETWATDN-....--------..-.......
ENSP00000381267  --------------------------------------------RIVLVAMETWATDN-....--------..-.......
ENSP00000343854  -------------------------S---------------------------------....--------..-.......
ENSP00000484999  -------------------------S---------------------------------....--------..-.......
ENSP00000358407  --------------------------------------FQDVRMRIHLKALEVWTDFNK....I---RVGY..P.......
ENSP00000313437  YLLL----GRWRKKHLTFRILNLPST-----------LPPHTARAALRQAFQDWSNVAP....LTFQEVQA..G.......
ENSP00000353767  RRRQAPAPTKWNKRNLSWRVRTFPRDSPLGH---------DTVRALMYYALKVWSDIAP....LNFHEVAG..S.......
ENSP00000479124  ------QGNKWYKQHLSYRLVNWPEH-----------LPEPAVRGAVRAAFQLWSNVSA....LEFWEAPA..T.......
ENSP00000483299  ------QGNKWYKQHLSYRLVNWPEH-----------LPEPAVRGAVRAAFQLWSNVSA....LEFWEAPA..T.......
ENSP00000348308  RYTLTPARLRWDHFNLTYRILSFPRNLL----------SPRETRRALAAAFRMWSDVSP....FSFREVAP..E.......
ENSP00000482367  RYTLTPARLRWDHFNLTYRILSFPRNLL----------SPRETRRALAAAFRMWSDVSP....FSFREVAP..E.......
ENSP00000403404  -----------------------------------------------------------....--------..-.......
ENSP00000401854  -----------------------------------------------------------....--------..-.......
ENSP00000481051  ------QGNKWYKQHLSYRLVNWPEH-----------LPEPAVRGAVRAAFQLWSNVSA....LEFWEAPA..T.......
ENSP00000473853  ------QGNKWYKQHLSYRLVNWPEH-----------LPEPAVRGAVRAAFQLWSNVSA....LEFWEAPA..T.......
ENSP00000484430  ------QGNKWYKQHLSYRLVNWPEH-----------LPEPAVRGAVRAAFQLWSNVSA....LEFWEAPA..T.......
ENSP00000444603  RRRQAPAPTKWNKRNLSWRVRTFPRDSPLGH---------DTVRALMYYALKVWSDIAP....LNFHEVAG..S.......
ENSP00000441106  RRRQAPAPTKWNKRNLSWRVRTFPRDSPLGH---------DTVRALMYYALKVWSDIAP....LNFHEVAG..S.......
ENSP00000364464  -----------------------------------------------------------....--------..-.......
ENSP00000347927  -----------------------------------------------------------....--------..-.......
ENSP00000360997  -----------------------------------------------------------....--------..-.......
ENSP00000429557  -----------------------------------------------------------....--------..-.......
ENSP00000361405  ---------KWHHHNITYWIQNYSED-----------LPRAVIDDAFARAFALWSAVTP....LTFTRVYS..R.......
ENSP00000360979  -----------------------------------------------------------....--------..-.......
ENSP00000435274  -----------------------------------------------------------....--------..-.......
ENSP00000346941  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000428249  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000348997  -----------------------------------------------------------....--------..-.......
ENSP00000369195  ---------------------------------------------VILSSLELWSNENQ....IS------..-.......
ENSP00000446979  -------------------------------------------RAALRQAFQDWSNVAP....LTFQEVQA..G.......
ENSP00000329614  -----------------------------------------------------------....--------..-.......
ENSP00000380805  -----------------------------------------------------------....--------..-.......
ENSP00000380813  -----------------------------------------------------------....--------..-.......
ENSP00000219070  NYNFFPRKPKWDKNQITYRIIGYTPD-----------LDPETVDDAFARAFQVWSDVTP....LRFSRIHD..G.......
ENSP00000444143  NYNFFPRKPKWDKNQITYRIIGYTPD-----------LDPETVDDAFARAFQVWSDVTP....LRFSRIHD..G.......
ENSP00000461421  NYNFFPRKPKWDKNQITYRIIGYTPD-----------LDPETVDDAFARAFQVWSDVTP....LRFSRIHD..G.......
ENSP00000394237  NYNFFPRKPKWDKNQITYRIIGYTPD-----------LDPETVDDAFARAFQVWSDVTP....LRFSRIHD..G.......
ENSP00000436733  ----------W------------------------------------------------....--------..-.......
ENSP00000442104  ------------------------------------------------YALKVWSDIAP....LNFHEVAG..S.......
ENSP00000456096  ----FPRKPKWDKNQITYRIIGYTPD-----------LDPETVDDAFARAFQVWSDVTP....LRFSRIHD..G.......
ENSP00000357798  ------------KRTLSWRLLGEALSSQLSV---------ADQRRIVALAFRMWSEVTP....LDFREDLAapG.......
ENSP00000429422  -------------------------------------MFTQFKVTIVLSSLELWSDENK....I-------..-.......
ENSP00000483377  -------------------------------------MFTQFKVTIVLSSLELWSDENK....I-------..-.......
ENSP00000405978  -------------------------------------MFTQFKVTIVLSSLELWSDENK....I-------..-.......
ENSP00000420011  -----------------------------------------------------------....--------..-.......
ENSP00000453952  -----------------------------------------------------------....--------..-.......
ENSP00000417595  -----------------------------------------------------------....--------..-.......
ENSP00000423780  RYTLTPARLRWDHFNLTYRILSFPRNLL----------SPRETRRALAAAFRMWSDVSP....FSFREVAP..E.......
ENSP00000435305  -----------------------------------------------------------....--------..-.......
ENSP00000340675  -----------------------------------------------------------....--------..-.......
ENSP00000426265  -----------------YQFKNAKTSDFWA-------ALEEASRLPVKEVMDTWT----....--------..-.......
ENSP00000465545  --------------EVTYTVQRNILD---------------------------------....--------..-.......
ENSP00000482854  RRRYALSGSVWKKRTLTWRVRSFPQSSQLSQ---------ETVRVLMSYALMAWGMESG....LTFHEVDSpqG.......
ENSP00000277198  -----------------------------------------------------------....--------..-.......
ENSP00000457949  ----FPRKPKWDKNQITYRIIGYTPD-----------LDPETVDDAFARAFQVWSDVTP....LRFSRIHD..G.......
ENSP00000484562  -----------------------------------------------------------....--------..-.......
ENSP00000431856  --------N--------------------------------------------------....--------..-.......
ENSP00000462599  SKILLQKNMQIANHTLKY-----------------------------------------....--------..-.......
ENSP00000405867  -----------------------------------------------------------....--------..-.......
ENSP00000457084  -----------------------------------------------------------....--------..-.......
ENSP00000431065  -----------------------------------------------------------....--------..-.......
ENSP00000419889  -----------------------------------------------------------....-SFQELAT..K.......
ENSP00000461938  -------------SPLKYRVLGSLQN---------------------------------....--------..-.......
ENSP00000427418  --------------------------------------------ATIKNIMDSWTHQ--....--------..-.......
ENSP00000427500  --------------------------------------------ATIKNIMDSWTHQ--....--------..-.......
ENSP00000422492  -----------PETNSRYSIFDV------------------------------------....--------..-.......
ENSP00000482173  -----------PETNSRYSIFDV------------------------------------....--------..-.......
ENSP00000427574  --------------------------------------------ATIKNIMDSWTHQ--....--------..-.......
ENSP00000456518  -----------------------------------------------------------....--------..-.......
ENSP00000418886  -----------------------------------------------------------....-SFQELAT..K.......
ENSP00000441485  --------PKWRKTHLTYRIVNYTPD-----------LPRDAVDSAIEKALKVWEEVTP....LTFSRLYE..G.......
ENSP00000380808  -----------------------------------------------------------....--------..-.......
ENSP00000391334  ----------------------------------------QLKTRIVLVAMETWATDNK....--------..-.......
ENSP00000391268  ---------------------------------------R-------------------....--------..-.......
ENSP00000418791  -----------------------------------------------------------....--------..-.......
ENSP00000463673  Q----------------------------------------------------------....--------..-.......
ENSP00000402171  -----------------------------------------------------------....--------..-.......
ENSP00000369182  -----------------------------------------------------------....--------..-.......
ENSP00000480574  -----------------------------------------------------------....--------..-.......
ENSP00000297979  -----------------------------------------------------------....--------..-.......
ENSP00000447822  -----------------------------------------------------------....--------..-.......
ENSP00000436633  ------------------------------C----------------------------....--------..-.......
ENSP00000453545  -----------------------------------LMVLNDVYRVMA------------....--------..-.......
ENSP00000386625  YLLL----GRWRKKHLTFRILNLPST-----------LPPHTARAALRQAFQDWSNVAP....LTFQEVQA..G.......
ENSP00000356974  -----------------------------------------------------------....--------..-.......
ENSP00000352976  -----------------------------------------------------------....--------..-.......
ENSP00000376481  -----------------------------------------------------------....--------..-.......
ENSP00000463012  -----------------------------------------------------------....--------..-.......
ENSP00000464133  -----------------------------------------------------------....--------..-.......
ENSP00000464635  -----------------------------------------------------------....--------..-.......
ENSP00000483162  -----------------------------------------------------------....--------..-.......
ENSP00000441710  RRRQAPAPTKWNKRNLSWRVRTFPRDSPLGH---------DTVRALMYYALKVWSDIAP....LNFHEVAG..S.......
ENSP00000412107  -----------------------------------------------------------....--------..-.......
ENSP00000367406  -----------------------------------------------------------....--------..-.......
ENSP00000423748  ----------WPGGVIPYVIGGN---------------FTGSQRAMFKQAMRHWEKHTC....VTFIERSD..E.......
ENSP00000352831  -----------------------------------------------------------....--------..-.......
ENSP00000330658  -----------------------------------------------------------....--------..-.......
ENSP00000446989  -------GLKWQHNEITFCIQNYTPK-----------VGEYATYEAIRKAFRVWESATP....LRFREVPY..Ayireghe
ENSP00000367945  RYTLTPARLRWDHFNLTYRILSFPRNLL----------SPRETRRALAAAFRMWSDVSP....FSFREVAP..E.......
ENSP00000482664  RYTLTPARLRWDHFNLTYRILSFPRNLL----------SPRETRRALAAAFRMWSDVSP....FSFREVAP..E.......
ENSP00000380915  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000427950  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000428798  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000430977  ------------------------------------GNFTGSQRAVFRQAMRHWEKHTC....VTFLERTD..E.......
ENSP00000390872  -----------------------------------------------------------....--------..-.......
ENSP00000484600  -----------------------------------------------------------....--------..-.......
ENSP00000418728  -----------------------------------------------------------....--------..-.......
ENSP00000462038  ---------------------------------------------VILNAFERYRLKTC....IDFKPWAG..E.......
ENSP00000356634  -----------------------------------------------------------....--------..-.......
ENSP00000380806  -----------------------------------------------------------....--------..-.......
ENSP00000420542  -----------------------------------------------------------....--------..-.......
ENSP00000356633  -----------------------------------------------------------....--------..-.......
ENSP00000430832  -------E---------------------------------------------------....--------..-.......
ENSP00000462995  ----------------------------------------SAEQVLFQSVAASWAHDTN....ITAENA--..-.......
ENSP00000356633  -----------------------------------------------------------....--------..-.......
ENSP00000356634  -----------------------------------------------------------....--------..-.......
ENSP00000425758  ------------------------------------------KRNQTHYALQ-------....--------..-.......
ENSP00000469559  -------------------------------------H---------------------....--------..-.......
ENSP00000469901  -------------------------------------H---------------------....--------..-.......
ENSP00000414661  -----------------------------------F-----------------------....--------..-.......
ENSP00000411451  -------------------F---------------------------------------....--------..-.......
ENSP00000462002  -----------------------------------------------------------....--------..-.......
ENSP00000308149  -----------------------------------------------------------....--------..-.......


                          110                 120          130        140             150           
                            |                   |            |          |               |           
d1sata2            Q.......KANITFGN..........YSQDRPG..HY.DYGTQA.YAFLPNTIWQGQ......DLGGQTWYNVNQS.....
ENSP00000367668  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000484606  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000405088  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000349581  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000264205  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000364028  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000353679  -.......--------..........-------..--.------.---Y--------......-------------.....
ENSP00000417079  -.......--------..........-------..--.------.---Y--------......-------------.....
ENSP00000418525  -.......--------..........-------..--.------.---Y--------......-------------.....
ENSP00000419653  -.......--------..........-------..--.------.---Y--------......-------------.....
ENSP00000420389  -.......--------..........-------..--.------.---Y--------......-------------.....
ENSP00000478173  -.......--------..........-------..--.------.---Y--------......-------------.....
ENSP00000352052  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000385846  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000350066  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000384223  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000290863  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000387760  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000464149  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000397593  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000290866  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000388439  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000397593  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000290866  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000302051  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000386333  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000368682  -.......--------..........-------..T-.------.------------......-------------.....
ENSP00000398444  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000252519  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000389326  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000392247  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000304467  A.......SGEVVGKF..........YLDLYPR..EG.KYGHAA.CFGLQPGCLRQ-......DGSRQIAIAAMVA.....
ENSP00000370372  A.......TGEVLGQF..........YLDLYPR..EG.KYNHAAcFGLQPGCLLPDGsrm...MAVAALVVNFSQP.....
ENSP00000422492  -.......--------..........-------..-K.------.------------......-------------.....
ENSP00000482173  -.......--------..........-------..-K.------.------------......-------------.....
ENSP00000423214  A.......TGEVLGQF..........YLDLYPR..EG.KYNHAAcFGLQPGCLLPDGsrm...MAVAALVVNFSQP.....
ENSP00000467226  A.......SGEVVGKF..........YLDLYPR..EG.KYGHAA.CFGLQPGCLRQ-......DGSRQIAIAAMVA.....
ENSP00000347409  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000477793  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000425477  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000410926  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000418324  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000371607  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000328829  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000328611  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000462909  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000427417  A.......TGEVLGQF..........YLDLYP-..--.------.------------......-------------.....
ENSP00000433287  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000320324  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000265162  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000300060  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000406304  -.......-------F..........YEDYFSI..PY.PLPKQD.LAAIPDFQSGAM......ENWGLTTYRESAL.....
ENSP00000296754  -.......-------F..........YEDYFSI..PY.PLPKQD.LAAIPDFQSGAM......ENWGLTTYRESAL.....
ENSP00000231368  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000379117  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000426959  -.......--------..........-------..--.------.------------......--------NFSQP.....
ENSP00000228740  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000421175  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000400376  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000369235  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000261180  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000395051  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000449958  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000421849  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000465855  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000462280  F.......-----TAL..........SNEAYKQ..DG.FTDTGA.YW----------......-------------.....
ENSP00000423604  -.......--------..........-------..--.------.-IALPSFDNHAM......ENWGLMIFDESGL.....
ENSP00000378899  -.......--------..........-------..--.------.-IALPSFDNHAM......ENWGLMIFDESGL.....
ENSP00000350541  -.......--------..........-------..--.------.-IALPSFDNHAM......ENWGLMIFDESGL.....
ENSP00000309968  -.......--------..........-------..--.------.KAYYSPVG----......--KKNIYLNSGLT.....
ENSP00000412683  -.......--------..........-------..--.------.------------......------------L.....
ENSP00000393699  -.......--------..........-------..--.AGTTVG.LAFMSTMCSP--......--YSVGVVQDHS-.....
ENSP00000265769  -.......--------..........-------..--.AGTTVG.LAFMSTMCSP--......--YSVGVVQDHS-.....
ENSP00000295640  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000357665  -.......--------..........-------..--.------.---APIMSMCTA......DQSGGIVMDHS--.....
ENSP00000357668  -.......--------..........-------..--.------.---APIMSMCTA......DQSGGIVMDHS--.....
ENSP00000389602  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000418737  -.......--------..........-------..KG.FGGTAG.MAFVGTVC----......SRSHAG-----GI.....
ENSP00000369249  -.......--------..........-------..KG.FGGTAG.MAFVGTVC----......SRSHAG-----GI.....
ENSP00000418437  -.......--------..........-------..KG.FGGTAG.MAFVGTVC----......SRSHAG-----GI.....
ENSP00000419446  -.......--------..........-------..KG.FGGTAG.MAFVGTVC----......SRSHAG-----GI.....
ENSP00000453043  -.......--------..........------V..DF.TGTTVG.FARVSAMC----......-SHSSGAVNQDHS.....
ENSP00000453855  -.......--------..........------V..DF.TGTTVG.FARVSAMC----......-SHSSGAVNQDHS.....
ENSP00000453302  -.......--------..........------V..DF.TGTTVG.FARVSAMC----......-SHSSGAVNQDHS.....
ENSP00000322550  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000348912  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000369190  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000270357  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000422937  -.......ESYIVFTY..........RPCGCCS..Y-.------.-VGRRGNGPQ--......-------------.....
ENSP00000257527  -.......--------..........-------..--.------.------------......-QSGGVNMDHSEN.....
ENSP00000428654  -.......--------..........-------..--.------.------------......-QSGGVNMDHSEN.....
ENSP00000061240  -.......ESYIVFTY..........RPCGCCS..Y-.------.-VGRRGNGPQ--......-------------.....
ENSP00000426082  -.......ESYIVFTY..........RPCGCCS..Y-.------.-VGRRGNGPQ--......-------------.....
ENSP00000373472  -.......--------..........-------..--.------.------------......-----------RS.....
ENSP00000175238  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000370166  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000466653  A.......SGEVVGKF..........YLDLYPR..EG.KYGHAA.CFGLQPGCLRQ-......DGSRQIAIAAMVA.....
ENSP00000350630  -.......ESFIVFSY..........RTCGCCSyvGRrGGGPQA.ISI---------......-------------.....
ENSP00000428665  -.......DSYIVFTY..........RPCGCCSyvGRrGGGPQA.ISI---------......-------------.....
ENSP00000430406  -.......DSYIVFTY..........RPCGCCSyvGRrGGGPQA.ISI---------......-------------.....
ENSP00000306121  -.......DSYIVFTY..........RPCGCCSyvGRrGGGPQA.ISI---------......-------------.....
ENSP00000428332  -.......DSYIVFTY..........RPCGCCSyvGRrGGGPQA.ISI---------......-------------.....
ENSP00000482883  -.......IADIMISFgike......HGDFYPF..DG.PSGLLA.HAFPPGPN----......-YGGDAHFDDDET.....
ENSP00000299855  -.......EADIMISFavre......HGDFYPF..DG.PGNVLA.HAYAPGPG----......-INGDAHFDDDEQ.....
ENSP00000370443  -.......DNAVLITR..........YDICTYK..NK.PCGTLG.LASVAGMC----......--------EPERS.....
ENSP00000305714  -.......DSYIVFTY..........RPCGCCSyvGRrGGGPQA.ISI---------......-------------.....
ENSP00000260302  -.......IADIMISFgike......HGDFYPF..DG.PSGLLA.HAFPPGPN----......-YGGDAHFDDDET.....
ENSP00000339672  -.......IADIMISFgike......HGDFYPF..DG.PSGLLA.HAFPPGPN----......-YGGDAHFDDDET.....
ENSP00000356255  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000322788  -.......QADIMISFvrgd......HRDNSPF..DG.PGGNLA.HAFQPGPG----......-IGGDAHFDEDER.....
ENSP00000435639  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000418735  -.......--------..........-------..--.------.------------......------------S.....
ENSP00000260228  -.......EADIMISFengd......HGDSYPF..DG.PRGTLA.HAFAPGEG----......-LGGDTHFDNAEK.....
ENSP00000458585  -.......MADILVVFarga......HGDFHAF..DG.KGGILA.HAFGPGSG----......-IGGDAHFDEDEF.....
ENSP00000270328  H.......DTAVLITR..........YDICIYK..NK.PCGTLG.LAPVGGMC----......--------ERERS.....
ENSP00000471851  H.......DTAVLITR..........YDICIYK..NK.PCGTLG.LAPVGGMC----......--------ERERS.....
ENSP00000476000  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000353892  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000271836  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000357397  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000432347  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000434227  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000432927  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000349436  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000403843  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000348227  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000352226  -.......--------..........-------..--.---TVG.MAIQNSICSP--......DFSGGVNMDHSTS.....
ENSP00000246186  Eiksdrk.EADIMIFFasgf......HGDSSPF..DG.EGGFLA.HAYFPGPG----......-IGGDTHFDSDEP.....
ENSP00000344847  -.......--------..........-------..--.------.------------......---------PHRS.....
ENSP00000422554  -.......--------..........-------..--.------.------------......---------PHRS.....
ENSP00000401004  -.......EADINIAFyqrd......HGDNSPF..DG.PNGILA.HAFQPGQG----......-IGGDAHFDAEET.....
ENSP00000427573  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000279441  -.......EADIMISFavke......HGDFYSF..DG.PGHSLA.HAYPPGPG----......-LYGDIHFDDDEK.....
ENSP00000260227  -.......TADIMIGFarga......HGDSYPF..DG.PGNTLA.HAFAPGTG----......-LGGDAHFDEDER.....
ENSP00000236826  -.......EADINIAFyqrd......HGDNSPF..DG.PNGILA.HAFQPGQG----......-IGGDAHFDAEET.....
ENSP00000300762  -.......DADIKVSFwqwa......HEDGWPF..DG.PGGILG.HAFLPNSG----......-NPGVVHFDKNEH.....
ENSP00000369753  -.......DADIKVSFwqwa......HEDGWPF..DG.PGGILG.HAFLPNSG----......-NPGVVHFDKNEH.....
ENSP00000378911  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000448341  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000484172  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000374071  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000256389  -.......--------..........------K..DT.QGMKLG.VAYVKGICQNPF......NTGVDVFED----.....
ENSP00000286614  Elengkr.DVDITIIFasgf......HGDSSPF..DG.EGGFLA.HAYFPGPG----......-IGGDTHFDSDEP.....
ENSP00000308208  K.......QADIMIFFaegf......HGDSTPF..DG.EGGFLA.HAYFPGPN----......-IGGDTHFDSAEP.....
ENSP00000465895  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000421631  -.......DHAILLTG..........LDICSWK..NE.PCDTLG.FAPISGMC----......SKYRS--------.....
ENSP00000419217  -.......--------..........-------..--.------.------------......------------S.....
ENSP00000282849  -.......DHAILLTG..........FDICSWK..NE.PCDTLG.FAPISGMC----......SKYRS--------.....
ENSP00000260229  -.......IADIMIAFrtrvh.....GRCPRYF..DG.PLGVLG.HAFPPGPG----......-LGGDTHFDEDEN.....
ENSP00000215743  -.......RADIMIDFaryw......HGDDLPF..DG.PGGILA.HAFFPKTH----......-REGDVHFDYDET.....
ENSP00000483349  -.......RADIMIDFaryw......HGDDLPF..DG.PGGILA.HAFFPKTH----......-REGDVHFDYDET.....
ENSP00000274181  -.......DHAILLTG..........LDICSWK..NE.PCDTLG.FAPISGMC----......SKYRS--------.....
ENSP00000299164  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000284987  -.......--------..........-------..--.------.------------......-----ICSPERSC.....
ENSP00000474385  -.......AAHMFIKN..........SL-----..--.-ISILG.LAYVAGICRPPI......DCGVDNFQG----.....
ENSP00000284984  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000435966  -.......--------..........-------..--.-----A.WRTFPNFI----......-SS------SQVF.....
ENSP00000219271  DirlrrqkEADIMVLFasgf......HGDSSPF..DG.TGGFLA.HAYFPGPG----......-LGGDTHFDADEP.....
ENSP00000369238  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000484817  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000407614  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000269202  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000463280  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000260408  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000356975  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000430400  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000420101  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000265707  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000482348  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000352177  -.......--------..........-------..--.------.------------......------HRSCAIV.....
ENSP00000384229  -.......--------..........-------..--.------.------------......------HRSCAIV.....
ENSP00000414544  -.......--------..........-------..--.------.------------......------HRSCAIV.....
ENSP00000423517  -.......--------..........-------..--.------.------------......------HRSCAIV.....
ENSP00000478469  -.......--------..........-------..--.------.------------......------HRSCAIV.....
ENSP00000484862  -.......--------..........-------..--.------.------------......------HRSCAIV.....
ENSP00000268070  -.......---VFVTR..........TDFCVHK..DE.PCDTVG.IAYLGGVC----......--------SAKRK.....
ENSP00000428993  -.......----TFDN..........FLRWHSS..NL.GKKIHD.HAQL--------......-LSGISFNNRRVG.....
ENSP00000256412  -.......----TFDN..........FLRWHSS..NL.GKKIHD.HAQL--------......-LSGISFNNRRVG.....
ENSP00000429352  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000478636  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000483607  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000265708  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000482337  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000257359  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000408070  -.......RADIMIDFaryw......HGDDLPF..DG.PGGILA.HAFFPKTH----......-REGDVHFDYDET.....
ENSP00000274487  V.......DAAILITR..........KDFCVHK..DE.PCDTVG.IAYLSGMCSE--......----------KRK.....
ENSP00000362304  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000464428  -.......--------..........H------..--.------.------------......-------------.....
ENSP00000343674  R.......DFISIIPM..........YGCFSSV..GR.SGGMQV.VSLAPTC-----......-------------.....
ENSP00000274609  -.......--------..........-------..--.PSGMQG.YAPVTGM-----......-----CH--PVRS.....
ENSP00000465537  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000295903  -.......--------..........-------..--.------.------------......------------S.....
ENSP00000230588  E.......SSYIIFQQ..........FDGCWS-..--.------.------------......-EVGDQHVGQ---.....
ENSP00000443773  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000480465  E.......SSYIIFQQ..........FDGCWS-..--.------.------------......-EVGDQHVGQ---.....
ENSP00000251582  -.......--------..........-------..--.PSGMQG.YAPVTGM-----......-----CH--PVRS.....
ENSP00000200557  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000362303  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000264377  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000363536  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000378638  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000286657  -.......--------..........-------..--.PAGMQG.YAPVTGMC----......------H--PVRS.....
ENSP00000480055  -.......--------..........-------..--.PAGMQG.YAPVTGMC----......------H--PVRS.....
ENSP00000337816  Q.......EPDILIDFaraf......HQDSYPF..DG.LGGTLA.HAFFPGEH----......PISGDTHFDDEET.....
ENSP00000464786  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000381261  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000381260  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000381262  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000265727  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000381267  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000343854  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000484999  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000358407  E.......LAEVLGRFvi........YKKSVLN..AR.LSSDWA.HLYLQRKYNDAL......AWSFGKVCSLEYA.....
ENSP00000313437  -.......AADIRLSFhgrqs.....SYCSNTF..DG.PGRVLA.HADIP-------......-ELGSVHFDEDEF.....
ENSP00000353767  -.......AADIQIDFskad......HNDGYPF..DG.PGGTVA.HAFFPGHH----......HTAGDTHFDDDEA.....
ENSP00000479124  G.......PADIRLTFfqgdhn....DGLGNAF..DG.PGGALA.HAFLP-------......-RRGEAHFDQDER.....
ENSP00000483299  G.......PADIRLTFfqgdhn....DGLGNAF..DG.PGGALA.HAFLP-------......-RRGEAHFDQDER.....
ENSP00000348308  Q.......PSDLRIGFypinhtdclvSALHHCF..DG.PTGELA.HAFFPPH-----......---GGIHFDDSEY.....
ENSP00000482367  Q.......PSDLRIGFypinhtdclvSALHHCF..DG.PTGELA.HAFFPPH-----......---GGIHFDDSEY.....
ENSP00000403404  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000401854  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000481051  G.......PADIRLTFfqgdhn....DGLGNAF..DG.PGGALA.HAFLP-------......-RRGEAHFDQDER.....
ENSP00000473853  G.......PADIRLTFfqgdhn....DGLGNAF..DG.PGGALA.HAFLP-------......-RRGEAHFDQDER.....
ENSP00000484430  G.......PADIRLTFfqgdhn....DGLGNAF..DG.PGGALA.HAFLP-------......-RRGEAHFDQDER.....
ENSP00000444603  -.......AADIQIDFskad......HNDGYPF..DG.PGGTVA.HAFFPGHH----......HTAGDTHFDDDEA.....
ENSP00000441106  -.......AADIQIDFskad......HNDGYPF..DG.PGGTVA.HAFFPGHH----......HTAGDTHFDDDEA.....
ENSP00000364464  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000347927  -.......--------..........-------..--.------.--CSP-------......----------TWS.....
ENSP00000360997  -.......--------..........-------..--.------.--CSP-------......----------TWS.....
ENSP00000429557  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000361405  -.......DADIVIQFgvae......HGDGYPF..DG.KDGLLA.HAFPPGPG----......-IQGDAHFDDDELwslgk
ENSP00000360979  -.......--------..........-------..--.------.--CSP-------......----------TWS.....
ENSP00000435274  -.......--------..........-------..--.------.--CSP-------......----------TWS.....
ENSP00000346941  -.......DSYIVFTY..........RPCGCCSyvGRrGGGPQA.ISI---------......-------------.....
ENSP00000428249  -.......DSYIVFTY..........RPCGCCSyvGRrGGGPQA.ISI---------......-------------.....
ENSP00000348997  -.......--------..........-------..--.------.--CSP-------......----------TWS.....
ENSP00000369195  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000446979  -.......AADIRLSFhgrqs.....SYCSNTF..DG.PGRVLA.HADIP-------......-ELGSVHFDEDEF.....
ENSP00000329614  -.......--------..........-------..--.------.---FPDDY----......-NLGDIFLGVEYI.....
ENSP00000380805  -.......--------..........-------..--.------.---FPDDY----......-NLGDIFLGVEYI.....
ENSP00000380813  -.......--------..........-------..--.------.---FPDDY----......-NLGDIFLGVEYI.....
ENSP00000219070  -.......EADIMINFgrwe......HGDGYPF..DG.KDGLLA.HAFAPGTG----......-VGGDSHFDDDELwtlge
ENSP00000444143  -.......EADIMINFgrwe......HGDGYPF..DG.KDGLLA.HAFAPGTG----......-VGGDSHFDDDELwtlge
ENSP00000461421  -.......EADIMINFgrwe......HGDGYPF..DG.KDGLLA.HAFAPGTG----......-VGGDSHFDDDELwtlge
ENSP00000394237  -.......EADIMINFgrwe......HGDGYPF..DG.KDGLLA.HAFAPGTG----......-VGGDSHFDDDELwtlge
ENSP00000436733  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000442104  -.......AADIQIDFskad......HNDGYPF..DG.PGGTVA.HAFFPGHH----......HTAGDTHFDDDEA.....
ENSP00000456096  -.......EADIMINFgrwe......HGDGYPF..DG.KDGLLA.HAFAPGTG----......-VGGDSHFDDDEL.....
ENSP00000357798  A.......AVDIKLGFgrgrh.....LGCPRAF..DG.SGQEFA.HA----------......WRLGDIHFDDDEH.....
ENSP00000429422  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000483377  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000405978  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000420011  -.......--------..........-------..--.---EKA.------------......-------------.....
ENSP00000453952  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000417595  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000423780  Q.......PSDLRIGFypinhtdclvSALHHCF..DG.PTGELA.HAFFPPH-----......---GGIHFDDSEY.....
ENSP00000435305  -.......--------..........-------..--.-----G.GACSP-------......----------TWS.....
ENSP00000340675  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000426265  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000465545  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000482854  Q.......EPDILIDFaraf......HQDSYPF..DG.LGGTLA.HAFFPGEH----......PISGDTHFDDEET.....
ENSP00000277198  -.......--------..........-------..--.------.-ANFPSLG----......MASPHIMFLSQSI.....
ENSP00000457949  -.......EADIMINFgrwe......HGDGYPF..DG.KDGLLA.HA----------......-------------.....
ENSP00000484562  -.......--------..........-----RF..AK.QGGALA.HAFLP-------......-RRGEAHFDQDER.....
ENSP00000431856  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000462599  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000405867  -.......--------..........---HHCF..DG.PTGELA.HAFFPPH-----......---GGIHFDDSEY.....
ENSP00000457084  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000431065  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000419889  N.......KNRLRRILev........QNSWHP-..-G.SGEEKA.FQ----------......-------------.....
ENSP00000461938  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000427418  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000427500  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000422492  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000482173  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000427574  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000456518  -.......--------..........-------..--.------.------------......-------YDRDKK.....
ENSP00000418886  N.......KNRLRRILev........QNSWHP-..-G.SGEEKA.FQ----------......-------------.....
ENSP00000441485  -.......EADIMISFa.........VK-----..--.-GHSLA.HAYPPGPG----......-------------.....
ENSP00000380808  -.......--------..........-------..--.------.----PDDY----......-NLGDIFLGVEYI.....
ENSP00000391334  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000391268  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000418791  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000463673  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000402171  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000369182  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000480574  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000297979  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000447822  -.......--------..........-------..--.---F--.------------......-------------.....
ENSP00000436633  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000453545  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000386625  -.......AADIRLSF..........HGRQSS-..--.------.------------......-------------.....
ENSP00000356974  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000352976  -.......--------..........-------..--.------.-----------VkklkktSSSDYSIFDNYYI.....
ENSP00000376481  -.......--------..........-------..--.------.-----------VkklkktSSSDYSIFDNYYI.....
ENSP00000463012  -.......--------..........-------..--.------.-----------VkklkktSSSDYSIFDNYYI.....
ENSP00000464133  -.......--------..........-------..--.------.-----------VkklkktSSSDYSIFDNYYI.....
ENSP00000464635  -.......--------..........-------..--.------.-----------VkklkktSSSDYSIFDNYYI.....
ENSP00000483162  -.......--------..........-------..--.------.-----------VkklkktSSSDYSIFDNYYI.....
ENSP00000441710  -.......AADIQIDF..........SK-----..--.------.------------......-------------.....
ENSP00000412107  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000367406  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000423748  -.......ESYIVFT-..........-------..--.------.------------......-------------.....
ENSP00000352831  -.......--------..........-------..--.------.-----------VkklkktSSSDYSIFDNYYI.....
ENSP00000330658  -.......--------..........-------..--.EEELAG.VATWPWDKEAL-......MHLGGIVLNPSFY.....
ENSP00000446989  K.......QADIMIFF..........AE-----..--.------.------------......-------------.....
ENSP00000367945  Q.......PSDLRIG-..........-------..--.------.------------......-------------.....
ENSP00000482664  Q.......PSDLRIG-..........-------..--.------.------------......-------------.....
ENSP00000380915  -.......DSYIVFTY..........RP-----..--.------.------------......-------------.....
ENSP00000427950  -.......DSYIVFTY..........RP-----..--.------.------------......-------------.....
ENSP00000428798  -.......DSYIVFTY..........RP-----..--.------.------------......-------------.....
ENSP00000430977  -.......DSYIVFTY..........RP-----..--.------.------------......-------------.....
ENSP00000390872  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000484600  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000418728  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000462038  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000356634  -.......--------..........-------..--.---LAG.AATWPWDKDAV-......THLGGIVLSPAYY.....
ENSP00000380806  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000420542  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000356633  -.......--------..........-------..--.REDLAG.AATWPWDKDAV-......THLGGIVLSPAYY.....
ENSP00000430832  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000462995  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000356633  -.......--------..........-------..--.-EDLAG.AATWPWDKDAV-......THLGGIVLSPAYY.....
ENSP00000356634  -.......--------..........-------..--.-EDLAG.AATWPWDKDAV-......THLGGIVLSPAYY.....
ENSP00000425758  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000469559  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000469901  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000414661  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000411451  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000462002  -.......--------..........-------..--.------.------------......-------------.....
ENSP00000308149  -.......--------..........-------..--.------.------------......-------------.....


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  .................................................................................
ENSP00000484606  .................................................................................
ENSP00000405088  .................................................................................
ENSP00000349581  .................................................................................
ENSP00000264205  .................................................................................
ENSP00000364028  .................................................................................
ENSP00000353679  .................................................................................
ENSP00000417079  .................................................................................
ENSP00000418525  .................................................................................
ENSP00000419653  .................................................................................
ENSP00000420389  .................................................................................
ENSP00000478173  .................................................................................
ENSP00000352052  .................................................................................
ENSP00000385846  .................................................................................
ENSP00000350066  .................................................................................
ENSP00000384223  .................................................................................
ENSP00000290863  .................................................................................
ENSP00000387760  .................................................................................
ENSP00000464149  .................................................................................
ENSP00000397593  .................................................................................
ENSP00000290866  .................................................................................
ENSP00000388439  .................................................................................
ENSP00000397593  .................................................................................
ENSP00000290866  .................................................................................
ENSP00000302051  .................................................................................
ENSP00000386333  .................................................................................
ENSP00000368682  .................................................................................
ENSP00000398444  .................................................................................
ENSP00000252519  .................................................................................
ENSP00000389326  .................................................................................
ENSP00000392247  .................................................................................
ENSP00000304467  .................................................................................
ENSP00000370372  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000423214  .................................................................................
ENSP00000467226  .................................................................................
ENSP00000347409  .................................................................................
ENSP00000477793  .................................................................................
ENSP00000425477  .................................................................................
ENSP00000410926  .................................................................................
ENSP00000418324  .................................................................................
ENSP00000371607  .................................................................................
ENSP00000328829  .................................................................................
ENSP00000328611  .................................................................................
ENSP00000462909  .................................................................................
ENSP00000427417  .................................................................................
ENSP00000433287  .................................................................................
ENSP00000320324  .................................................................................
ENSP00000265162  .................................................................................
ENSP00000300060  .................................................................................
ENSP00000406304  .................................................................................
ENSP00000296754  .................................................................................
ENSP00000231368  .................................................................................
ENSP00000379117  .................................................................................
ENSP00000426959  .................................................................................
ENSP00000228740  .................................................................................
ENSP00000421175  .................................................................................
ENSP00000400376  .................................................................................
ENSP00000369235  .................................................................................
ENSP00000261180  .................................................................................
ENSP00000395051  .................................................................................
ENSP00000449958  .................................................................................
ENSP00000421849  .................................................................................
ENSP00000465855  .................................................................................
ENSP00000462280  .................................................................................
ENSP00000423604  .................................................................................
ENSP00000378899  .................................................................................
ENSP00000350541  .................................................................................
ENSP00000309968  .................................................................................
ENSP00000412683  .................................................................................
ENSP00000393699  .................................................................................
ENSP00000265769  .................................................................................
ENSP00000295640  .................................................................................
ENSP00000357665  .................................................................................
ENSP00000357668  .................................................................................
ENSP00000389602  .................................................................................
ENSP00000418737  .................................................................................
ENSP00000369249  .................................................................................
ENSP00000418437  .................................................................................
ENSP00000419446  .................................................................................
ENSP00000453043  .................................................................................
ENSP00000453855  .................................................................................
ENSP00000453302  .................................................................................
ENSP00000322550  .................................................................................
ENSP00000348912  .................................................................................
ENSP00000369190  .................................................................................
ENSP00000270357  .................................................................................
ENSP00000422937  .................................................................................
ENSP00000257527  .................................................................................
ENSP00000428654  .................................................................................
ENSP00000061240  .................................................................................
ENSP00000426082  .................................................................................
ENSP00000373472  .................................................................................
ENSP00000175238  .................................................................................
ENSP00000370166  .................................................................................
ENSP00000466653  .................................................................................
ENSP00000350630  .................................................................................
ENSP00000428665  .................................................................................
ENSP00000430406  .................................................................................
ENSP00000306121  .................................................................................
ENSP00000428332  .................................................................................
ENSP00000482883  .................................................................................
ENSP00000299855  .................................................................................
ENSP00000370443  .................................................................................
ENSP00000305714  .................................................................................
ENSP00000260302  .................................................................................
ENSP00000339672  .................................................................................
ENSP00000356255  .................................................................................
ENSP00000322788  .................................................................................
ENSP00000435639  .................................................................................
ENSP00000418735  .................................................................................
ENSP00000260228  .................................................................................
ENSP00000458585  .................................................................................
ENSP00000270328  .................................................................................
ENSP00000471851  .................................................................................
ENSP00000476000  .................................................................................
ENSP00000353892  .................................................................................
ENSP00000271836  .................................................................................
ENSP00000357397  .................................................................................
ENSP00000432347  .................................................................................
ENSP00000434227  .................................................................................
ENSP00000432927  .................................................................................
ENSP00000349436  .................................................................................
ENSP00000403843  .................................................................................
ENSP00000348227  .................................................................................
ENSP00000352226  .................................................................................
ENSP00000246186  .................................................................................
ENSP00000344847  .................................................................................
ENSP00000422554  .................................................................................
ENSP00000401004  .................................................................................
ENSP00000427573  .................................................................................
ENSP00000279441  .................................................................................
ENSP00000260227  .................................................................................
ENSP00000236826  .................................................................................
ENSP00000300762  .................................................................................
ENSP00000369753  .................................................................................
ENSP00000378911  .................................................................................
ENSP00000448341  .................................................................................
ENSP00000484172  .................................................................................
ENSP00000374071  .................................................................................
ENSP00000256389  .................................................................................
ENSP00000286614  .................................................................................
ENSP00000308208  .................................................................................
ENSP00000465895  .................................................................................
ENSP00000421631  .................................................................................
ENSP00000419217  .................................................................................
ENSP00000282849  .................................................................................
ENSP00000260229  .................................................................................
ENSP00000215743  .................................................................................
ENSP00000483349  .................................................................................
ENSP00000274181  .................................................................................
ENSP00000299164  .................................................................................
ENSP00000284987  .................................................................................
ENSP00000474385  .................................................................................
ENSP00000284984  .................................................................................
ENSP00000435966  .................................................................................
ENSP00000219271  .................................................................................
ENSP00000369238  .................................................................................
ENSP00000484817  .................................................................................
ENSP00000407614  .................................................................................
ENSP00000269202  .................................................................................
ENSP00000463280  .................................................................................
ENSP00000260408  .................................................................................
ENSP00000356975  .................................................................................
ENSP00000430400  .................................................................................
ENSP00000420101  .................................................................................
ENSP00000265707  .................................................................................
ENSP00000482348  .................................................................................
ENSP00000352177  .................................................................................
ENSP00000384229  .................................................................................
ENSP00000414544  .................................................................................
ENSP00000423517  .................................................................................
ENSP00000478469  .................................................................................
ENSP00000484862  .................................................................................
ENSP00000268070  .................................................................................
ENSP00000428993  .................................................................................
ENSP00000256412  .................................................................................
ENSP00000429352  .................................................................................
ENSP00000478636  .................................................................................
ENSP00000483607  .................................................................................
ENSP00000265708  .................................................................................
ENSP00000482337  .................................................................................
ENSP00000257359  .................................................................................
ENSP00000408070  .................................................................................
ENSP00000274487  .................................................................................
ENSP00000362304  .................................................................................
ENSP00000464428  .................................................................................
ENSP00000343674  .................................................................................
ENSP00000274609  .................................................................................
ENSP00000465537  .................................................................................
ENSP00000295903  .................................................................................
ENSP00000230588  .................................................................................
ENSP00000443773  .................................................................................
ENSP00000480465  .................................................................................
ENSP00000251582  .................................................................................
ENSP00000200557  .................................................................................
ENSP00000362303  .................................................................................
ENSP00000264377  .................................................................................
ENSP00000363536  .................................................................................
ENSP00000378638  .................................................................................
ENSP00000286657  .................................................................................
ENSP00000480055  .................................................................................
ENSP00000337816  .................................................................................
ENSP00000464786  .................................................................................
ENSP00000381261  .................................................................................
ENSP00000381260  .................................................................................
ENSP00000381262  .................................................................................
ENSP00000265727  .................................................................................
ENSP00000381267  .................................................................................
ENSP00000343854  .................................................................................
ENSP00000484999  .................................................................................
ENSP00000358407  .................................................................................
ENSP00000313437  .................................................................................
ENSP00000353767  .................................................................................
ENSP00000479124  .................................................................................
ENSP00000483299  .................................................................................
ENSP00000348308  .................................................................................
ENSP00000482367  .................................................................................
ENSP00000403404  .................................................................................
ENSP00000401854  .................................................................................
ENSP00000481051  .................................................................................
ENSP00000473853  .................................................................................
ENSP00000484430  .................................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  .................................................................................
ENSP00000364464  .................................................................................
ENSP00000347927  .................................................................................
ENSP00000360997  .................................................................................
ENSP00000429557  .................................................................................
ENSP00000361405  gvvvptrfgnadgaachfpfifegrsysacttdgrsdglpwcsttanydtddrfgfcpserlytqdgnadgkpcqfpfifq
ENSP00000360979  .................................................................................
ENSP00000435274  .................................................................................
ENSP00000346941  .................................................................................
ENSP00000428249  .................................................................................
ENSP00000348997  .................................................................................
ENSP00000369195  .................................................................................
ENSP00000446979  .................................................................................
ENSP00000329614  .................................................................................
ENSP00000380805  .................................................................................
ENSP00000380813  .................................................................................
ENSP00000219070  gqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcphealftmggnaegqpckfpfrfq
ENSP00000444143  gqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcphealftmggnaegqpckfpfrfq
ENSP00000461421  gqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcphealftmggnaegqpckfpfrfq
ENSP00000394237  gqvvrvkygnadgeyckfpflfngkeynsctdtgrsdgflwcsttynfekdgkygfcphealftmggnaegqpckfpfrfq
ENSP00000436733  .................................................................................
ENSP00000442104  .................................................................................
ENSP00000456096  .................................................................................
ENSP00000357798  .................................................................................
ENSP00000429422  .................................................................................
ENSP00000483377  .................................................................................
ENSP00000405978  .................................................................................
ENSP00000420011  .................................................................................
ENSP00000453952  .................................................................................
ENSP00000417595  .................................................................................
ENSP00000423780  .................................................................................
ENSP00000435305  .................................................................................
ENSP00000340675  .................................................................................
ENSP00000426265  .................................................................................
ENSP00000465545  .................................................................................
ENSP00000482854  .................................................................................
ENSP00000277198  .................................................................................
ENSP00000457949  .................................................................................
ENSP00000484562  .................................................................................
ENSP00000431856  .................................................................................
ENSP00000462599  .................................................................................
ENSP00000405867  .................................................................................
ENSP00000457084  .................................................................................
ENSP00000431065  .................................................................................
ENSP00000419889  .................................................................................
ENSP00000461938  .................................................................................
ENSP00000427418  .................................................................................
ENSP00000427500  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000427574  .................................................................................
ENSP00000456518  .................................................................................
ENSP00000418886  .................................................................................
ENSP00000441485  .................................................................................
ENSP00000380808  .................................................................................
ENSP00000391334  .................................................................................
ENSP00000391268  .................................................................................
ENSP00000418791  .................................................................................
ENSP00000463673  .................................................................................
ENSP00000402171  .................................................................................
ENSP00000369182  .................................................................................
ENSP00000480574  .................................................................................
ENSP00000297979  .................................................................................
ENSP00000447822  .................................................................................
ENSP00000436633  .................................................................................
ENSP00000453545  .................................................................................
ENSP00000386625  .................................................................................
ENSP00000356974  .................................................................................
ENSP00000352976  .................................................................................
ENSP00000376481  .................................................................................
ENSP00000463012  .................................................................................
ENSP00000464133  .................................................................................
ENSP00000464635  .................................................................................
ENSP00000483162  .................................................................................
ENSP00000441710  .................................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  .................................................................................
ENSP00000423748  .................................................................................
ENSP00000352831  .................................................................................
ENSP00000330658  .................................................................................
ENSP00000446989  .................................................................................
ENSP00000367945  .................................................................................
ENSP00000482664  .................................................................................
ENSP00000380915  .................................................................................
ENSP00000427950  .................................................................................
ENSP00000428798  .................................................................................
ENSP00000430977  .................................................................................
ENSP00000390872  .................................................................................
ENSP00000484600  .................................................................................
ENSP00000418728  .................................................................................
ENSP00000462038  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000380806  .................................................................................
ENSP00000420542  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000430832  .................................................................................
ENSP00000462995  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000425758  .................................................................................
ENSP00000469559  .................................................................................
ENSP00000469901  .................................................................................
ENSP00000414661  .................................................................................
ENSP00000411451  .................................................................................
ENSP00000462002  .................................................................................
ENSP00000308149  .................................................................................


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  .................................................................................
ENSP00000484606  .................................................................................
ENSP00000405088  .................................................................................
ENSP00000349581  .................................................................................
ENSP00000264205  .................................................................................
ENSP00000364028  .................................................................................
ENSP00000353679  .................................................................................
ENSP00000417079  .................................................................................
ENSP00000418525  .................................................................................
ENSP00000419653  .................................................................................
ENSP00000420389  .................................................................................
ENSP00000478173  .................................................................................
ENSP00000352052  .................................................................................
ENSP00000385846  .................................................................................
ENSP00000350066  .................................................................................
ENSP00000384223  .................................................................................
ENSP00000290863  .................................................................................
ENSP00000387760  .................................................................................
ENSP00000464149  .................................................................................
ENSP00000397593  .................................................................................
ENSP00000290866  .................................................................................
ENSP00000388439  .................................................................................
ENSP00000397593  .................................................................................
ENSP00000290866  .................................................................................
ENSP00000302051  .................................................................................
ENSP00000386333  .................................................................................
ENSP00000368682  .................................................................................
ENSP00000398444  .................................................................................
ENSP00000252519  .................................................................................
ENSP00000389326  .................................................................................
ENSP00000392247  .................................................................................
ENSP00000304467  .................................................................................
ENSP00000370372  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000423214  .................................................................................
ENSP00000467226  .................................................................................
ENSP00000347409  .................................................................................
ENSP00000477793  .................................................................................
ENSP00000425477  .................................................................................
ENSP00000410926  .................................................................................
ENSP00000418324  .................................................................................
ENSP00000371607  .................................................................................
ENSP00000328829  .................................................................................
ENSP00000328611  .................................................................................
ENSP00000462909  .................................................................................
ENSP00000427417  .................................................................................
ENSP00000433287  .................................................................................
ENSP00000320324  .................................................................................
ENSP00000265162  .................................................................................
ENSP00000300060  .................................................................................
ENSP00000406304  .................................................................................
ENSP00000296754  .................................................................................
ENSP00000231368  .................................................................................
ENSP00000379117  .................................................................................
ENSP00000426959  .................................................................................
ENSP00000228740  .................................................................................
ENSP00000421175  .................................................................................
ENSP00000400376  .................................................................................
ENSP00000369235  .................................................................................
ENSP00000261180  .................................................................................
ENSP00000395051  .................................................................................
ENSP00000449958  .................................................................................
ENSP00000421849  .................................................................................
ENSP00000465855  .................................................................................
ENSP00000462280  .................................................................................
ENSP00000423604  .................................................................................
ENSP00000378899  .................................................................................
ENSP00000350541  .................................................................................
ENSP00000309968  .................................................................................
ENSP00000412683  .................................................................................
ENSP00000393699  .................................................................................
ENSP00000265769  .................................................................................
ENSP00000295640  .................................................................................
ENSP00000357665  .................................................................................
ENSP00000357668  .................................................................................
ENSP00000389602  .................................................................................
ENSP00000418737  .................................................................................
ENSP00000369249  .................................................................................
ENSP00000418437  .................................................................................
ENSP00000419446  .................................................................................
ENSP00000453043  .................................................................................
ENSP00000453855  .................................................................................
ENSP00000453302  .................................................................................
ENSP00000322550  .................................................................................
ENSP00000348912  .................................................................................
ENSP00000369190  .................................................................................
ENSP00000270357  .................................................................................
ENSP00000422937  .................................................................................
ENSP00000257527  .................................................................................
ENSP00000428654  .................................................................................
ENSP00000061240  .................................................................................
ENSP00000426082  .................................................................................
ENSP00000373472  .................................................................................
ENSP00000175238  .................................................................................
ENSP00000370166  .................................................................................
ENSP00000466653  .................................................................................
ENSP00000350630  .................................................................................
ENSP00000428665  .................................................................................
ENSP00000430406  .................................................................................
ENSP00000306121  .................................................................................
ENSP00000428332  .................................................................................
ENSP00000482883  .................................................................................
ENSP00000299855  .................................................................................
ENSP00000370443  .................................................................................
ENSP00000305714  .................................................................................
ENSP00000260302  .................................................................................
ENSP00000339672  .................................................................................
ENSP00000356255  .................................................................................
ENSP00000322788  .................................................................................
ENSP00000435639  .................................................................................
ENSP00000418735  .................................................................................
ENSP00000260228  .................................................................................
ENSP00000458585  .................................................................................
ENSP00000270328  .................................................................................
ENSP00000471851  .................................................................................
ENSP00000476000  .................................................................................
ENSP00000353892  .................................................................................
ENSP00000271836  .................................................................................
ENSP00000357397  .................................................................................
ENSP00000432347  .................................................................................
ENSP00000434227  .................................................................................
ENSP00000432927  .................................................................................
ENSP00000349436  .................................................................................
ENSP00000403843  .................................................................................
ENSP00000348227  .................................................................................
ENSP00000352226  .................................................................................
ENSP00000246186  .................................................................................
ENSP00000344847  .................................................................................
ENSP00000422554  .................................................................................
ENSP00000401004  .................................................................................
ENSP00000427573  .................................................................................
ENSP00000279441  .................................................................................
ENSP00000260227  .................................................................................
ENSP00000236826  .................................................................................
ENSP00000300762  .................................................................................
ENSP00000369753  .................................................................................
ENSP00000378911  .................................................................................
ENSP00000448341  .................................................................................
ENSP00000484172  .................................................................................
ENSP00000374071  .................................................................................
ENSP00000256389  .................................................................................
ENSP00000286614  .................................................................................
ENSP00000308208  .................................................................................
ENSP00000465895  .................................................................................
ENSP00000421631  .................................................................................
ENSP00000419217  .................................................................................
ENSP00000282849  .................................................................................
ENSP00000260229  .................................................................................
ENSP00000215743  .................................................................................
ENSP00000483349  .................................................................................
ENSP00000274181  .................................................................................
ENSP00000299164  .................................................................................
ENSP00000284987  .................................................................................
ENSP00000474385  .................................................................................
ENSP00000284984  .................................................................................
ENSP00000435966  .................................................................................
ENSP00000219271  .................................................................................
ENSP00000369238  .................................................................................
ENSP00000484817  .................................................................................
ENSP00000407614  .................................................................................
ENSP00000269202  .................................................................................
ENSP00000463280  .................................................................................
ENSP00000260408  .................................................................................
ENSP00000356975  .................................................................................
ENSP00000430400  .................................................................................
ENSP00000420101  .................................................................................
ENSP00000265707  .................................................................................
ENSP00000482348  .................................................................................
ENSP00000352177  .................................................................................
ENSP00000384229  .................................................................................
ENSP00000414544  .................................................................................
ENSP00000423517  .................................................................................
ENSP00000478469  .................................................................................
ENSP00000484862  .................................................................................
ENSP00000268070  .................................................................................
ENSP00000428993  .................................................................................
ENSP00000256412  .................................................................................
ENSP00000429352  .................................................................................
ENSP00000478636  .................................................................................
ENSP00000483607  .................................................................................
ENSP00000265708  .................................................................................
ENSP00000482337  .................................................................................
ENSP00000257359  .................................................................................
ENSP00000408070  .................................................................................
ENSP00000274487  .................................................................................
ENSP00000362304  .................................................................................
ENSP00000464428  .................................................................................
ENSP00000343674  .................................................................................
ENSP00000274609  .................................................................................
ENSP00000465537  .................................................................................
ENSP00000295903  .................................................................................
ENSP00000230588  .................................................................................
ENSP00000443773  .................................................................................
ENSP00000480465  .................................................................................
ENSP00000251582  .................................................................................
ENSP00000200557  .................................................................................
ENSP00000362303  .................................................................................
ENSP00000264377  .................................................................................
ENSP00000363536  .................................................................................
ENSP00000378638  .................................................................................
ENSP00000286657  .................................................................................
ENSP00000480055  .................................................................................
ENSP00000337816  .................................................................................
ENSP00000464786  .................................................................................
ENSP00000381261  .................................................................................
ENSP00000381260  .................................................................................
ENSP00000381262  .................................................................................
ENSP00000265727  .................................................................................
ENSP00000381267  .................................................................................
ENSP00000343854  .................................................................................
ENSP00000484999  .................................................................................
ENSP00000358407  .................................................................................
ENSP00000313437  .................................................................................
ENSP00000353767  .................................................................................
ENSP00000479124  .................................................................................
ENSP00000483299  .................................................................................
ENSP00000348308  .................................................................................
ENSP00000482367  .................................................................................
ENSP00000403404  .................................................................................
ENSP00000401854  .................................................................................
ENSP00000481051  .................................................................................
ENSP00000473853  .................................................................................
ENSP00000484430  .................................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  .................................................................................
ENSP00000364464  .................................................................................
ENSP00000347927  .................................................................................
ENSP00000360997  .................................................................................
ENSP00000429557  .................................................................................
ENSP00000361405  gqsysacttdgrsdgyrwcattanydrdklfgfcptradstvmggnsagelcvfpftflgkeystctsegrgdgrlwcatt
ENSP00000360979  .................................................................................
ENSP00000435274  .................................................................................
ENSP00000346941  .................................................................................
ENSP00000428249  .................................................................................
ENSP00000348997  .................................................................................
ENSP00000369195  .................................................................................
ENSP00000446979  .................................................................................
ENSP00000329614  .................................................................................
ENSP00000380805  .................................................................................
ENSP00000380813  .................................................................................
ENSP00000219070  gtsydscttegrtdgyrwcgttedydrdkkygfcpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcatta
ENSP00000444143  gtsydscttegrtdgyrwcgttedydrdkkygfcpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcatta
ENSP00000461421  gtsydscttegrtdgyrwcgttedydrdkkygfcpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcatta
ENSP00000394237  gtsydscttegrtdgyrwcgttedydrdkkygfcpetamstvggnsegapcvfpftflgnkyesctsagrsdgkmwcatta
ENSP00000436733  .................................................................................
ENSP00000442104  .................................................................................
ENSP00000456096  .................................................................................
ENSP00000357798  .................................................................................
ENSP00000429422  .................................................................................
ENSP00000483377  .................................................................................
ENSP00000405978  .................................................................................
ENSP00000420011  .................................................................................
ENSP00000453952  .................................................................................
ENSP00000417595  .................................................................................
ENSP00000423780  .................................................................................
ENSP00000435305  .................................................................................
ENSP00000340675  .................................................................................
ENSP00000426265  .................................................................................
ENSP00000465545  .................................................................................
ENSP00000482854  .................................................................................
ENSP00000277198  .................................................................................
ENSP00000457949  .................................................................................
ENSP00000484562  .................................................................................
ENSP00000431856  .................................................................................
ENSP00000462599  .................................................................................
ENSP00000405867  .................................................................................
ENSP00000457084  .................................................................................
ENSP00000431065  .................................................................................
ENSP00000419889  .................................................................................
ENSP00000461938  .................................................................................
ENSP00000427418  .................................................................................
ENSP00000427500  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000427574  .................................................................................
ENSP00000456518  .................................................................................
ENSP00000418886  .................................................................................
ENSP00000441485  .................................................................................
ENSP00000380808  .................................................................................
ENSP00000391334  .................................................................................
ENSP00000391268  .................................................................................
ENSP00000418791  .................................................................................
ENSP00000463673  .................................................................................
ENSP00000402171  .................................................................................
ENSP00000369182  .................................................................................
ENSP00000480574  .................................................................................
ENSP00000297979  .................................................................................
ENSP00000447822  .................................................................................
ENSP00000436633  .................................................................................
ENSP00000453545  .................................................................................
ENSP00000386625  .................................................................................
ENSP00000356974  .................................................................................
ENSP00000352976  .................................................................................
ENSP00000376481  .................................................................................
ENSP00000463012  .................................................................................
ENSP00000464133  .................................................................................
ENSP00000464635  .................................................................................
ENSP00000483162  .................................................................................
ENSP00000441710  .................................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  .................................................................................
ENSP00000423748  .................................................................................
ENSP00000352831  .................................................................................
ENSP00000330658  .................................................................................
ENSP00000446989  .................................................................................
ENSP00000367945  .................................................................................
ENSP00000482664  .................................................................................
ENSP00000380915  .................................................................................
ENSP00000427950  .................................................................................
ENSP00000428798  .................................................................................
ENSP00000430977  .................................................................................
ENSP00000390872  .................................................................................
ENSP00000484600  .................................................................................
ENSP00000418728  .................................................................................
ENSP00000462038  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000380806  .................................................................................
ENSP00000420542  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000430832  .................................................................................
ENSP00000462995  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000425758  .................................................................................
ENSP00000469559  .................................................................................
ENSP00000469901  .................................................................................
ENSP00000414661  .................................................................................
ENSP00000411451  .................................................................................
ENSP00000462002  .................................................................................
ENSP00000308149  .................................................................................


                            160                      170          180       190       200       210 
                              |                        |            |         |         |         | 
d1sata2            ........NVKHPAT...............EDYGRQTF...THEIGHALGLSHPGDYNAGEGDPTYADVTYAEDTRQFSLM
ENSP00000367668  ........-------...............--------...--E-------------------------------------
ENSP00000484606  ........-------...............--------...--E-------------------------------------
ENSP00000405088  ........-------...............------V-...----------------------------------------
ENSP00000349581  ........-------...............------V-...----------------------------------------
ENSP00000264205  ........-------...............------V-...----------------------------------------
ENSP00000364028  ........-------...............------V-...----------------------------------------
ENSP00000353679  ........-------...............--------...----------------------------------------
ENSP00000417079  ........-------...............--------...----------------------------------------
ENSP00000418525  ........-------...............--------...----------------------------------------
ENSP00000419653  ........-------...............--------...----------------------------------------
ENSP00000420389  ........-------...............--------...----------------------------------------
ENSP00000478173  ........-------...............--------...----------------------------------------
ENSP00000352052  ........-------...............--------...----------------------------------------
ENSP00000385846  ........-------...............--------...----------------------------------------
ENSP00000350066  ........-------...............--------...----------------------------------------
ENSP00000384223  ........-------...............--------...----------------------------------------
ENSP00000290863  ........-------...............NLEDLVVA...HHEMGHI---------------------------------
ENSP00000387760  ........-------...............NLEDLVVA...HHEMGHI---------------------------------
ENSP00000464149  ........-------...............NLEDLVVA...HHEMGHI---------------------------------
ENSP00000397593  ........-------...............NLEDLVVA...HHEMGHI---------------------------------
ENSP00000290866  ........-------...............NLEDLVVA...HHEMGHI---------------------------------
ENSP00000388439  ........-------...............------V-...----------------------------------------
ENSP00000397593  ........-------...............TMDQLSTV...HHEMGHI---------------------------------
ENSP00000290866  ........-------...............TMDQLSTV...HHEMGHI---------------------------------
ENSP00000302051  ........-------...............--------...----------------------------------------
ENSP00000386333  ........-------...............--------...----------------------------------------
ENSP00000368682  ........-------...............--------...----------------------------------------
ENSP00000398444  ........-------...............--------...----------------------------------------
ENSP00000252519  ........-------...............TMDDFLTA...HHEMGH----------------------------------
ENSP00000389326  ........-------...............TMDDFLTA...HHEMGH----------------------------------
ENSP00000392247  ........-------...............NLEDLVVA...HHEMGHI---------------------------------
ENSP00000304467  ........NFTKPTAdapsll.........QHDEVETY...FHEFGHVM--------------------------------
ENSP00000370372  ........VAGRPSLl..............RHDEVRTY...FHEFGHVM--------------------------------
ENSP00000422492  ........-------...............--------...----------------------------------------
ENSP00000482173  ........-------...............--------...----------------------------------------
ENSP00000423214  ........VAGRPSLl..............RHDEVRTY...FHEFGHVM--------------------------------
ENSP00000467226  ........NFTKPTAdapsll.........QHDEVETY...FHEFGHVM--------------------------------
ENSP00000347409  ........-------...............--------...----------------------------------------
ENSP00000477793  ........-------...............--------...----------------------------------------
ENSP00000425477  ........-------...............--------...----------------------------------------
ENSP00000410926  ........-----QE...............FVGMLSTV...KHEVIHALGFS-----------------------------
ENSP00000418324  ........-----QE...............FVGMLSTV...KHEVIHALGFS-----------------------------
ENSP00000371607  ........-------...............-------L...FHEMGHAM--------------------------------
ENSP00000328829  ........-----QE...............FVGMLSTV...KHEVIHALGFS-----------------------------
ENSP00000328611  ........-----QE...............FVGMLSTV...KHEVIHALGFS-----------------------------
ENSP00000462909  ........-------...............--------...----------------------------------------
ENSP00000427417  ........-------...............--------...----------------------------------------
ENSP00000433287  ........-------...............--------...----------------------------------------
ENSP00000320324  ........-------...............--------...----------------------------------------
ENSP00000265162  ........-------...............--RVATVV...AHEL------------------------------------
ENSP00000300060  ........----SSN...............KERVVTVI...AHELAH----------------------------------
ENSP00000406304  ........LFDAEKSsass...........KLGITMTV...AHELAH----------------------------------
ENSP00000296754  ........LFDAEKSsass...........KLGITMTV...AHELAH----------------------------------
ENSP00000231368  ........-------...............--------...----------------------------------------
ENSP00000379117  ........-------...............--------...----------------------------------------
ENSP00000426959  ........VAGRPSLl..............RHDEVRTY...FHEFGHVM--------------------------------
ENSP00000228740  ........-------...............DKSLSNVI...AHEISHS---------------------------------
ENSP00000421175  ........-------...............---VTRVI...AHELAH----------------------------------
ENSP00000400376  ........-------...............---VTRVI...AHELAH----------------------------------
ENSP00000369235  ........-------...............----TRVI...AHELAH----------------------------------
ENSP00000261180  ........-------...............LLDVTMVI...VHEICH----------------------------------
ENSP00000395051  ........-------...............DKSLSNVI...AHEISHS---------------------------------
ENSP00000449958  ........-------...............DKSLSNVI...AHEISHS---------------------------------
ENSP00000421849  ........-------...............---VTRVI...AHELAH----------------------------------
ENSP00000465855  ........-------...............QHDEVETY...FHEFGHVM--------------------------------
ENSP00000462280  ........-------...............--------...----------------------------------------
ENSP00000423604  ........LLEPKDQltek...........KTLISYVV...SHEIGHQ---------------------------------
ENSP00000378899  ........LLEPKDQltek...........KTLISYVV...SHEIGHQ---------------------------------
ENSP00000350541  ........LLEPKDQltek...........KTLISYVV...SHEIGHQ---------------------------------
ENSP00000309968  ........STKNYGKtil............TKEADLVT...THELGHNFGAEHDPDGLA-E--------------------
ENSP00000412683  ........-------...............--------...----------------------------------------
ENSP00000393699  ........-----DN...............LLRVAGTM...AHEMGHNFGMFHDD--------------------------
ENSP00000265769  ........-----DN...............LLRVAGTM...AHEMGHNFGMFHDD--------------------------
ENSP00000295640  ........-------...............--SLADVI...IHEISHS---------------------------------
ENSP00000357665  ........-----DN...............PLGAAVTL...AHELGHNFGMNHDT--------------------------
ENSP00000357668  ........-----DN...............PLGAAVTL...AHELGHNFGMNHDT--------------------------
ENSP00000389602  ........-------...............--SLADVI...IHEISHS---------------------------------
ENSP00000418737  ........NVFGQIT...............VETFASIV...AHELGHNLGMNHDDGRDCSC--------------------
ENSP00000369249  ........NVFGQIT...............VETFASIV...AHELGHNLGMNHDDGRDCSC--------------------
ENSP00000418437  ........NVFGQIT...............VETFASIV...AHELGHNLGMNHDDGRDCSC--------------------
ENSP00000419446  ........NVFGQIT...............VETFASIV...AHELGHNLGMNHDDGRDCSC--------------------
ENSP00000453043  ........-----KN...............PVGVACTM...AHEMGHNLGMDHDENVQ-----------------------
ENSP00000453855  ........-----KN...............PVGVACTM...AHEMGHNLGMDHDENVQ-----------------------
ENSP00000453302  ........-----KN...............PVGVACTM...AHEMGHNLGMDHDENVQ-----------------------
ENSP00000322550  ........-------...............PIGAAATM...AHEIGHSLGLSHDPDG------------------------
ENSP00000348912  ........-------...............PIGAAATM...AHEIGHSLGLSHDPDG------------------------
ENSP00000369190  ........-------...............PIGAAATM...AHEIGHSLGLSHDPDG------------------------
ENSP00000270357  ........-------...............--------...-------------WFGNA-VTNATW---------------
ENSP00000422937  ........-AISIGK...............NCDKFGIV...VHELGHVIGFWHEHTRPDRD--------------------
ENSP00000257527  ........-------...............AIGVAATM...AHEMGHNFGMTHDS--------------------------
ENSP00000428654  ........-------...............AIGVAATM...AHEMGHNFGMTHDS--------------------------
ENSP00000061240  ........-AISIGK...............NCDKFGIV...VHELGHVIGFWHEHTRPDRD--------------------
ENSP00000426082  ........-AISIGK...............NCDKFGIV...VHELGHVIGFWHEHTRPDRD--------------------
ENSP00000373472  ........CSINEDT...............GLPLAFTV...AHELGHSFGIQHDGSGND----------------------
ENSP00000175238  ........-------...............-------M...AHQLGHNLGMQHD---------------------------
ENSP00000370166  ........-------...............-------M...AHQLGHNLGMQHD---------------------------
ENSP00000466653  ........NFTKPTAdapsll.........QHDEVETY...FHEFGHVM--------------------------------
ENSP00000350630  ........-----GK...............NCDKFGIV...AHELGHVVGFWHEHTRPDRDQH------------------
ENSP00000428665  ........-----GK...............NCDKFGIV...VHELGHVVGFWHEHTRPDR---------------------
ENSP00000430406  ........-----GK...............NCDKFGIV...VHELGHVVGFWHEHTRPDR---------------------
ENSP00000306121  ........-----GK...............NCDKFGIV...VHELGHVVGFWHEHTRPDR---------------------
ENSP00000428332  ........-----GK...............NCDKFGIV...VHELGHVVGFWHEHTRPDR---------------------
ENSP00000482883  ........WTSS-SK...............GYNLFLVA...AHEFGHSLGLDHSKDPGA-LMFPIYT--------------
ENSP00000299855  ........WTKD-TT...............GTNLFLVA...AHEIGHSLGLFHSANTEA-LMYPLYHS-------------
ENSP00000370443  ........CSINEDI...............GLGSAFTI...AHEIGHNFGMNHDGIGNS-C--------------------
ENSP00000305714  ........-----GK...............NCDKFGIV...VHELGHVVGFWHEHTRPDR---------------------
ENSP00000260302  ........WTSS-SK...............GYNLFLVA...AHEFGHSLGLDHSKDPGA-LMFPIYT--------------
ENSP00000339672  ........WTSS-SK...............GYNLFLVA...AHEFGHSLGLDHSKDPGA-LMFPIYT--------------
ENSP00000356255  ........-------...............--SLADVI...IHEISHS---------------------------------
ENSP00000322788  ........WTNN-FR...............EYNLHRVA...AHELGHSLGLSHSTDIGA-LMYPSYT--------------
ENSP00000435639  ........-------...............--------...----------------------------------------
ENSP00000418735  ........CSISEDS...............GLSTAFTI...AHELGHVFNMPHDDNNKC----------------------
ENSP00000260228  ........WTMG-TN...............GFNLFTVA...AHEFGHALGLAHSTDPSA-LMYPTYK--------------
ENSP00000458585  ........WTTH-SG...............GTNLFLTA...VHEIGHSLGLGHSSDPKA-VMFPTYK--------------
ENSP00000270328  ........CSVNEDI...............GLATAFTI...AHEIGHTFGMNHDGVGNS-C--------------------
ENSP00000471851  ........CSVNEDI...............GLATAFTI...AHEIGHTFGMNHDGVGNS-C--------------------
ENSP00000476000  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000353892  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000271836  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000357397  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000432347  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000434227  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000432927  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000349436  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000403843  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000348227  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000352226  ........-------...............ILGVASSI...AHELGHSLGLDHDLPGNS----------------------
ENSP00000246186  ........WTLGNANhd.............GNDLFLVA...VHELGHALGLEHSSDPSA-IMAPFYQ--------------
ENSP00000344847  ........CNINEDS...............GLPLAFTI...AHELGHSFGIQHDGKEND----------------------
ENSP00000422554  ........CNINEDS...............GLPLAFTI...AHELGHSFGIQHDGKEND----------------------
ENSP00000401004  ........WTNT-SA...............NYNLFLVA...AHEFGHSLGLAHSSDPGA-LMYPNYA--------------
ENSP00000427573  ........-------...............--WVTRVI...AHELAH----------------------------------
ENSP00000279441  ........WTED-AS...............GTNLFLVA...AHELGHSLGLFHSANTEA-LMYPLYNS-------------
ENSP00000260227  ........WTDGSSL...............GINFLYAA...THELGHSLGMGHSSDPNA-VMYPTYG--------------
ENSP00000236826  ........WTNT-SA...............NYNLFLVA...AHEFGHSLGLAHSSDPGA-LMYPNYA--------------
ENSP00000300762  ........WSAS-DT...............GYNLFLVA...THEIGHSLGLQHSGNQSS-IMYPTYW--------------
ENSP00000369753  ........WSAS-DT...............GYNLFLVA...THEIGHSLGLQHSGNQSS-IMYPTYW--------------
ENSP00000378911  ........----EEK...............GLISAFTI...AHELGHTLGVQHDDNPRCKEMKVTKYH-------------
ENSP00000448341  ........----EEK...............GLISAFTI...AHELGHTLGVQHDDNPRCKEMKVTKYH-------------
ENSP00000484172  ........----EEK...............GLISAFTI...AHELGHTLGVQHDDNPRCKEMKVTKYH-------------
ENSP00000374071  ........----EEK...............GLISAFTI...AHELGHTLGVQHDDNPRCKEMKVTKYH-------------
ENSP00000256389  ........-----NR...............LVVFAITL...GHELGHNLGMQHDTQWCV----------------------
ENSP00000286614  ........WTLGNPNhd.............GNDLFLVA...VHELGHALGLEHSNDPTA-IMAPFYQ--------------
ENSP00000308208  ........WTVRNEDln.............GNDIFLVA...VHELGHALGLEHSSDPSA-IMAPFYQ--------------
ENSP00000465895  ........-------...............--DEVETY...FHEFGHVM--------------------------------
ENSP00000421631  ........CTINEDT...............GLGLAFTI...AHESGHNFGMIHDGEGNM----------------------
ENSP00000419217  ........CSISEDS...............GLSTAFTI...AHELGHVFNMPHDDNNKC----------------------
ENSP00000282849  ........CTINEDT...............GLGLAFTI...AHESGHNFGMIHDGEGNP----------------------
ENSP00000260229  ........WTKD-GA...............GFNLFLVA...AHEFGHALGLSHSNDQTA-LMFPNYV--------------
ENSP00000215743  ........WTIGDDQ...............GTDLLQVA...AHEFGHVLGLQHTTAAKA-LMSAFY---------------
ENSP00000483349  ........WTIGDDQ...............GTDLLQVA...AHEFGHVLGLQHTTAAKA-LMSAFY---------------
ENSP00000274181  ........CTINEDT...............GLGLAFTI...AHESGHNFGMIHDGEGNM----------------------
ENSP00000299164  ........-------...............----AFTT...AHELGHVFNMPHDN--------------------------
ENSP00000284987  ........AVIE-DD...............GLHAAFTV...AHEIGHLLGLSHDDSKFC----------------------
ENSP00000474385  ........-----DT...............WSLFANTV...AHELGHTLGMQHDEE-------------------------
ENSP00000284984  ........-------...............GLQAAFTT...AHELGHVFNMPHDDAKQC----------------------
ENSP00000435966  ........TCLSPQH...............KHWVALVV...GHELAH----------------------------------
ENSP00000219271  ........WTFSSTDlh.............GNNLFLVA...VHELGHALGLEHSSNPNA-IMAPFYQ--------------
ENSP00000369238  ........-------...............--------...----------------------------------------
ENSP00000484817  ........-------...............--------...----------------------------------------
ENSP00000407614  ........-------...............--SLADVI...IHEISHS---------------------------------
ENSP00000269202  ........-------...............NCDRIATV...QHEFLHALGFWHEQSRSDRDDYVRI-MWDRILSGREHNFN
ENSP00000463280  ........-------...............NCDRIATV...QHEFLHALGFWHEQSRSDRDDYVRI-MWDRILSGREHNFN
ENSP00000260408  ........------Vp..............PKVSHITF...AHEVGHNFGSPHDS--------------------------
ENSP00000356975  ........-----DD...............GLQSAFTA...AHELGHVFNMLHDNSKP-----------------------
ENSP00000430400  ........-------...............-------M...AHQLGHNLGMQHD---------------------------
ENSP00000420101  ........-------...............--------...----------------------------------------
ENSP00000265707  ........-------...............--------...----------------------------------------
ENSP00000482348  ........-------...............--------...----------------------------------------
ENSP00000352177  ........TFMNKTL...............GTFSIAVA...HH-LGHNLGMNHDEDT------------------------
ENSP00000384229  ........TFMNKTL...............GTFSIAVA...HH-LGHNLGMNHDEDT------------------------
ENSP00000414544  ........TFMNKTL...............GTFSIAVA...HH-LGHNLGMNHDEDT------------------------
ENSP00000423517  ........TFMNKTL...............GTFSIAVA...HH-LGHNLGMNHDEDT------------------------
ENSP00000478469  ........TFMNKTL...............GTFSIAVA...HH-LGHNLGMNHDEDT------------------------
ENSP00000484862  ........TFMNKTL...............GTFSIAVA...HH-LGHNLGMNHDEDT------------------------
ENSP00000268070  ........CVLAEDN...............GLNLAFTI...AHELGHNLGMNHDDDHSSC---------------------
ENSP00000428993  ........LAASNSLcspssvavieakkknNVALVGVM...SHELGHVLGM------------------------------
ENSP00000256412  ........LAASNSLcspssvavieakkknNVALVGVM...SHELGHVLGM------------------------------
ENSP00000429352  ........-------...............-------F...----------------------------------------
ENSP00000478636  ........-------...............-------F...----------------------------------------
ENSP00000483607  ........-------...............-------F...----------------------------------------
ENSP00000265708  ........-------...............-------F...----------------------------------------
ENSP00000482337  ........-------...............-------F...----------------------------------------
ENSP00000257359  ........-----DE...............GLQAAHTL...AHELGHVLSMPHDDSKPC----------------------
ENSP00000408070  ........WTIGDDQ...............GTDLLQVA...AHEFGHVLGLQHTTAAKA-LMSAFY---------------
ENSP00000274487  ........CIIAEDN...............GLNLAFTI...AHEMGHNMGINHDNDHPS----------------------
ENSP00000362304  ........--LNHED...............GFSSAFVI...AHETGHVLGMEHDGQGNG----------------------
ENSP00000464428  ........-------...............--------...----------------------------------------
ENSP00000343674  ........-------...............LQKGRGIV...LHELMHVLGFWHEHTRADRDRYIR----------------
ENSP00000274609  ........CTLNHED...............GFSSAFVV...AHETGHVLGMEHDGQGNR----------------------
ENSP00000465537  ........-------...............--------...----------------------------------------
ENSP00000295903  ........CSISEDS...............GLSTAFTI...AHELGHVFNMPHDDNNKC----------------------
ENSP00000230588  ........-NISIGQ...............GCAYKAII...EHEILHALGFYHEQSRTDRDDYVNIW-WDQILSGYQHNFD
ENSP00000443773  ........-------...............--------...----------------------------------------
ENSP00000480465  ........-NISIGQ...............GCAYKAII...EHEILHALGFYHEQSRTDRDDYVNIW-WDQILSGYQHNFD
ENSP00000251582  ........CTLNHED...............GFSSAFVV...AHETGHVLGMEHDGQGNR----------------------
ENSP00000200557  ........-------...............--------...----------------------------------------
ENSP00000362303  ........----HED...............GFSSAFVI...AHETGHVLGMEHDGQGNG----------------------
ENSP00000264377  ........-------...............--------...----------------------------------------
ENSP00000363536  ........-------...............--------...----------------------------------------
ENSP00000378638  ........-------...............--------...----------------------------------------
ENSP00000286657  ........CTLNHED...............GFSSAFVV...AHETGHVLGMEHDGQGNR----------------------
ENSP00000480055  ........CTLNHED...............GFSSAFVV...AHETGHVLGMEHDGQGNR----------------------
ENSP00000337816  ........WTFGSKDge.............GTDLFAVA...VHEFGHALGLGHSSAPNS-IMRPFYQ--------------
ENSP00000464786  ........-------...............--------...----------------------------------------
ENSP00000381261  ........-------...............--------...----------------------------------------
ENSP00000381260  ........-------...............--------...----------------------------------------
ENSP00000381262  ........-------...............--------...----------------------------------------
ENSP00000265727  ........-------...............--------...----------------------------------------
ENSP00000381267  ........-------...............--------...----------------------------------------
ENSP00000343854  ........-------...............--------...----------------------------------------
ENSP00000484999  ........-------...............--------...----------------------------------------
ENSP00000358407  ........GSVSTLL...............DTNILAPAtwsAHELGHAVGMSHDEQYCQ-CRGRL--NCIMGSGRTGFSNC
ENSP00000313437  ........WTEGTYR...............GVNLRIIA...AHEVGHALGLGHSRYSQA-LMAPVYE--------------
ENSP00000353767  ........WTFRSSDah.............GMDLFAVA...VHEFGHAIGLSHVAAAHS-IMRPYYQ--------------
ENSP00000479124  ........WSLSRRR...............GRNLFVVL...AHEIGHTLGLTHSPAPRA-LMAPYYK--------------
ENSP00000483299  ........WSLSRRR...............GRNLFVVL...AHEIGHTLGLTHSPAPRA-LMAPYYK--------------
ENSP00000348308  ........WVLGPTRyswkkgvw.......LTDLVHVA...AHEIGHALGLMHSQHGRA-LMHLN----------------
ENSP00000482367  ........WVLGPTRyswkkgvw.......LTDLVHVA...AHEIGHALGLMHSQHGRA-LMHLN----------------
ENSP00000403404  ........-------...............GLQAAFTT...AHELGHVFNMPHDDA-------------------------
ENSP00000401854  ........-------...............-------L...CHEIAHA---------------------------------
ENSP00000481051  ........WSLSRRR...............GRNLFVVL...AHEIGHTLGLTHSPAPRA-LMAPYYK--------------
ENSP00000473853  ........WSLSRRR...............GRNLFVVL...AHEIGHTLGLTHSPAPRA-LMAPYYK--------------
ENSP00000484430  ........WSLSRRR...............GRNLFVVL...AHEIGHTLGLTHSPAPRA-LMAPYYK--------------
ENSP00000444603  ........WTFRSSDah.............GMDLFAVA...VHEFGHAIGLSHVAAAHS-IMRPYYQ--------------
ENSP00000441106  ........WTFRSSDah.............GMDLFAVA...VHEFGHAIGLSHVAAAHS-IMRPYYQ--------------
ENSP00000364464  ........-------...............-------L...CHEIAHA---------------------------------
ENSP00000347927  ........CLITEDT...............GFDLGVTI...AHEIGHSFGLEHDGAPGSGCG-------------------
ENSP00000360997  ........CLITEDT...............GFDLGVTI...AHEIGHSFGLEHDGAPGSGCG-------------------
ENSP00000429557  ........-------...............GLQAAFTT...AHELGHVFNMPHDDAKQ-----------------------
ENSP00000361405  snfdsdkkWGFCPDQ...............GYSLFLVA...AHEFGHALGLDHSSVPEA-LMYPMYR--------------
ENSP00000360979  ........CLITEDT...............GFDLGVTI...AHEIGHSFGLEHDGAPGSGCG-------------------
ENSP00000435274  ........CLITEDT...............GFDLGVTI...AHEIGHSFGLEHDGAPGSGCG-------------------
ENSP00000346941  ........-----GK...............NCDKFGIV...VHELGHVVGFWHEHTRPD----------------------
ENSP00000428249  ........-----GK...............NCDKFGIV...VHELGHVVGFWHEHTRPD----------------------
ENSP00000348997  ........CLITEDT...............GFDLGVTI...AHEIGHSFGLEHDGAPGSGCG-------------------
ENSP00000369195  ........-------...............--------...----------------------------------------
ENSP00000446979  ........WTEGTYR...............GVNLRIIA...AHEVGHALGLGHSRYSQA-LMAPVYE--------------
ENSP00000329614  ........FHQCKENedy............NDVLTVTA...THGLCHLLGFTHGTEAEWQQMFQ-----------------
ENSP00000380805  ........FHQCKENedy............NDVLTVTA...THGLCHLLGFTHGTEAEWQQMFQ-----------------
ENSP00000380813  ........FHQCKENedy............NDVLTVTA...THGLCHLLGFTHGTEAEWQQMFQ-----------------
ENSP00000219070  .nydddrkWGFCPDQ...............GYSLFLVA...AHEFGHAMGLEHSQDPGA-LMAPIY---------------
ENSP00000444143  .nydddrkWGFCPDQ...............GYSLFLVA...AHEFGHAMGLEHSQDPGA-LMAPIY---------------
ENSP00000461421  .nydddrkWGFCPDQ...............GYSLFLVA...AHEFGHAMGLEHSQDPGA-LMAPIY---------------
ENSP00000394237  .nydddrkWGFCPDQ...............GYSLFLVA...AHEFGHAMGLEHSQDPGA-LMAPIY---------------
ENSP00000436733  ........-------...............--------...----------------------------------------
ENSP00000442104  ........WTFRSSDah.............GMDLFAVA...VHEFGHAIGLSHVAAAHS-IMRPYYQ--------------
ENSP00000456096  ........WTLG---...............--------...----------------------------------------
ENSP00000357798  ........FTPPTSDt..............GISLLKVA...VHEIGHVLGLPHTYRTGS-IMQPNY---------------
ENSP00000429422  ........-------...............--------...----------------------------------------
ENSP00000483377  ........-------...............--------...----------------------------------------
ENSP00000405978  ........-------...............--------...----------------------------------------
ENSP00000420011  ........-------...............--------...----------------------------------------
ENSP00000453952  ........-------...............PKVSHITF...AHEVGHNFGSPHDSG-------------------------
ENSP00000417595  ........-------...............--------...----------------------------------------
ENSP00000423780  ........WVLGPT-...............--------...----------------------------------------
ENSP00000435305  ........CLITEDT...............GFDLGVTI...AHEIGH----------------------------------
ENSP00000340675  ........-------...............--FHEVTA...THGLCHLLGFTHGTEAEWQQMFQ-----------------
ENSP00000426265  ........-------...............--------...----------------------------------------
ENSP00000465545  ........-------...............--------...----------------------------------------
ENSP00000482854  ........WTFG---...............--------...----------------------------------------
ENSP00000277198  ........LTGGNHLc..............GTR----L...CHEIAHA---------------------------------
ENSP00000457949  ........-------...............--------...----------------------------------------
ENSP00000484562  ........WSLSRRR...............GRNLFVVL...AHEIGHTLGLTHSPAPRA-LMAPYYK--------------
ENSP00000431856  ........-------...............--------...----------------------------------------
ENSP00000462599  ........-------...............--------...----------------------------------------
ENSP00000405867  ........WVLGPTRyswkkgvw.......LTDLVHVA...AHEIGHALGLMHSQHGRA-LMHLN----------------
ENSP00000457084  ........-------...............GNNLFLVA...VHELGHALGLEHSSNPNA-IMAPFYQ--------------
ENSP00000431065  ........-------...............--------...----------------------------------------
ENSP00000419889  ........-------...............--------...----------------------------------------
ENSP00000461938  ........-------...............--------...----------------------------------------
ENSP00000427418  ........-------...............--------...----------------------------------------
ENSP00000427500  ........-------...............--------...----------------------------------------
ENSP00000422492  ........-------...............--------...----------------------------------------
ENSP00000482173  ........-------...............--------...----------------------------------------
ENSP00000427574  ........-------...............--------...----------------------------------------
ENSP00000456518  ........YGFCPET...............GYSLFLVA...AHEFGHAMGLEHSQDPGA-LMAPIY---------------
ENSP00000418886  ........-------...............--------...----------------------------------------
ENSP00000441485  ........-------...............--------...----------------------------------------
ENSP00000380808  ........FHQCKENedy............NDVLTVTA...THGLCHLLGFTHGTEAEWQQMFQ-----------------
ENSP00000391334  ........-------...............--------...----------------------------------------
ENSP00000391268  ........-------...............--------...----------------------------------------
ENSP00000418791  ........-------...............--------...----------------------------------------
ENSP00000463673  ........-------...............--------...----------------------------------------
ENSP00000402171  ........-------...............--------...-----------------A----------------------
ENSP00000369182  ........-------...............--------...----------------------------------------
ENSP00000480574  ........-------...............--------...----------------------------------------
ENSP00000297979  ........-------...............--------...-----------------A----------------------
ENSP00000447822  ........-------...............--------...----------------------------------------
ENSP00000436633  ........-------...............--------...----------------------------------------
ENSP00000453545  ........-------...............--------...----------------------------------------
ENSP00000386625  ........-------...............--------...----------------------------------------
ENSP00000356974  ........-------...............--------...----------------------------------------
ENSP00000352976  ........PEITSVL...............LLRSCKTL...THEIGHIFGLRH----------------------------
ENSP00000376481  ........PEITSVL...............LLRSCKTL...THEIGHIFGLRH----------------------------
ENSP00000463012  ........PEITSVL...............LLRSCKTL...THEIGHIFGLRH----------------------------
ENSP00000464133  ........PEITSVL...............LLRSCKTL...THEIGHIFGLRH----------------------------
ENSP00000464635  ........PEITSVL...............LLRSCKTL...THEIGHIFGLRH----------------------------
ENSP00000483162  ........PEITSVL...............LLRSCKTL...THEIGHIFGLRH----------------------------
ENSP00000441710  ........-------...............--------...----------------------------------------
ENSP00000412107  ........-------...............--------...AHEFGHVLGLQHTTAAKA-LMSAFY---------------
ENSP00000367406  ........-------...............--------...----------------------------------------
ENSP00000423748  ........-------...............--------...----------------------------------------
ENSP00000352831  ........PEITSVL...............LLRSCKTL...THEIGHIFGLRH----------------------------
ENSP00000330658  ........GMPG---...............---HTHTM...IHEIGHSLGLYHV---------------------------
ENSP00000446989  ........-------...............--------...----------------------------------------
ENSP00000367945  ........-------...............--------...----------------------------------------
ENSP00000482664  ........-------...............--------...----------------------------------------
ENSP00000380915  ........-------...............--------...----------------------------------------
ENSP00000427950  ........-------...............--------...----------------------------------------
ENSP00000428798  ........-------...............--------...----------------------------------------
ENSP00000430977  ........-------...............--------...----------------------------------------
ENSP00000390872  ........-------...............--------...-----------------------------------Q----
ENSP00000484600  ........-------...............--------...----------------------------------------
ENSP00000418728  ........-------...............--------...----------------------------------------
ENSP00000462038  ........-------...............--------...----------------------------------------
ENSP00000356634  ........GMP----...............--GHTDTM...IHEVGHVLGLYH----------------------------
ENSP00000380806  ........-------...............------TA...THGLCHLLGFTHGTEAEWQQMFQK----------------
ENSP00000420542  ........-------...............--------...------------------------------------A---
ENSP00000356633  ........GMP----...............--GHTDTM...IHEVGHVLGLYH----------------------------
ENSP00000430832  ........-------...............--------...----------------------------------------
ENSP00000462995  ........-------...............--------...----------------------------------------
ENSP00000356633  ........GMP----...............--GHTDTM...IHEVGHVLGLYH----------------------------
ENSP00000356634  ........GMP----...............--GHTDTM...IHEVGHVLGLYH----------------------------
ENSP00000425758  ........-------...............--------...----------------------------------------
ENSP00000469559  ........-------...............--------...----------------------------------------
ENSP00000469901  ........-------...............--------...----------------------------------------
ENSP00000414661  ........-------...............--------...----------------------------------------
ENSP00000411451  ........-------...............--------...----------------------------------------
ENSP00000462002  ........-------...............--------...-----------------------EYAEANW----------
ENSP00000308149  ........-------...............------VT...CHELCHLLGLG-----------------------------


                         220       230       240                                                    
                           |         |         |                                                    
d1sata2            SYWSETNTGGDNGGHYAAAPLLDDIAAIQHLY.................................................
ENSP00000367668  --------------------------------ithgfddngrnfdkngnmmdwwsnfstqhfreqsecmiyqygnyswdla
ENSP00000484606  --------------------------------ithgfddngrnfdkngnmmdwwsnfstqhfreqsecmiyqygnyswdla
ENSP00000405088  --------------------------------vghelthafddqgreydkdgnlrpwwknssveafkrqtecmveqysnys
ENSP00000349581  --------------------------------vghelthafddqgreydkdgnlrpwwknssveafkrqtecmveqysnys
ENSP00000264205  --------------------------------vghelthafddqgreydkdgnlrpwwknssveafkrqtecmveqysnys
ENSP00000364028  --------------------------------vghelthafddqgreydkdgnlrpwwknssveafkrqtecmveqysnys
ENSP00000353679  --------------------------------ssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddngr
ENSP00000417079  --------------------------------ssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddngr
ENSP00000418525  --------------------------------ssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddngr
ENSP00000419653  --------------------------------ssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddngr
ENSP00000420389  --------------------------------ssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddngr
ENSP00000478173  --------------------------------ssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddngr
ENSP00000352052  --------------------------------smtpqtvnayylptkneivfpagilqapfyarnhpkalnfggigvvmgh
ENSP00000385846  --------------------------------smtpqtvnayylptkneivfpagilqapfyarnhpkalnfggigvvmgh
ENSP00000350066  --------------------------------smtpqtvnayylptkneivfpagilqapfyarnhpkalnfggigvvmgh
ENSP00000384223  --------------------------------smtpqtvnayylptkneivfpagilqapfyarnhpkalnfggigvvmgh
ENSP00000290863  --------------------------------qyfmqykdlpvalreganpgfheaigdvlalsvstpkhlhslnllsseg
ENSP00000387760  --------------------------------qyfmqykdlpvalreganpgfheaigdvlalsvstpkhlhslnllsseg
ENSP00000464149  --------------------------------qyfmqykdlpvalreganpgfheaigdvlalsvstpkhlhslnllsseg
ENSP00000397593  --------------------------------qyfmqykdlpvalreganpgfheaigdvlalsvstpkhlhslnllsseg
ENSP00000290866  --------------------------------qyfmqykdlpvalreganpgfheaigdvlalsvstpkhlhslnllsseg
ENSP00000388439  --------------------------------vghelthafddqgreydkdgnlrpwwknssveafkrqtecmveqysnys
ENSP00000397593  --------------------------------qyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvt
ENSP00000290866  --------------------------------qyylqykdlpvslrrganpgfheaigdvlalsvstpehlhkiglldrvt
ENSP00000302051  --------------------------------wrvvvvlsehlsppfrealhelaqemegsdkpqelarvclgqanrhfgm
ENSP00000386333  --------------------------------lhnylvwrvvvvlsehlsppfrealhelaqemegsdkpqelarvclgqa
ENSP00000368682  --------------------------------npttvnafysastnqirfpagelqkpffwgteyprslsygaigvivghe
ENSP00000398444  --------------------------------ppsrdqwsmtpqtvnayylptkneivfpagilqapfyarnhpkalnfgg
ENSP00000252519  --------------------------------iqydmayaaqpfllrnganegfheavgeimslsaatpkhlksigllspd
ENSP00000389326  --------------------------------iqydmayaaqpfllrnganegfheavgeimslsaatpkhlksigllspd
ENSP00000392247  --------------------------------qyfmqykdlpvalreganpgfheaigdvlalsvstpkhlhslnllsseg
ENSP00000304467  --------------------------------hqlcsqaefamfsgthverdfveapsqmlenwvweqepllrmsrhyrtg
ENSP00000370372  --------------------------------hqicaqtdfarfsgtnvetdfvevpsqmlenwvwdvdslrrlskhykdg
ENSP00000422492  --------------------------------ngnmmdwwsnfstqhfreqsecmiyqygnyswdladeqnvngfntlgen
ENSP00000482173  --------------------------------ngnmmdwwsnfstqhfreqsecmiyqygnyswdladeqnvngfntlgen
ENSP00000423214  --------------------------------hqicaqtdfarfsgtnvetdfvevpsqmlenwvwdvdslrrlskhykdg
ENSP00000467226  --------------------------------hqlcsqaefamfsgthverdfveapsqmlenwvweqepllrmsrhyrtg
ENSP00000347409  --------------------------------itrlrnlpwmneetqnmaqdkvaqlqvemgasewalkpelarqeyndiq
ENSP00000477793  --------------------------------itrlrnlpwmneetqnmaqdkvaqlqvemgasewalkpelarqeyndiq
ENSP00000425477  --------------------------------mpsreyyfnggsnrkvreaylqfmvsvatllredanlprdsclvqedmv
ENSP00000410926  --------------------------------aglfafyhdkdgnpltsrfadglppfnyslglyqwsdkvvrkverlwdv
ENSP00000418324  --------------------------------aglfafyhdkdgnpltsrfadglppfnyslglyqwsdkvvrkverlwdv
ENSP00000371607  --------------------------------hsmlgrtryqhvtgtrcptdfaevpsilmeyfandyrvvnqfarhyqtg
ENSP00000328829  --------------------------------aglfafyhdkdgnpltsrfadglppfnyslglyqwsdkvvrkverlwdv
ENSP00000328611  --------------------------------aglfafyhdkdgnpltsrfadglppfnyslglyqwsdkvvrkverlwdv
ENSP00000462909  --------------------------------psapsmdtteamlkqgwtprrmfkeaddfftslgllpvppefwnksmle
ENSP00000427417  --------------------------------regkynhaacfglqpgcllpdgsrmmavaalvvnfsqpvagrpsllrhd
ENSP00000433287  --------------------------------wthlwlnegfaswieylcvdhcfpeydiwtqfvsadytraqeldaldns
ENSP00000320324  --------------------------------wthlwlnegfaswieylcvdhcfpeydiwtqfvsadytraqeldaldns
ENSP00000265162  --------------------------------vhqwfgnivtmdwwedlwlnegfasffeflgvnhaetdwqmrdqmlled
ENSP00000300060  --------------------------------qwfgnlvtiewwndlwlnegfasyveylgadyaeptwnlkdlmvlndvy
ENSP00000406304  --------------------------------qwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfd
ENSP00000296754  --------------------------------qwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfd
ENSP00000231368  ---S----------------------------lekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds
ENSP00000379117  ---S----------------------------lekifkelssyedfldarfktmkkdslnsshpisssvqsseqieemfds
ENSP00000426959  --------------------------------hqicaqtdfarfsgtnvetdfvevpsqmlenwvwdvdslrrlskhykdg
ENSP00000228740  --------------------------------wtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgel
ENSP00000421175  --------------------------------qwfgnlvtmewwndiwlkegfakymeliavnatypelqfddyflnvcfe
ENSP00000400376  --------------------------------qwfgnlvtmewwndiwlkegfakymeliavnatypelqfddyflnvcfe
ENSP00000369235  --------------------------------qwfgnlvtmewwndiwlkegfakymeliavnatypelqfddyflnvcfe
ENSP00000261180  --------------------------------qwfgdlvtpvwwedvwlkegfahyfefvgtdylypgwnmekqrfltdvl
ENSP00000395051  --------------------------------wtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgel
ENSP00000449958  --------------------------------wtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgel
ENSP00000421849  --------------------------------qwfgnlvtmewwndiwlkegfakymeliavnatypelqfddyflnvcfe
ENSP00000465855  --------------------------------hqlcsqaefamfsgthverdfveapsqmlenwvweqepllrmsrhyrtg
ENSP00000462280  --------------------------------rswynsptfeddlehlyqqleplylnlhafvrralhrrygdryinlrgp
ENSP00000423604  --------------------------------wfgnlvtmnwwnniwlnegfasyfefevinyfnpklprneiffsnilhn
ENSP00000378899  --------------------------------wfgnlvtmnwwnniwlnegfasyfefevinyfnpklprneiffsnilhn
ENSP00000350541  --------------------------------wfgnlvtmnwwnniwlnegfasyfefevinyfnpklprneiffsnilhn
ENSP00000309968  --------------------------------capnedqggkyvmypiavsgdhennkmfsncskqsiyktieskaqecfq
ENSP00000412683  --------------------------------hwwteasysrflrkaecivrlydnftvynqrayqkwvrehgpehplprl
ENSP00000393699  --------------------------------ysckcpsticvmdkalsfyiptdfsscsrlsydkffedklsnclfn...
ENSP00000265769  --------------------------------ysckcpsticvmdkalsfyiptdfsscsrlsydkffedklsnclfn...
ENSP00000295640  --------------------------------wfgnlvtnanwgefwlnegftmyaqrristilfgaaytcleaatgrall
ENSP00000357665  --------------------------------ldrgcscqmavekggcimnastgypfpmvfsscsrkdletslekgmgvc
ENSP00000357668  --------------------------------ldrgcscqmavekggcimnastgypfpmvfsscsrkdletslekgmgvc
ENSP00000389602  --------------------------------wfgnlvtnanwgefwlnegftmyaqrristilfgaaytcleaatgrall
ENSP00000418737  --------------------------------gakscimnsgasgsrnfsscsaedfekltlnkggnclln..........
ENSP00000369249  --------------------------------gakscimnsgasgsrnfsscsaedfekltlnkggnclln..........
ENSP00000418437  --------------------------------gakscimnsgasgsrnfsscsaedfekltlnkggnclln..........
ENSP00000419446  --------------------------------gakscimnsgasgsrnfsscsaedfekltlnkggnclln..........
ENSP00000453043  --------------------------------gcrcqerfeagrcimagsigssfprmfsdcsqaylesflerpqsvclan
ENSP00000453855  --------------------------------gcrcqerfeagrcimagsigssfprmfsdcsqaylesflerpqsvclan
ENSP00000453302  --------------------------------gcrcqerfeagrcimagsigssfprmfsdcsqaylesflerpqsvclan
ENSP00000322550  --------------------------------ccveaaaesggcvmaaatghpfprvfsacsrrqlraffrkgggaclsna
ENSP00000348912  --------------------------------ccveaaaesggcvmaaatghpfprvfsacsrrqlraffrkgggaclsna
ENSP00000369190  --------------------------------ccveaaaesggcvmaaatghpfprvfsacsrrqlraffrkgggaclsna
ENSP00000270357  --------------------------------eemwlseglatyaqrrittetygaaftcletafrldalhrqmkllgeds
ENSP00000422937  --------------------------------nhvtiireniqpgqeynflkmepgevnslgerydfdsimhyarntfsrg
ENSP00000257527  --------------------------------adccsasaadggcimaaatghpfpkvfngcnrreldrylqsgggmclsn
ENSP00000428654  --------------------------------adccsasaadggcimaaatghpfpkvfngcnrreldrylqsgggmclsn
ENSP00000061240  --------------------------------nhvtiireniqpgqeynflkmepgevnslgerydfdsimhyarntfsrg
ENSP00000426082  --------------------------------nhvtiireniqpgqeynflkmepgevnslgerydfdsimhyarntfsrg
ENSP00000373472  --------------------------------cepvgkrpfimspqllydaapltwsrcsrqyitrfldrgwglcldd...
ENSP00000175238  --------------------------------efpctcpsgkcvmdsdgsipalkfskcsqnqyhqylkdykptcmlnip.
ENSP00000370166  --------------------------------efpctcpsgkcvmdsdgsipalkfskcsqnqyhqylkdykptcmlnip.
ENSP00000466653  --------------------------------hqlcsqaefamfsgthverdfveapsqmlenwvweqepllrmsrhyrtg
ENSP00000350630  --------------------------------vtiireniqpgqeynflkmeagevsslgetydfdsimhyarntfsrgvf
ENSP00000428665  --------------------------------drhvsivreniqpgqeynflkmepqeveslgetydfdsimhyarntfsr
ENSP00000430406  --------------------------------drhvsivreniqpgqeynflkmepqeveslgetydfdsimhyarntfsr
ENSP00000306121  --------------------------------drhvsivreniqpgqeynflkmepqeveslgetydfdsimhyarntfsr
ENSP00000428332  --------------------------------drhvsivreniqpgqeynflkmepqeveslgetydfdsimhyarntfsr
ENSP00000482883  -----------YTGKSHFMLPDDDVQGIQSLYgpg..............................................
ENSP00000299855  -----------LTDLTRFRLSQDDINGIQSLYgpp..............................................
ENSP00000370443  --------------------------------gtkgheaaklmaahitantnpfswsacsrdyitsfldsgrgtcldne..
ENSP00000305714  --------------------------------drhvsivreniqpgqeynflkmepqeveslgetydfdsimhyarntfsr
ENSP00000260302  -----------YTGKSHFMLPDDDVQGIQSLYgpg..............................................
ENSP00000339672  -----------YTGKSHFMLPDDDVQGIQSLYgpg..............................................
ENSP00000356255  --------------------------------wfgnlvtnanwgefwlnegftmyaqrristilfgaaytcleaatgrall
ENSP00000322788  -------------FSGDVQLAQDDIDGIQAIYgrsq.............................................
ENSP00000435639  --------------------------------aswieylcvdhcfpeydiwtqfvsadytraqeldaldnshpievsvghp
ENSP00000418735  --------------------------------keegvkspqhvmaptlnfytnpwmwskcsrkyitefldtgygecllne.
ENSP00000260228  -----------YKNPYGFHLPKDDVKGIQALYgpr..............................................
ENSP00000458585  -----------YVDINTFRLSADDIRGIQSLYgd...............................................
ENSP00000270328  --------------------------------gargqdpaklmaahitmktnpfvwsscsrdyitsfldsglglclnnr..
ENSP00000471851  --------------------------------gargqdpaklmaahitmktnpfvwsscsrdyitsfldsglglclnnr..
ENSP00000476000  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000353892  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000271836  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000357397  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000432347  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000434227  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000432927  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000349436  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000403843  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000348227  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000352226  --------------------------------cpcpgpapaktcimeastdflpglnfsncsrralekalldgmgsclfe.
ENSP00000246186  -----------YMETHNFKLPQDDLQGIQKIYg................................................
ENSP00000344847  --------------------------------cepvgrhpyimsrqlqydptpltwskcseeyitrfldrgwgfcldd...
ENSP00000422554  --------------------------------cepvgrhpyimsrqlqydptpltwskcseeyitrfldrgwgfcldd...
ENSP00000401004  -----------FRETSNYSLPQDDIDGIQAIYg................................................
ENSP00000427573  --------------------------------qwfgnlvtmewwndiwlkegfakymeliavnatypelqfgacilnmlkd
ENSP00000279441  -----------FTELAQFRLSQDDVNGIQSLYgpp..............................................
ENSP00000260227  -----------NGDPQNFKLSQDDIKGIQKLYgkr..............................................
ENSP00000236826  -----------FRETSNYSLPQDDIDGIQAIYg................................................
ENSP00000300762  -----------YHDPRTFQLSADDIQRIQHLYge...............................................
ENSP00000369753  -----------YHDPRTFQLSADDIQRIQHLYge...............................................
ENSP00000378911  --------------------------------vmapalsfhmspwswsncsrkyvtefldtgygeclldk...........
ENSP00000448341  --------------------------------vmapalsfhmspwswsncsrkyvtefldtgygeclldk...........
ENSP00000484172  --------------------------------vmapalsfhmspwswsncsrkyvtefldtgygeclldk...........
ENSP00000374071  --------------------------------vmapalsfhmspwswsncsrkyvtefldtgygeclldk...........
ENSP00000256389  --------------------------------celqwcimhayrkvttkfsncsyaqywdstiss................
ENSP00000286614  -----------YMETDNFKLPNDDLQGIQKIYgppd.............................................
ENSP00000308208  -----------WMDTENFVLPDDDRRGIQQLYg................................................
ENSP00000465895  --------------------------------hqlcsqaefamfsgthverdfveapsqmlenwvweqepllrmsrhyrtg
ENSP00000421631  --------------------------------ckksegnimsptlagrngvfswspcsrqylhkflstaqaiclad.....
ENSP00000419217  --------------------------------keegvkspqhvmaptlnfytnpwmwskcsrkyitefl............
ENSP00000282849  --------------------------------crkaegnimsptltgnngvfswsscsrqylkkflstpqagclvd.....
ENSP00000260229  -----------SLDPRKYPLSQDDINGIQSIYg................................................
ENSP00000215743  ------------TFRYPLSLSPDDCRGVQHLY.................................................
ENSP00000483349  ------------TFRYPLSLSPDDCRGVQHLY.................................................
ENSP00000274181  --------------------------------ckksegnimsptlagrngvfswspcsrqylhkflstaqaiclad.....
ENSP00000299164  --------------------------------vkvceevfgklranhmmsptliqidranpwsacsaaiitdfldsghgdc
ENSP00000284987  --------------------------------eetfgstedkrlmssiltsidaskpwskctsatiteflddghgnclld.
ENSP00000474385  --------------------------------fcfcgergcimntfrvpaekftncsyadfmkttlnqgsclhn.......
ENSP00000284984  --------------------------------aslngvnqdshmmasmlsnldhsqpwspcsaymitsfldnghgeclmdk
ENSP00000435966  --------------------------------qwfgnlvtmewwthlwlnegfaswieylcvdhcfpeydiwtqfvsadyt
ENSP00000219271  -----------WKDVDNFKLPEDDLRGIQQLYgt...............................................
ENSP00000369238  --------------------------------stvgeadellqkflewkqsylnlrphdiaylliymdyprylgavfpgtm
ENSP00000484817  --------------------------------stvgeadellqkflewkqsylnlrphdiaylliymdyprylgavfpgtm
ENSP00000407614  --------------------------------wfgnlvtnanwgefwlnegftmyaqrristilfgvdpddtynetpyekg
ENSP00000269202  TYSDDISDSLNVPYDYT---------------svmhysktafqngteptivtrisdfedvigqrmdfsdsdllklnqlync
ENSP00000463280  TYSDDISDSLNVPYDYT---------------svmhysktafqngteptivtrisdfedvigqrmdfsdsdllklnqlync
ENSP00000260408  --------------------------------gtectpgesknlgqkengnyimyaratsgdklnnnkfslcsirnisqvl
ENSP00000356975  --------------------------------cislngplstsrhvmapvmahvdpeepwspcsarfitdfldngyghcll
ENSP00000430400  --------------------------------efpctcpsgkcvmdsdgsipalkfskcsqnqyhqylkdykptcmlnip.
ENSP00000420101  ----------------------------Q---kakalyrscinesaidsrggepllkllpdiygwpvatenweqkygaswt
ENSP00000265707  --------------------------------tsgdaddilqrflawkrdylilrphdiayllvyrkhpkyvgatfpgtvc
ENSP00000482348  --------------------------------tsgdaddilqrflawkrdylilrphdiayllvyrkhpkyvgatfpgtvc
ENSP00000352177  --------------------------------crcsqprcimhegnppitkfsncsygdfweytvertkcll.........
ENSP00000384229  --------------------------------crcsqprcimhegnppitkfsncsygdfweytvertkcll.........
ENSP00000414544  --------------------------------crcsqprcimhegnppitkfsncsygdfweytvertkcll.........
ENSP00000423517  --------------------------------crcsqprcimhegnppitkfsncsygdfweytvertkcll.........
ENSP00000478469  --------------------------------crcsqprcimhegnppitkfsncsygdfweytvertkcll.........
ENSP00000484862  --------------------------------crcsqprcimhegnppitkfsncsygdfweytvertkcll.........
ENSP00000268070  --------------------------------agrshimsgewvkgrnpsdlswsscsrddlenflkskvstcll......
ENSP00000428993  --------------------------------pdvpfntkcpsgscvmnqylsskfpkdfstscrahferyllsqkpkcll
ENSP00000256412  --------------------------------pdvpfntkcpsgscvmnqylsskfpkdfstscrahferyllsqkpkcll
ENSP00000429352  --------------------------------lrwktsylvlrphdvafllvyreksnyvgatfqgkmcdanyaggvvlhp
ENSP00000478636  --------------------------------lrwktsylvlrphdvafllvyreksnyvgatfqgkmcdanyaggvvlhp
ENSP00000483607  --------------------------------lrwktsylvlrphdvafllvyreksnyvgatfqgkmcdanyaggvvlhp
ENSP00000265708  --------------------------------lrwktsylvlrphdvafllvyreksnyvgatfqgkmcdanyaggvvlhp
ENSP00000482337  --------------------------------lrwktsylvlrphdvafllvyreksnyvgatfqgkmcdanyaggvvlhp
ENSP00000257359  --------------------------------trlfgpmgkhhvmaplfvhlnqtlpwspcsamyltelldgghgdclld.
ENSP00000408070  ------------TFRYPLSLSPDDCRGVQHLYgqpwpt...........................................
ENSP00000274487  --------------------------------cadglhimsgewikgqnlgdvswsrcskedlerflrskasncll.....
ENSP00000362304  --------------------------------cadetslgsvmaplvqaafhrfhwsrcsklelsrylpsydclld.....
ENSP00000464428  --------------------------------kcdiyqskeagqrlatamklgfsrpwpeamqlitgqpnmsasamlsyfk
ENSP00000343674  --------------------------------vnwneilpgfeinfiksqssnmltpydyssvmhygrlafsrrglptitp
ENSP00000274609  --------------------------------cgdevrlgsimaplvqaafhrfhwsrcsqqelsrylhsydclld.....
ENSP00000465537  --------------------------------ddlletlarlmvyrreglpepsdathlfsgrtfqstssgaayvggicsl
ENSP00000295903  --------------------------------keegvkspqhvmaptlnfytnpwmwskcsrkyitefldtgygecllne.
ENSP00000230588  TYDDSLI-------------------------tdlntpydyeslmhyqpfsfnknasvptitakipefnsiigqrldfsai
ENSP00000443773  --------------------------------ddlletlarlmvyrreglpepsdathlfsgrtfqstssgaayvggicsl
ENSP00000480465  TYDDSLI-------------------------tdlntpydyeslmhyqpfsfnknasvptitakipefnsiigqrldfsai
ENSP00000251582  --------------------------------cgdevrlgsimaplvqaafhrfhwsrcsqqelsrylhsydclld.....
ENSP00000200557  --------------------------------ddlletlarlmvyrreglpepsdathlfsgrtfqstssgaayvggicsl
ENSP00000362303  --------------------------------cadetslgsvmaplvqaafhrfhwsrcsklelsrylpsydclld.....
ENSP00000264377  --------------------------------npvqmlhefskyrqrikqhadavhlisrvtfhykrsslsyfggvcsrtr
ENSP00000363536  --------------------------------npvqmlhefskyrqrikqhadavhlisrvtfhykrsslsyfggvcsrtr
ENSP00000378638  --------------------------------mfhtrfkqegvlnskfphyevrplrhvslclpltwcdpgsgqppesltr
ENSP00000286657  --------------------------------cgdetamgsvmaplvqaafhryhwsrcsgqelkryihsydclld.....
ENSP00000480055  --------------------------------cgdetamgsvmaplvqaafhryhwsrcsgqelkryihsydclld.....
ENSP00000337816  ---------GPVGDPDKYRLSQDDRDGLQQLY.................................................
ENSP00000464786  --------------------------------laggydaqyygylwsevysmdmfhtrfkqegvlnskvgmdyrscilrpg
ENSP00000381261  --------------------------------kfaisenplitlrefmkyrrdfikeksdavhlfsgsqfessrsgaayig
ENSP00000381260  --------------------------------kfaisenplitlrefmkyrrdfikeksdavhlfsgsqfessrsgaayig
ENSP00000381262  --------------------------------kfaisenplitlrefmkyrrdfikeksdavhlfsgsqfessrsgaayig
ENSP00000265727  --------------------------------kfaisenplitlrefmkyrrdfikeksdavhlfsgsqfessrsgaayig
ENSP00000381267  --------------------------------kfaisenplitlrefmkyrrdfikeksdavhlfsgsqfessrsgaayig
ENSP00000343854  --------------------------------ylvlrphdvafllvyreksnyvgatfqgkmcdanyaggvvlhprtisle
ENSP00000484999  --------------------------------ylvlrphdvafllvyreksnyvgatfqgkmcdanyaggvvlhprtisle
ENSP00000358407  SYI-----------------------------sffkhissgatclnn..................................
ENSP00000313437  ------------GYRPHFKLHPDDVAGIQALY.................................................
ENSP00000353767  ---------GPVGDPLRYGLPYED--------kvrvwqly.........................................
ENSP00000479124  ------------RLGRDALLSWDDVLAVQSLYgkp..............................................
ENSP00000483299  ------------RLGRDALLSWDDVLAVQSLYgkp..............................................
ENSP00000348308  -----------ATLRGWKALSQDELWGLHRLY.................................................
ENSP00000482367  -----------ATLRGWKALSQDELWGLHRLY.................................................
ENSP00000403404  --------------------------------kqc..............................................
ENSP00000401854  --------------------------------wfglaigardwteewlsegfathledvfwataqqlapyeareqqelrac
ENSP00000481051  ------------RLGRDALLSWDDVLAVQSLYgkp..............................................
ENSP00000473853  ------------RLGRDALLSWDDVLAVQSLYgkp..............................................
ENSP00000484430  ------------RLGRDALLSWDDVLAVQSLYgkp..............................................
ENSP00000444603  --------------------------------g................................................
ENSP00000441106  ---------GPVGDPLRYGLPYED--------kvrvwqly.........................................
ENSP00000364464  --------------------------------wfglaigardwteewlsegfathledvfwataqqlapyeareqqelrac
ENSP00000347927  --------------------------------psghvmasdgaapraglawspcsrrqllsllsagrarcvwd........
ENSP00000360997  --------------------------------psghvmasdgaapraglawspcsrrqllsllsagrarcvwd........
ENSP00000429557  --------------------------------caslngvnqdshmmas.................................
ENSP00000361405  -----------FTEGPP--LHKDDVNGIRHLYg................................................
ENSP00000360979  --------------------------------psghvmasdgaapraglawspcsrrqllsllr.................
ENSP00000435274  --------------------------------psghvmasdgaapraglawspcsrrqllsllr.................
ENSP00000346941  --------------------------------rdrhvsivreniqpgvlhs..............................
ENSP00000428249  --------------------------------rdrhvsivreniqpgvlhs..............................
ENSP00000348997  --------------------------------psghvmasdgaapraglawspcsrrqllsllsan...............
ENSP00000369195  --------------------------------tsgdaddilqrflawkrdylilrphdiayllvyrkhpkyvgatfpgtvc
ENSP00000446979  ------------GYRPHFKLHPDDVAGIQALYgk...............................................
ENSP00000329614  --------------------------------kekavldelgrrtgtrlqpltr...........................
ENSP00000380805  --------------------------------kekavldelgrrtgtrlqpltr...........................
ENSP00000380813  --------------------------------kekavldelgrrtgtrlqpltr...........................
ENSP00000219070  ------------TYTKNFRLSQDDIKGIQELYg................................................
ENSP00000444143  ------------TYTKNFRLSQDDIKGIQELYg................................................
ENSP00000461421  ------------TYTKNFRLSQDDIKGIQELYg................................................
ENSP00000394237  ------------TYTKNFRLSQDDIKGIQELYg................................................
ENSP00000436733  --------------------------------thlwlnegfaswieylcvdhcfpeydiwtqfvsadytraqeldaldnsh
ENSP00000442104  ---------GPVGDPLRYGLPYED--------kvrvwqlyg........................................
ENSP00000456096  --------------------------------eg...............................................
ENSP00000357798  -----------IPQEPAFELDWSDRKAIQKLYg................................................
ENSP00000429422  --------------------------------stvgeadellqkflewkqsylnlrphdiaylliymdyprylgavfpgtm
ENSP00000483377  --------------------------------stvgeadellqkflewkqsylnlrphdiaylliymdyprylgavfpgtm
ENSP00000405978  --------------------------------stvgeadellqkflewkqsylnlrphdiaylliymdyprylgavfpgtm
ENSP00000420011  --------------------------------fqfynscmdtlaieaagtgplrqvieelggwrisgkwtslnfnrtlrll
ENSP00000453952  --------------------------------tectpgesknlgqkengnyimyaratsgdklnnnkfslcsirnisqvle
ENSP00000417595  ---------------VLQEPKTEDIVAV----qkakalyrscinesaidsrggepllkll.....................
ENSP00000423780  --------------------------------r................................................
ENSP00000435305  --------------------------------.................................................
ENSP00000340675  --------------------------------kekavldelgrrtgtrlqpltr...........................
ENSP00000426265  --------------------------------rqmgypvlnv.......................................
ENSP00000465545  --------------------------------fpqhvspskdirtasteadkklsefdvemsmredvyqrivwlqekvqkd
ENSP00000482854  --------------------------------s................................................
ENSP00000277198  --------------------------------wfglaigardwteewlsegfathledvfwataqqlapyeareqqelrac
ENSP00000457949  --------------------------------.................................................
ENSP00000484562  ------------RLGRDALLSWDDVLAVQSLYgkp..............................................
ENSP00000431856  --------------------------------lwehnqaiikhllenstasvseaerkaqvyyracmnetr..........
ENSP00000462599  --------------------------------gtqarkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmet
ENSP00000405867  -----------ATLRGWKALSQDELWGLHRLY.................................................
ENSP00000457084  -----------WKDVDNFKLPEDDLRGIQQLYg................................................
ENSP00000431065  --------------------------------tsnaaltlrnfcnwqkqhnppsdrdaehydtailftrqdlcgs......
ENSP00000419889  --------------------------------fynscmdtlaieaagtgplrqvieei.......................
ENSP00000461938  --------------------------------laafadtfhcargtpmhpkercrvw........................
ENSP00000427418  --------------------------------sgfpvitl.........................................
ENSP00000427500  --------------------------------sgfpvitl.........................................
ENSP00000422492  --------------------------------lrdelevilkavlenst................................
ENSP00000482173  --------------------------------lrdelevilkavlenst................................
ENSP00000427574  --------------------------------sgfpvitl.........................................
ENSP00000456518  ------------TYTKNFRLSQDDIKGIQELYga...............................................
ENSP00000418886  --------------------------------fynscmdtlaieaagtgplrqvie.........................
ENSP00000441485  --------------------------------.................................................
ENSP00000380808  --------------------------------kekavldelgrrtgtrlqpltr...........................
ENSP00000391334  --------------------------------faisenplitlrefmkyrrdfikeksdavhlfsyvt.............
ENSP00000391268  --------------------------------plnirivlvgvevwndmdkcsvsqdp.......................
ENSP00000418791  --------------------------------wlkrnvipetssrygnfdilrdelevvl.....................
ENSP00000463673  --------------------------------nqqngevlgwpeyqwhpplpdny..........................
ENSP00000402171  --------------------------------svikhglnpekifmqvhylkgyfllrflakrlgdetyfsflrkfvhtfh
ENSP00000369182  ----------------------------Q---csgavcimnpeaihfsgvkifsncsfedfahfiskqksqclhn......
ENSP00000480574  ----------------------------Q---csgavcimnpeaihfsgvkifsncsfedfahfiskqksqclhn......
ENSP00000297979  --------------------------------svikhglnpekifmqvhylkgyfllrflakrlgdetyfsflrkfvhtfh
ENSP00000447822  --------------------------------mghsvfqrglqdyltihkygnaarndlwntlsealkrngkyvniqevmd
ENSP00000436633  --------------------------------hdffsyacggwikanpvpdghsrwgt.......................
ENSP00000453545  --------------------------------vdalasshplstpaseintpaqiselfdaisysk...............
ENSP00000386625  --------------------------------ycsntfdgp........................................
ENSP00000356974  --------------------------------egpqvgpsaaqtlrsfcawqrglntpedsdpdhfdtailftrqv.....
ENSP00000352976  --------------------------------cqwlaclmqgsnhleeadrrplnlcpiclhklqc...............
ENSP00000376481  --------------------------------cqwlaclmqgsnhleeadrrplnlcpiclhklqc...............
ENSP00000463012  --------------------------------cqwlaclmqgsnhleeadrrplnlcpiclhklqc...............
ENSP00000464133  --------------------------------cqwlaclmqgsnhleeadrrplnlcpiclhklqc...............
ENSP00000464635  --------------------------------cqwlaclmqgsnhleeadrrplnlcpiclhklqc...............
ENSP00000483162  --------------------------------cqwlaclmqgsnhleeadrrplnlcpiclhklqc...............
ENSP00000441710  --------------------------------adhnd............................................
ENSP00000412107  ------------TFRYPLSLSPDDCRGVQHLYgqpwpt...........................................
ENSP00000367406  --------------------------------tfgvneyrhwikeeldkivayelktggvllhpifgggkekdnpashlhf
ENSP00000423748  --------------------------------yrp..............................................
ENSP00000352831  --------------------------------cqwlaclmqgsnhleeadrrplnlcpiclhklqc...............
ENSP00000330658  --------------------------------frgiseiqscsdpcmetepsfetgdlcndtnpapkhkscgdpgp.....
ENSP00000446989  --------------------------------gfhg.............................................
ENSP00000367945  --------------------------------gr...............................................
ENSP00000482664  --------------------------------gr...............................................
ENSP00000380915  --------------------------------cg...............................................
ENSP00000427950  --------------------------------cg...............................................
ENSP00000428798  --------------------------------cg...............................................
ENSP00000430977  --------------------------------cg...............................................
ENSP00000390872  --------------------------------catnqylrkendphryctgecaahtkcgpvivpeehlqqcrvyrggkwp
ENSP00000484600  --------------------------------anyvdqllrtldiqvaltglevwterdrsr...................
ENSP00000418728  --------------------------------ddiyrntswdnagfkgygiqi............................
ENSP00000462038  --------------------------------tnyisvfkgsgcwssvgnrrvgkqelsig....................
ENSP00000356634  --------------------------------vfkgvserescndpcketvpsmetgdlcadtaptpkselcrepeptsdt
ENSP00000380806  --------------------------------ekavldelgrrtgtrlqpltrg...........................
ENSP00000420542  --------------------------------ttepctdffkyacggwlk...............................
ENSP00000356633  --------------------------------vfkgvserescndpcketvpsmetg........................
ENSP00000430832  --------------------------------kdnpashlhfsikhphtlsweyysmfqckahlvmrlienrismefmlqv
ENSP00000462995  --------------------------------rrqeeaallsqefaeawgqkakelyepiwqnftdpqlrriigavrtlgs
ENSP00000356633  --------------------------------vfkgvserescndpcketvpsmetgdl......................
ENSP00000356634  --------------------------------vfkgvserescndpcketvpsmetgdlc.....................
ENSP00000425758  --------------------------------aslklldfyekyfdiyyplsklgmf........................
ENSP00000469559  --------------------------------grrdveqyvlaimnivrl...............................
ENSP00000469901  --------------------------------grrdveqyvlaimnivrl...............................
ENSP00000414661  --------------------------------lsffpelkeqsvdcragleferwlnatgpplaep...............
ENSP00000411451  --------------------------------lqmllenipeekrlelsveniyqdwlessgip.................
ENSP00000462002  --------------------------------nyntnittetskil...................................
ENSP00000308149  --------------------------------ncrwlrclmqgalsldealrrpldlcpiclrklqhvl............


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  deqnvngfntlgeniadnggvrqaykaylkwmaeggkdqqlpgldltheqlffinyaqvwcgsyrpefaiqsiktdvhspl
ENSP00000484606  deqnvngfntlgeniadnggvrqaykaylkwmaeggkdqqlpgldltheqlffinyaqvwcgsyrpefaiqsiktdvhspl
ENSP00000405088  vngepvngrhtlgeniadngglkaayrayqnwvkkngaehslptlgltnnqlfflgfaqvwcsvrtpessheglitdphsp
ENSP00000349581  vngepvngrhtlgeniadngglkaayrayqnwvkkngaehslptlgltnnqlfflgfaqvwcsvrtpessheglitdphsp
ENSP00000264205  vngepvngrhtlgeniadngglkaayrayqnwvkkngaehslptlgltnnqlfflgfaqvwcsvrtpessheglitdphsp
ENSP00000364028  vngepvngrhtlgeniadngglkaayrayqnwvkkngaehslptlgltnnqlfflgfaqvwcsvrtpessheglitdphsp
ENSP00000353679  nfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngglgqayrayqnyikkngeekllp
ENSP00000417079  nfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngglgqayrayqnyikkngeekllp
ENSP00000418525  nfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngglgqayrayqnyikkngeekllp
ENSP00000419653  nfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngglgqayrayqnyikkngeekllp
ENSP00000420389  nfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngglgqayrayqnyikkngeekllp
ENSP00000478173  nfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngglgqayrayqnyikkngeekllp
ENSP00000352052  elthafddqgreydkegnlrpwwqneslaafrnhtacmeeqynqyqvngerlngrqtlgeniadngglkaaynaykawlrk
ENSP00000385846  elthafddqgreydkegnlrpwwqneslaafrnhtacmeeqynqyqvngerlngrqtlgeniadngglkaaynaykawlrk
ENSP00000350066  elthafddqgreydkegnlrpwwqneslaafrnhtacmeeqynqyqvngerlngrqtlgeniadngglkaaynaykawlrk
ENSP00000384223  elthafddqgreydkegnlrpwwqneslaafrnhtacmeeqynqyqvngerlngrqtlgeniadngglkaaynaykawlrk
ENSP00000290863  gsdehdinflmkmaldkiafipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssv
ENSP00000387760  gsdehdinflmkmaldkiafipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssv
ENSP00000464149  gsdehdinflmkmaldkiafipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssv
ENSP00000397593  gsdehdinflmkmaldkiafipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssv
ENSP00000290866  gsdehdinflmkmaldkiafipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssv
ENSP00000388439  vngepvngrhtlgeniadngglkaayrvwcsvrtpessheglitdphspsrfrvigslsnskefsehfrcppgspmnpphk
ENSP00000397593  ndtesdinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrnethfdagakfhvpnvt
ENSP00000290866  ndtesdinyllkmalekiaflpfgylvdqwrwgvfsgrtppsrynfdwwylrtkyqgicppvtrnethfdagakfhvpnvt
ENSP00000302051  algalfvhehfsaaskakvqqlvedikyilgqrleeldwmdaetraaaraklqymmvmvgypdfllkpdavdkeyefevhe
ENSP00000386333  nrhfgmalgalfvhehfsaaskakvqqlvedikyilgqrleeldwmdaetraaaraklqymmvmvgypdfllkpdavdkey
ENSP00000368682  fthgfdnngrkydkngnldpwwsteseekfkektkcminqysnyywkkaglnvkgkrtlgeniadngglreafrayrkwin
ENSP00000398444  igvvmghelthafddqgreydkegnlrpwwqneslaafrnhtacmeeqynqyqvngerlngrqtlgeniadngglkaayna
ENSP00000252519  fqedneteinfllkqaltivgtlpftymlekwrwmvfkgeipkdqwmkkwwemkreivgvvepvphdetycdpaslfhvsn
ENSP00000389326  fqedneteinfllkqaltivgtlpftymlekwrwmvfkgeipkdqwmkkwwemkreivgvvepvphdetycdpaslfhvsn
ENSP00000392247  gsdehdinflmkmaldkiafipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvprtqgdfdpgakfhipssv
ENSP00000304467  savprellekliesrqantglfnlrqivlakvdqalhtqtdadpaeeyarlcqeilgvpatpgtnmpatfghlaggydaqy
ENSP00000370372  spiaddlleklvasrlvntglltlrqivlskvdqslhtntsldaaseyakycseilgvaatpgtnmpatfghlaggydgqy
ENSP00000422492  iadnggvrqaykaylkwmaeggkdqqlpgldltheqlffinyaqvwcgsyrpefaiqsiktdvhsplkyrvlgslqnlaaf
ENSP00000482173  iadnggvrqaykaylkwmaeggkdqqlpgldltheqlffinyaqvwcgsyrpefaiqsiktdvhsplkyrvlgslqnlaaf
ENSP00000423214  spiaddlleklvasrlvntglltlrqivlskvdqslhtntsldaaseyakycseilgvaatpgtnmpatfghlaggydgqy
ENSP00000467226  savprellekliesrqantglfnlrqivlakvdqalhtqtdadpaeeyarlcqeilgvpatpgtnmpatfghlaggydaqy
ENSP00000347409  lgssflqsvlscvrslrarivqsflqphpqhrwkvspwdvnayysvsdhvvvfpagllqppffhpgypravnfgaagsima
ENSP00000477793  lgssflqsvlscvrslrarivqsflqphpqhrwkvspwdvnayysvsdhvvvfpagllqppffhpgypravnfgaagsima
ENSP00000425477  qvleletqlakatvpqeerhdvialyhrmgleelqsqfglkgfnwtlfiqtvlssvkikllpdeevvvygipylqnlenii
ENSP00000410926  rdnkivrhtvyllvtprvveearkhfdcpvlegmelenqggvgtelnhwekrlleneamtgshtqnrvlsritlalmedtg
ENSP00000418324  rdnkivrhtvyllvtprvveearkhfdcpvlegmelenqggvgtelnhwekrlleneamtgshtqnrvlsritlalmedtg
ENSP00000371607  qplpknmvsrlceskkvcaaadmqlqvfyatldqiyhgkhplrnsttdilketqekfyglpyvpntawqlrfshlvgygar
ENSP00000328829  rdnkivrhtvyllvtprvveearkhfdcpvlegmelenqggvgtelnhwekrlleneamtgshtqnrvlsritlalmedtg
ENSP00000328611  rdnkivrhtvyllvtprvveearkhfdcpvlegmelenqggvgtelnhwekrlleneamtgshtqnrvlsritlalmedtg
ENSP00000462909  kptdgrevvchasawdfynehdinflmkmaldkiafipfsylvdqwrwrvfdgsitkenynqewwslrlkyqglcppvp..
ENSP00000427417  etdfarfsgtnvetdfvevpsqmlenwvwdvdslrrlskhykdgspiaddlleklvasrlvntglltlrqivlskvdqslh
ENSP00000433287  hpievsvghpsevdeifdaisyskgasvirmlhdyigdkdfkkgmnmyltkfqqknaatedlweslenasgkpiaavmntw
ENSP00000320324  hpievsvghpsevdeifdaisyskgasvirmlhdyigdkdfkkgmnmyltkfqqknaatedlweslenasgkpiaavmntw
ENSP00000265162  vlpvqeddslmsshpiivtvttpdeitsvfdgisyskgssilrmledwikpenfqkgcqmylekyqfknaktsdfwaalee
ENSP00000300060  rvmavdalasshplstpaseintpaqiselfdaisyskgasvlrmlssflsedvfkqglasylhtfayqntiylnlwdhlq
ENSP00000406304  amevdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasicp
ENSP00000296754  amevdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqylqkhsykntknedlwdsmasicp
ENSP00000231368  lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrmmktwtlqkgfplvtv......
ENSP00000379117  lsyfkgsslllmlktylsedvfqhavvlylhnhsyasiqsddlwdsfnevtnqtldvkrmmktwtlqkgfplvtv......
ENSP00000426959  spiaddlleklvasrlvntglltlrqivlskvdqslhtntsldaaseyakycseilgvaatpgtnmpatfghlaggydgqy
ENSP00000228740  qnsvktfgethpftklvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekfsyksittddwkdflys
ENSP00000421175  vitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnscl
ENSP00000400376  vitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnscl
ENSP00000369235  vitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsnscl
ENSP00000261180  hevmlldglasshpvsqevlqatdidrvfdwiaykkgaalirmlanfmghsvfqrglqdyltihkygnaarndlwntlsea
ENSP00000395051  qnsvktfgethpftklvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekfsyksittddwkdflys
ENSP00000449958  qnsvktfgethpftklvvdltdidpdvayssvpyekgfallfyleqllggpeiflgflkayvekfsyksittddwkdflys
ENSP00000421849  vitkdslnssrpiskpaetptqiqemfdevsynkgacilnmlkdflgeekfqkgiiqylkkfsyrnaknddlwsslsns..
ENSP00000465855  savprellekliesrqantglfnlrqivlakvdqalhtqtdadpaeeyarlcqeilgvpatpggydaqyygylwsevysmd
ENSP00000462280  ipahllgdmwaqsweniydmvvpfpdkpnldvtstml............................................
ENSP00000423604  ilredhalvtravamkvenfktseiqelfdiftyskgasmarmlscflnehlfvsalksylktfsysnaeqddlwrhfqma
ENSP00000378899  ilredhalvtravamkvenfktseiqelfdiftyskgasmarmlscflnehlfvsalksylktfsysnaeqddlwrhfqma
ENSP00000350541  ilredhalvtravamkvenfktseiqelfdiftyskgasmarmlscflnehlfvsalksylktfsysnaeqddlwrhfqma
ENSP00000309968  e................................................................................
ENSP00000412683  kythdqlffiafaqnwcikrrsqsiylqvltdkhapehyrvlgsvsqfeefgrafhcpkdspmnpahkcsvw.........
ENSP00000393699  .................................................................................
ENSP00000265769  .................................................................................
ENSP00000295640  rqhmditgeenplnklrvkiepgvdpddtynetpyekgfcfvsylahlvgdqdqfdsflkayvhefkfrsiladdfldfyl
ENSP00000357665  lfn..............................................................................
ENSP00000357668  lfn..............................................................................
ENSP00000389602  rqhmditgeenplnklrvkiepgvdpddtynetpyekgfcfvsylahlvgdqdqfdsflkayvhefkfrsiladdfldfyl
ENSP00000418737  .................................................................................
ENSP00000369249  .................................................................................
ENSP00000418437  .................................................................................
ENSP00000419446  .................................................................................
ENSP00000453043  .................................................................................
ENSP00000453855  .................................................................................
ENSP00000453302  .................................................................................
ENSP00000322550  p................................................................................
ENSP00000348912  p................................................................................
ENSP00000369190  p................................................................................
ENSP00000270357  pvsklqvklepgvnpshlmnlftyekgycfvyylsqlcgdpqrfddflrayvekykftsvvaqdlldsflsffpelkeqsv
ENSP00000422937  mfldtilpsrddngirpaigqrtrlskgdiaqarklyrc..........................................
ENSP00000257527  .................................................................................
ENSP00000428654  .................................................................................
ENSP00000061240  mfldtilpsrddngirpaigqrtrlskgdiaqarklyrc..........................................
ENSP00000426082  mfldtilpsrddngirpaigqrtrlskgdiaqarklyrc..........................................
ENSP00000373472  .................................................................................
ENSP00000175238  .................................................................................
ENSP00000370166  .................................................................................
ENSP00000466653  savprellekliesrqantglfnlrqigl....................................................
ENSP00000350630  ldtilprqddngvrptigqrvrlsqgdiaqarklykc............................................
ENSP00000428665  gifldtivpkyevngvkppigqrtrlskgdiaqarklykc.........................................
ENSP00000430406  gifldtivpkyevngvkppigqrtrlskgdiaqarklykc.........................................
ENSP00000306121  gifldtivpkyevngvkppigqrtrlskgdiaqarklykc.........................................
ENSP00000428332  gifldtivpkyevngvkppigqrtrlskgdiaqarklykc.........................................
ENSP00000482883  .................................................................................
ENSP00000299855  .................................................................................
ENSP00000370443  .................................................................................
ENSP00000305714  gifldtivpkyevngvkppigqrtrlskgdiaqarklykc.........................................
ENSP00000260302  .................................................................................
ENSP00000339672  .................................................................................
ENSP00000356255  rqhmditgeenplnklrvkiepgvdpddtynetpyekgfcfvsylahlvgdqdqfdsflkayvhefkfrsiladdfldfyl
ENSP00000322788  .................................................................................
ENSP00000435639  sevdeifdaisyskgasvirmlhdyigdkdfkkgmnmyltkfqqknaa.................................
ENSP00000418735  .................................................................................
ENSP00000260228  .................................................................................
ENSP00000458585  .................................................................................
ENSP00000270328  .................................................................................
ENSP00000471851  .................................................................................
ENSP00000476000  .................................................................................
ENSP00000353892  .................................................................................
ENSP00000271836  .................................................................................
ENSP00000357397  .................................................................................
ENSP00000432347  .................................................................................
ENSP00000434227  .................................................................................
ENSP00000432927  .................................................................................
ENSP00000349436  .................................................................................
ENSP00000403843  .................................................................................
ENSP00000348227  .................................................................................
ENSP00000352226  .................................................................................
ENSP00000246186  .................................................................................
ENSP00000344847  .................................................................................
ENSP00000422554  .................................................................................
ENSP00000401004  .................................................................................
ENSP00000427573  flgeekfqkgiiqylkkfsyrnaknddlwssl.................................................
ENSP00000279441  .................................................................................
ENSP00000260227  .................................................................................
ENSP00000236826  .................................................................................
ENSP00000300762  .................................................................................
ENSP00000369753  .................................................................................
ENSP00000378911  .................................................................................
ENSP00000448341  .................................................................................
ENSP00000484172  .................................................................................
ENSP00000374071  .................................................................................
ENSP00000256389  .................................................................................
ENSP00000286614  .................................................................................
ENSP00000308208  .................................................................................
ENSP00000465895  savprellekliesrqantglfnlrqivlakvdqalhtqtdadpaeeyarlcqeilgvpatpgtnmpatfghlaggydaqy
ENSP00000421631  .................................................................................
ENSP00000419217  .................................................................................
ENSP00000282849  .................................................................................
ENSP00000260229  .................................................................................
ENSP00000215743  .................................................................................
ENSP00000483349  .................................................................................
ENSP00000274181  .................................................................................
ENSP00000299164  lldq.............................................................................
ENSP00000284987  .................................................................................
ENSP00000474385  .................................................................................
ENSP00000284984  .................................................................................
ENSP00000435966  raqeldaldnshpievsvghpsevdeifdaisyskgasvirmlhdyigdkdfkkgmnmyltkfqqknaa............
ENSP00000219271  .................................................................................
ENSP00000369238  citrysagvalypkeitleafavivtqmlalslgisyddpkkcqcsestcimnpevvqsngvktfsscslrsfqnfisnvg
ENSP00000484817  citrysagvalypkeitleafavivtqmlalslgisyddpkkcqcsestcimnpevvqsngvktfsscslrsfqnfisnvg
ENSP00000407614  fcfvsylahlvgdqdqfdsflkayvhefkfrsiladdfldf........................................
ENSP00000269202  s................................................................................
ENSP00000463280  s................................................................................
ENSP00000260408  ekkrnncfve.......................................................................
ENSP00000356975  dk...............................................................................
ENSP00000430400  .................................................................................
ENSP00000420101  aekaiaqlnskygkkvlinlfvgtddknsvnhvihidqprlglpsrdyye...............................
ENSP00000265707  nksydagiamypdaiglegfsviiaqllglnvgltydditqcfclratcimnheavsasgrkifsncsmhdyryfvskfet
ENSP00000482348  nksydagiamypdaiglegfsviiaqllglnvgltydditqcfclratcimnheavsasgrkifsncsmhdyryfvskfet
ENSP00000352177  .................................................................................
ENSP00000384229  .................................................................................
ENSP00000414544  .................................................................................
ENSP00000423517  .................................................................................
ENSP00000478469  .................................................................................
ENSP00000484862  .................................................................................
ENSP00000268070  .................................................................................
ENSP00000428993  qap..............................................................................
ENSP00000256412  qap..............................................................................
ENSP00000429352  rtisleslavilaqllslsmgityddinkcqcsgavcimnpeaihfsgvkifsncsfedfahfiskqksqclhn.......
ENSP00000478636  rtisleslavilaqllslsmgityddinkcqcsgavcimnpeaihfsgvkifsncsfedfahfiskqksqclhn.......
ENSP00000483607  rtisleslavilaqllslsmgityddinkcqcsgavcimnpeaihfsgvkifsncsfedfahfiskqksqclhn.......
ENSP00000265708  rtisleslavilaqllslsmgityddinkcqcsgavcimnpeaihfsgvkifsncsfedfahfiskqksqclhn.......
ENSP00000482337  rtisleslavilaqllslsmgityddinkcqcsgavcimnpeaihfsgvkifsncsfedfahfiskqksqclhn.......
ENSP00000257359  .................................................................................
ENSP00000408070  .................................................................................
ENSP00000274487  .................................................................................
ENSP00000362304  .................................................................................
ENSP00000464428  plldwlrtenelhgeklgwp.............................................................
ENSP00000343674  lwapsvhigqrwnlsasditrvlklygc.....................................................
ENSP00000274609  .................................................................................
ENSP00000465537  shgggvneygnmgamavtlaqtlgqnlgmmwnkhrssagdckcpdiwlgcimedtgfylprkfsrcsideynqflqegggs
ENSP00000295903  .................................................................................
ENSP00000230588  dlerlnrmync......................................................................
ENSP00000443773  shgggvneygnmgamavtlaqtlgqnlgmmwnkhrssagdckcpdiwlgcimedtgfylprkfsrcsideynqflqegggs
ENSP00000480465  dlerlnrmync......................................................................
ENSP00000251582  .................................................................................
ENSP00000200557  shgggvneygnmgamavtlaqtlgqnlgmmwnkhrssagdckcpdiwlgcimedtgfylprkfsrcsideynqflqegggs
ENSP00000362303  .................................................................................
ENSP00000264377  gvgvneyglpmavaqvlsqslaqnlgiqwepssrkpkcdcteswggcimeetgvshsrkfskcsileyrdflqrgggaclf
ENSP00000363536  gvgvneyglpmavaqvlsqslaqnlgiqwepssrkpkcdcteswggcimeetgvshsrkfskcsileyrdflqrgggaclf
ENSP00000378638  nrwlpalragpalpgcnialgslqvgmdyrscilrpggsedasamlrrflgrdpkqdaflls...................
ENSP00000286657  .................................................................................
ENSP00000480055  .................................................................................
ENSP00000337816  .................................................................................
ENSP00000464786  gsedasam.........................................................................
ENSP00000381261  gicsllkgggvnefgktdlmavtlaqslahnigiisdkrklasgeckcedtwsgcimgdtgyylpkkftqcnieeyhdfln
ENSP00000381260  gicsllkgggvnefgktdlmavtlaqslahnigiisdkrklasgeckcedtwsgcimgdtgyylpkkftqcnieeyhdfln
ENSP00000381262  gicsllkgggvnefgktdlmavtlaqslahnigiisdkrklasgeckcedtwsgcimgdtgyylpkkftqcnieeyhdfln
ENSP00000265727  gicsllkgggvnefgktdlmavtlaqslahnigiisdkrklasgeckcedtwsgcimgdtgyylpkkftqcnieeyhdfln
ENSP00000381267  gicsllkgggvnefgktdlmavtlaqslahnigiisdkrklasgeckcedtwsgcimgdtgyylpkkftqcnieeyhdfln
ENSP00000343854  slavilaqllslsmgityddinkcqcsgavcimnpeaihfsgvkifsncsfedfahfiskqksqclhn.............
ENSP00000484999  slavilaqllslsmgityddinkcqcsgavcimnpeaihfsgvkifsncsfedfahfiskqksqclhn.............
ENSP00000358407  .................................................................................
ENSP00000313437  .................................................................................
ENSP00000353767  .................................................................................
ENSP00000479124  .................................................................................
ENSP00000483299  .................................................................................
ENSP00000348308  .................................................................................
ENSP00000482367  .................................................................................
ENSP00000403404  .................................................................................
ENSP00000401854  lrwrrlqdemqcspeemqvlrpskdktghtsdsgasvikhglnpekifmqvhylkgyfllrflakrlgdetyfsflrkfvh
ENSP00000481051  .................................................................................
ENSP00000473853  .................................................................................
ENSP00000484430  .................................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  .................................................................................
ENSP00000364464  lrwrrlqdemqcspeemqvlrpskdktghtsdsgasvikhglnpekifmqvhylkgyfllrflakrlgdetyfsflrkfvh
ENSP00000347927  .................................................................................
ENSP00000360997  .................................................................................
ENSP00000429557  .................................................................................
ENSP00000361405  .................................................................................
ENSP00000360979  .................................................................................
ENSP00000435274  .................................................................................
ENSP00000346941  .................................................................................
ENSP00000428249  .................................................................................
ENSP00000348997  .................................................................................
ENSP00000369195  nksydagiamypdaiglegfsviiaqllglnvgltydditqcfclratcimnheavsasgrkifsncsmhdyryfvskfet
ENSP00000446979  .................................................................................
ENSP00000329614  .................................................................................
ENSP00000380805  .................................................................................
ENSP00000380813  .................................................................................
ENSP00000219070  .................................................................................
ENSP00000444143  .................................................................................
ENSP00000461421  .................................................................................
ENSP00000394237  .................................................................................
ENSP00000436733  pieyyrlsaschnp...................................................................
ENSP00000442104  .................................................................................
ENSP00000456096  .................................................................................
ENSP00000357798  .................................................................................
ENSP00000429422  citrysagvalqcgpasccdfrtcvlkdgakcykglcckdcqi......................................
ENSP00000483377  citrysagvalqcgpasccdfrtcvlkdgakcykglcckdcqi......................................
ENSP00000405978  citrysagvalqcgpasccdfrtcvlkdgakcykglcckdcqi......................................
ENSP00000420011  msqyghfpffraylgphpasphtpv........................................................
ENSP00000453952  kk...............................................................................
ENSP00000417595  .................................................................................
ENSP00000423780  .................................................................................
ENSP00000435305  .................................................................................
ENSP00000340675  .................................................................................
ENSP00000426265  .................................................................................
ENSP00000465545  slrpeaarylerliklgrrnglhlpretqenikrikkklsllcidfnknlnedt...........................
ENSP00000482854  .................................................................................
ENSP00000277198  lrwrrlqdemqcspeem................................................................
ENSP00000457949  .................................................................................
ENSP00000484562  .................................................................................
ENSP00000431856  .................................................................................
ENSP00000462599  tysvatvchpngsclqlepal............................................................
ENSP00000405867  .................................................................................
ENSP00000457084  .................................................................................
ENSP00000431065  .................................................................................
ENSP00000419889  .................................................................................
ENSP00000461938  .................................................................................
ENSP00000427418  .................................................................................
ENSP00000427500  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000427574  .................................................................................
ENSP00000456518  .................................................................................
ENSP00000418886  .................................................................................
ENSP00000441485  .................................................................................
ENSP00000380808  .................................................................................
ENSP00000391334  .................................................................................
ENSP00000391268  .................................................................................
ENSP00000418791  .................................................................................
ENSP00000463673  .................................................................................
ENSP00000402171  gqlilsqdflqmllenipeekrlelsveniyqdwlessgip........................................
ENSP00000369182  .................................................................................
ENSP00000480574  .................................................................................
ENSP00000297979  gqlilsqdflqmllenipeekrlelsveniyqdwlessgip........................................
ENSP00000447822  qwtlqmgypviti....................................................................
ENSP00000436633  .................................................................................
ENSP00000453545  .................................................................................
ENSP00000386625  .................................................................................
ENSP00000356974  .................................................................................
ENSP00000352976  .................................................................................
ENSP00000376481  .................................................................................
ENSP00000463012  .................................................................................
ENSP00000464133  .................................................................................
ENSP00000464635  .................................................................................
ENSP00000483162  .................................................................................
ENSP00000441710  .................................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  sikhphtlsweyysmfqckahlvmrlienrismefmlqvfnkllslastassqkfqshmwsqmlvstsgflksisnvsgkd
ENSP00000423748  .................................................................................
ENSP00000352831  .................................................................................
ENSP00000330658  .................................................................................
ENSP00000446989  .................................................................................
ENSP00000367945  .................................................................................
ENSP00000482664  .................................................................................
ENSP00000380915  .................................................................................
ENSP00000427950  .................................................................................
ENSP00000428798  .................................................................................
ENSP00000430977  .................................................................................
ENSP00000390872  hgavgvpdqegisdadfvlyvgalat.......................................................
ENSP00000484600  .................................................................................
ENSP00000418728  .................................................................................
ENSP00000462038  .................................................................................
ENSP00000356634  cgftrfpgapftnymsytddnctdnftpnqvarmhcy............................................
ENSP00000380806  .................................................................................
ENSP00000420542  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000430832  fnkllslastassqkfqshmwsqmlvstsgflksisnvsgkdiqplikqwvdqsgv.........................
ENSP00000462995  anlplakrqqis.....................................................................
ENSP00000356633  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000425758  .................................................................................
ENSP00000469559  .................................................................................
ENSP00000469901  .................................................................................
ENSP00000414661  .................................................................................
ENSP00000411451  .................................................................................
ENSP00000462002  .................................................................................
ENSP00000308149  .................................................................................


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  kyrvlgslqnlaafadtfhcargtpmhpkercrvw..............................................
ENSP00000484606  kyrvlgslqnlaafadtfhcargtpmhpkercrvw..............................................
ENSP00000405088  srfrvigslsnskefsehfrcppgspmnpphkcevw.............................................
ENSP00000349581  srfrvigslsnskefsehfrcppgspmnpphkcevw.............................................
ENSP00000264205  srfrvigslsnskefsehfrcppgspmnpphkcevw.............................................
ENSP00000364028  srfrvigslsnskefsehfrcppgspmnpphkcevw.............................................
ENSP00000353679  gldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhspgnfriigtlqnsaefseafhcrknsymnpekkcrvw.......
ENSP00000417079  gldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhspgnfriigtlqnsaefseafhcrknsymnpekkcrvw.......
ENSP00000418525  gldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhspgnfriigtlqnsaefseafhcrknsymnpekkcrvw.......
ENSP00000419653  gldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhspgnfriigtlqnsaefseafhcrknsymnpekkcrvw.......
ENSP00000420389  gldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhspgnfriigtlqnsaefseafhcrknsymnpekkcrvw.......
ENSP00000478173  gldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhspgnfriigtlqnsaefseafhcrknsymnpekkcrvw.......
ENSP00000352052  hgeeqqlpavgltnhqlffvgfaqvwcsvrtpessheglvtdphsparfrvlgtlsnsrdflrhfgcpvgspmnpgqlcev
ENSP00000385846  hgeeqqlpavgltnhqlffvgfaqvwcsvrtpessheglvtdphsparfrvlgtlsnsrdflrhfgcpvgspmnpgqlcev
ENSP00000350066  hgeeqqlpavgltnhqlffvgfaqvwcsvrtpessheglvtdphsparfrvlgtlsnsrdflrhfgcpvgspmnpgqlcev
ENSP00000384223  hgeeqqlpavgltnhqlffvgfaqvwcsvrtpessheglvtdphsparfrvlgtlsnsrdflrhfgcpvgspmnpgqlcev
ENSP00000290863  pyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlitgqpnmsasamlsyfkpl
ENSP00000387760  pyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlitgqpnmsasamlsyfkpl
ENSP00000464149  pyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlitgqpnmsasamlsyfkpl
ENSP00000397593  pyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlitgqpnmsasamlsyfkpl
ENSP00000290866  pyiryfvsfiiqfqfhealcqaaghtgplhkcdiyqskeagqrlatamklgfsrpwpeamqlitgqpnmsasamlsyfkpl
ENSP00000388439  cevw.............................................................................
ENSP00000397593  pyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkvlqagssrpwqevlkdmvgldaldaqpllkyfqpv
ENSP00000290866  pyiryfvsfvlqfqfhealckeagyegplhqcdiyrstkagaklrkvlqagssrpwqevlkdmvgldaldaqpllkyfqpv
ENSP00000302051  ktyfknilnsirfsiqlsvkkirqevdkstwllppqalnayylpnknqmvfpagilqptlydpdfpqslnyggigtiighe
ENSP00000386333  efevhektyfknilnsirfsiqlsvkkirqevdkwllppqalnayylpnknqmvfpagilqptlydpdfpqslnyggigti
ENSP00000368682  drrqgleepllpgitftnnqlfflsyahvrcnsyrpeaareqvqigahsppqfrvngaisnfeefqkafncppnstmnrgm
ENSP00000398444  ykawlrkhgeeqqlpavgltnhqlffvgfaqv.................................................
ENSP00000252519  dysfiryytrtlyqfqfqealcqaakhegplhkcdisnsteagqklfnmlrlgksepwtlalenvvgaknmnvrpllnyfe
ENSP00000389326  dysfiryytrtlyqfqfqealcqaakhegplhkcdisnsteagqklfnmlrlgksepwtlalenvvgaknmnvrpllnyfe
ENSP00000392247  pyirtamklgfsrpwpeamqlitgqpnmsasamlsyfkplldwlrtenelhgeklgwp.......................
ENSP00000304467  ygylwsevysmdmfhtrfkqegvlnskvgmdyrscilrpggsedasamlrrflgrdpkqdafl..................
ENSP00000370372  ygylwsevfsmdmfyscfkkegimnpevgmkyrnlilkpggsldgmdmlhnflkrepnqkaflmsrg..............
ENSP00000422492  adtfhcargtpmhpkercrvw............................................................
ENSP00000482173  adtfhcargtpmhpkercrvw............................................................
ENSP00000423214  ygylwsevfsmdmfyscfkkegimnpevgmkyrnlilkpggsldgmdmlhnflkrepnqkaflmsrg..............
ENSP00000467226  ygylwsevysmdmfhtrfkqegvlnskvgmdyrscilrpggsedasamlrrflgrdpkqdafl..................
ENSP00000347409  hellhifyqlllpggclacdnhalqeahlclkrhyaafplpsrtsfndsltflenaadvgglaialqayskrllrhhgetv
ENSP00000477793  hellhifyqlllpggclacdnhalqeahlclkrhyaafplpsrtsfndsltflenaadvgglaialqayskrllrhhgetv
ENSP00000425477  dtysartiqnylvwrlvldrigslsqrfkdtrvnyrkalfgtmveevrwrecvgyvnsnmenavgslyvreafpgdsksmv
ENSP00000410926  wykanysmaekldwgrgmgcdfvrksckfwidqqrqkrqmlspycdtlrsnplqltcrqdqravavcnlqkfpkplpqeyq
ENSP00000418324  wykanysmaekldwgrgmgcdfvrksckfwidqqrqkrqmlspycdtlrsnplqltcrqdqravavcnlqkfpkplpqeyq
ENSP00000371607  yysylmsravasmvwkecflqdpfnraageryrremlahgggrepmlmvegmlqkcpsvddfvs.................
ENSP00000328829  rqmlspycdtlrsnplqltcrqdqravavcnlqkfpkplpqeyqyfdelsgipaedlpyyggsveiadycpfsqefswhls
ENSP00000328611  rqmlspycdtlrsnplqltcrqdqravavcnlqkfpkplpqeyqyfdelsgipaedlpyyggsveiadycpfsqefswhls
ENSP00000462909  .................................................................................
ENSP00000427417  tntsldaaseyakycseilgvaatpgtnmpatfghlaggydgqyygylwsevfsmdmfyscfkkegimnpevgmkyrnlil
ENSP00000433287  tkqmgfpliyve.....................................................................
ENSP00000320324  tkqmgfpliyve.....................................................................
ENSP00000265162  asrlpvkevmdtwtrqmgypvlnv.........................................................
ENSP00000300060  eavnnrsiqlpttvrdimnrwtlqmgfpvitvd................................................
ENSP00000406304  tdgvkgmdgfcsrsqhssssshwhqegvdvktmmntwtlqkgfpliti.................................
ENSP00000296754  tdgvkgmdgfcsrsqhssssshwhqegvdvktmmntwtlqkgfpliti.................................
ENSP00000231368  .................................................................................
ENSP00000379117  .................................................................................
ENSP00000426959  ygylwsevfsmdmfyscfkkegimnpet.....................................................
ENSP00000228740  yfkdkvdvlnqvdwnawlyspglppi.......................................................
ENSP00000421175  esdftsggvchsdpkmtsnmlaflgenaevkemmttwtlqkgipllvv.................................
ENSP00000400376  esdftsggvchsdpkmtsnmlaflgenaevkemmttwtlqkgipllvv.................................
ENSP00000369235  esdftsggvchsdpkmtsnmlaflgenaevkemmttwtlqkgipllvv.................................
ENSP00000261180  lkrngkyvniqevmdqwtlqmgypviti.....................................................
ENSP00000395051  yfkdkvdvlnqvdwnawlyspglppikp.....................................................
ENSP00000449958  yfkdkvdvlnqvdwnawlyspglppikp.....................................................
ENSP00000421849  .................................................................................
ENSP00000465855  mfhtrfkqegvlnskvgmdyrscilrpggsedasamlrrflgrdpkqdafl..............................
ENSP00000462280  .................................................................................
ENSP00000423604  iddqstvilpatiknimdswthqsgfpvitl..................................................
ENSP00000378899  iddqstvilpatiknimdswthqsgfpvitl..................................................
ENSP00000350541  iddqstvilpatiknimdswthqsgfpvitl..................................................
ENSP00000309968  .................................................................................
ENSP00000412683  .................................................................................
ENSP00000393699  .................................................................................
ENSP00000265769  .................................................................................
ENSP00000295640  eyfpelkkkrvdiipgfefdrwlntpgwppy..................................................
ENSP00000357665  .................................................................................
ENSP00000357668  .................................................................................
ENSP00000389602  eyfpel...........................................................................
ENSP00000418737  .................................................................................
ENSP00000369249  .................................................................................
ENSP00000418437  .................................................................................
ENSP00000419446  .................................................................................
ENSP00000453043  .................................................................................
ENSP00000453855  .................................................................................
ENSP00000453302  .................................................................................
ENSP00000322550  .................................................................................
ENSP00000348912  .................................................................................
ENSP00000369190  .................................................................................
ENSP00000270357  dcragleferwlnatgpplae............................................................
ENSP00000422937  .................................................................................
ENSP00000257527  .................................................................................
ENSP00000428654  .................................................................................
ENSP00000061240  .................................................................................
ENSP00000426082  .................................................................................
ENSP00000373472  .................................................................................
ENSP00000175238  .................................................................................
ENSP00000370166  .................................................................................
ENSP00000466653  .................................................................................
ENSP00000350630  .................................................................................
ENSP00000428665  .................................................................................
ENSP00000430406  .................................................................................
ENSP00000306121  .................................................................................
ENSP00000428332  .................................................................................
ENSP00000482883  .................................................................................
ENSP00000299855  .................................................................................
ENSP00000370443  .................................................................................
ENSP00000305714  .................................................................................
ENSP00000260302  .................................................................................
ENSP00000339672  .................................................................................
ENSP00000356255  eyfpelkkkrvdiipgfefdrwlntpgwppy..................................................
ENSP00000322788  .................................................................................
ENSP00000435639  .................................................................................
ENSP00000418735  .................................................................................
ENSP00000260228  .................................................................................
ENSP00000458585  .................................................................................
ENSP00000270328  .................................................................................
ENSP00000471851  .................................................................................
ENSP00000476000  .................................................................................
ENSP00000353892  .................................................................................
ENSP00000271836  .................................................................................
ENSP00000357397  .................................................................................
ENSP00000432347  .................................................................................
ENSP00000434227  .................................................................................
ENSP00000432927  .................................................................................
ENSP00000349436  .................................................................................
ENSP00000403843  .................................................................................
ENSP00000348227  .................................................................................
ENSP00000352226  .................................................................................
ENSP00000246186  .................................................................................
ENSP00000344847  .................................................................................
ENSP00000422554  .................................................................................
ENSP00000401004  .................................................................................
ENSP00000427573  .................................................................................
ENSP00000279441  .................................................................................
ENSP00000260227  .................................................................................
ENSP00000236826  .................................................................................
ENSP00000300762  .................................................................................
ENSP00000369753  .................................................................................
ENSP00000378911  .................................................................................
ENSP00000448341  .................................................................................
ENSP00000484172  .................................................................................
ENSP00000374071  .................................................................................
ENSP00000256389  .................................................................................
ENSP00000286614  .................................................................................
ENSP00000308208  .................................................................................
ENSP00000465895  ygylwsevysmdmfhtrfkqegvlns.......................................................
ENSP00000421631  .................................................................................
ENSP00000419217  .................................................................................
ENSP00000282849  .................................................................................
ENSP00000260229  .................................................................................
ENSP00000215743  .................................................................................
ENSP00000483349  .................................................................................
ENSP00000274181  .................................................................................
ENSP00000299164  .................................................................................
ENSP00000284987  .................................................................................
ENSP00000474385  .................................................................................
ENSP00000284984  .................................................................................
ENSP00000435966  .................................................................................
ENSP00000219271  .................................................................................
ENSP00000369238  vkclqn...........................................................................
ENSP00000484817  vkclqn...........................................................................
ENSP00000407614  .................................................................................
ENSP00000269202  .................................................................................
ENSP00000463280  .................................................................................
ENSP00000260408  .................................................................................
ENSP00000356975  .................................................................................
ENSP00000430400  .................................................................................
ENSP00000420101  .................................................................................
ENSP00000265707  kclq.............................................................................
ENSP00000482348  kclq.............................................................................
ENSP00000352177  .................................................................................
ENSP00000384229  .................................................................................
ENSP00000414544  .................................................................................
ENSP00000423517  .................................................................................
ENSP00000478469  .................................................................................
ENSP00000484862  .................................................................................
ENSP00000268070  .................................................................................
ENSP00000428993  .................................................................................
ENSP00000256412  .................................................................................
ENSP00000429352  .................................................................................
ENSP00000478636  .................................................................................
ENSP00000483607  .................................................................................
ENSP00000265708  .................................................................................
ENSP00000482337  .................................................................................
ENSP00000257359  .................................................................................
ENSP00000408070  .................................................................................
ENSP00000274487  .................................................................................
ENSP00000362304  .................................................................................
ENSP00000464428  .................................................................................
ENSP00000343674  .................................................................................
ENSP00000274609  .................................................................................
ENSP00000465537  clfn.............................................................................
ENSP00000295903  .................................................................................
ENSP00000230588  .................................................................................
ENSP00000443773  clfn.............................................................................
ENSP00000480465  .................................................................................
ENSP00000251582  .................................................................................
ENSP00000200557  clfn.............................................................................
ENSP00000362303  .................................................................................
ENSP00000264377  n................................................................................
ENSP00000363536  n................................................................................
ENSP00000378638  .................................................................................
ENSP00000286657  .................................................................................
ENSP00000480055  .................................................................................
ENSP00000337816  .................................................................................
ENSP00000464786  .................................................................................
ENSP00000381261  sgggaclfnkp......................................................................
ENSP00000381260  sgggaclfnkp......................................................................
ENSP00000381262  sgggaclfnkp......................................................................
ENSP00000265727  sgggaclfnkp......................................................................
ENSP00000381267  sgggaclfnkp......................................................................
ENSP00000343854  .................................................................................
ENSP00000484999  .................................................................................
ENSP00000358407  .................................................................................
ENSP00000313437  .................................................................................
ENSP00000353767  .................................................................................
ENSP00000479124  .................................................................................
ENSP00000483299  .................................................................................
ENSP00000348308  .................................................................................
ENSP00000482367  .................................................................................
ENSP00000403404  .................................................................................
ENSP00000401854  tfhgqlilsqdflqmllenipeekrlelsveniyqdwlessgip.....................................
ENSP00000481051  .................................................................................
ENSP00000473853  .................................................................................
ENSP00000484430  .................................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  .................................................................................
ENSP00000364464  tfhgqlilsqdflqmllenipeekrlelsveniyqdwlessgip.....................................
ENSP00000347927  .................................................................................
ENSP00000360997  .................................................................................
ENSP00000429557  .................................................................................
ENSP00000361405  .................................................................................
ENSP00000360979  .................................................................................
ENSP00000435274  .................................................................................
ENSP00000346941  .................................................................................
ENSP00000428249  .................................................................................
ENSP00000348997  .................................................................................
ENSP00000369195  kclq.............................................................................
ENSP00000446979  .................................................................................
ENSP00000329614  .................................................................................
ENSP00000380805  .................................................................................
ENSP00000380813  .................................................................................
ENSP00000219070  .................................................................................
ENSP00000444143  .................................................................................
ENSP00000461421  .................................................................................
ENSP00000394237  .................................................................................
ENSP00000436733  .................................................................................
ENSP00000442104  .................................................................................
ENSP00000456096  .................................................................................
ENSP00000357798  .................................................................................
ENSP00000429422  .................................................................................
ENSP00000483377  .................................................................................
ENSP00000405978  .................................................................................
ENSP00000420011  .................................................................................
ENSP00000453952  .................................................................................
ENSP00000417595  .................................................................................
ENSP00000423780  .................................................................................
ENSP00000435305  .................................................................................
ENSP00000340675  .................................................................................
ENSP00000426265  .................................................................................
ENSP00000465545  .................................................................................
ENSP00000482854  .................................................................................
ENSP00000277198  .................................................................................
ENSP00000457949  .................................................................................
ENSP00000484562  .................................................................................
ENSP00000431856  .................................................................................
ENSP00000462599  .................................................................................
ENSP00000405867  .................................................................................
ENSP00000457084  .................................................................................
ENSP00000431065  .................................................................................
ENSP00000419889  .................................................................................
ENSP00000461938  .................................................................................
ENSP00000427418  .................................................................................
ENSP00000427500  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000427574  .................................................................................
ENSP00000456518  .................................................................................
ENSP00000418886  .................................................................................
ENSP00000441485  .................................................................................
ENSP00000380808  .................................................................................
ENSP00000391334  .................................................................................
ENSP00000391268  .................................................................................
ENSP00000418791  .................................................................................
ENSP00000463673  .................................................................................
ENSP00000402171  .................................................................................
ENSP00000369182  .................................................................................
ENSP00000480574  .................................................................................
ENSP00000297979  .................................................................................
ENSP00000447822  .................................................................................
ENSP00000436633  .................................................................................
ENSP00000453545  .................................................................................
ENSP00000386625  .................................................................................
ENSP00000356974  .................................................................................
ENSP00000352976  .................................................................................
ENSP00000376481  .................................................................................
ENSP00000463012  .................................................................................
ENSP00000464133  .................................................................................
ENSP00000464635  .................................................................................
ENSP00000483162  .................................................................................
ENSP00000441710  .................................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  iqplikqwvdqsgv...................................................................
ENSP00000423748  .................................................................................
ENSP00000352831  .................................................................................
ENSP00000330658  .................................................................................
ENSP00000446989  .................................................................................
ENSP00000367945  .................................................................................
ENSP00000482664  .................................................................................
ENSP00000380915  .................................................................................
ENSP00000427950  .................................................................................
ENSP00000428798  .................................................................................
ENSP00000430977  .................................................................................
ENSP00000390872  .................................................................................
ENSP00000484600  .................................................................................
ENSP00000418728  .................................................................................
ENSP00000462038  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000380806  .................................................................................
ENSP00000420542  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000430832  .................................................................................
ENSP00000462995  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000425758  .................................................................................
ENSP00000469559  .................................................................................
ENSP00000469901  .................................................................................
ENSP00000414661  .................................................................................
ENSP00000411451  .................................................................................
ENSP00000462002  .................................................................................
ENSP00000308149  .................................................................................


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  .................................................................................
ENSP00000484606  .................................................................................
ENSP00000405088  .................................................................................
ENSP00000349581  .................................................................................
ENSP00000264205  .................................................................................
ENSP00000364028  .................................................................................
ENSP00000353679  .................................................................................
ENSP00000417079  .................................................................................
ENSP00000418525  .................................................................................
ENSP00000419653  .................................................................................
ENSP00000420389  .................................................................................
ENSP00000478173  .................................................................................
ENSP00000352052  w................................................................................
ENSP00000385846  w................................................................................
ENSP00000350066  w................................................................................
ENSP00000384223  w................................................................................
ENSP00000290863  ldwlrtenelhgeklgwp...............................................................
ENSP00000387760  ldwlrtenelhgeklgwp...............................................................
ENSP00000464149  ldwlrtenelhgeklgwp...............................................................
ENSP00000397593  ldwlrtenelhgeklgwp...............................................................
ENSP00000290866  ldwlrtenelhgeklgwp...............................................................
ENSP00000388439  .................................................................................
ENSP00000397593  tqwlqeqnqqngevlgwp...............................................................
ENSP00000290866  tqwlqeqnqqngevlgwp...............................................................
ENSP00000302051  lthgyddwggqydrsgnllhwwteasysrflrkaecivrlydnftvynqrvngkhtlgeniadmgglklayhayqkwvreh
ENSP00000386333  ighelthgyddwggqydrsgnllhwwteasysrflrkaecivrlydnftvynqrvngkhtlgeniadmgglklayhayqkw
ENSP00000368682  dscrlw...........................................................................
ENSP00000398444  .................................................................................
ENSP00000252519  plftwlkdqnknsfvgws...............................................................
ENSP00000389326  plftwlkdqnknsfvgws...............................................................
ENSP00000392247  .................................................................................
ENSP00000304467  .................................................................................
ENSP00000370372  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000423214  .................................................................................
ENSP00000467226  .................................................................................
ENSP00000347409  lpsldlspqqiffrsyaqvmcrkpspqdshdthspphlrvhgplsstpafaryfrcargallnpssrcqlw..........
ENSP00000477793  lpsldlspqqiffrsyaqvmcrkpspqdshdthspphlrvhgplsstpafaryfrcargallnpssrcqlw..........
ENSP00000425477  relidkvrtvfvetldelgwmdeeskkkaqekamsireqighpdyileemnrrldeeysnlnfsedlyfenslqnlkvgaq
ENSP00000410926  yfdelsgipaedlpyyggsveiadycpfsqefswhlsgeyqrssdcrilenqpeifknygaekygphsvcliqksafvmek
ENSP00000418324  yfdelsgipaedlpyyggsveiadycpfsqefswhlsgeyqrssdcrilenqpeifknygaekygphsvcliqksafvmek
ENSP00000371607  .................................................................................
ENSP00000328829  geyqrssdcrilenqpeifknygaekygphsvcliqksafvmekcerklsypdwgsgcyqvscspqglkvwvqdtsylcsr
ENSP00000328611  geyqrssdcrilenqpeifknygaekygphsvcliqksafvmekcerklsypdwgsgcyqvscspqglkvwvqdtsylcsr
ENSP00000462909  .................................................................................
ENSP00000427417  kpggsldgmdmlhnflkrepnqkaflmsrg...................................................
ENSP00000433287  .................................................................................
ENSP00000320324  .................................................................................
ENSP00000265162  .................................................................................
ENSP00000300060  .................................................................................
ENSP00000406304  .................................................................................
ENSP00000296754  .................................................................................
ENSP00000231368  .................................................................................
ENSP00000379117  .................................................................................
ENSP00000426959  .................................................................................
ENSP00000228740  .................................................................................
ENSP00000421175  .................................................................................
ENSP00000400376  .................................................................................
ENSP00000369235  .................................................................................
ENSP00000261180  .................................................................................
ENSP00000395051  .................................................................................
ENSP00000449958  .................................................................................
ENSP00000421849  .................................................................................
ENSP00000465855  .................................................................................
ENSP00000462280  .................................................................................
ENSP00000423604  .................................................................................
ENSP00000378899  .................................................................................
ENSP00000350541  .................................................................................
ENSP00000309968  .................................................................................
ENSP00000412683  .................................................................................
ENSP00000393699  .................................................................................
ENSP00000265769  .................................................................................
ENSP00000295640  .................................................................................
ENSP00000357665  .................................................................................
ENSP00000357668  .................................................................................
ENSP00000389602  .................................................................................
ENSP00000418737  .................................................................................
ENSP00000369249  .................................................................................
ENSP00000418437  .................................................................................
ENSP00000419446  .................................................................................
ENSP00000453043  .................................................................................
ENSP00000453855  .................................................................................
ENSP00000453302  .................................................................................
ENSP00000322550  .................................................................................
ENSP00000348912  .................................................................................
ENSP00000369190  .................................................................................
ENSP00000270357  .................................................................................
ENSP00000422937  .................................................................................
ENSP00000257527  .................................................................................
ENSP00000428654  .................................................................................
ENSP00000061240  .................................................................................
ENSP00000426082  .................................................................................
ENSP00000373472  .................................................................................
ENSP00000175238  .................................................................................
ENSP00000370166  .................................................................................
ENSP00000466653  .................................................................................
ENSP00000350630  .................................................................................
ENSP00000428665  .................................................................................
ENSP00000430406  .................................................................................
ENSP00000306121  .................................................................................
ENSP00000428332  .................................................................................
ENSP00000482883  .................................................................................
ENSP00000299855  .................................................................................
ENSP00000370443  .................................................................................
ENSP00000305714  .................................................................................
ENSP00000260302  .................................................................................
ENSP00000339672  .................................................................................
ENSP00000356255  .................................................................................
ENSP00000322788  .................................................................................
ENSP00000435639  .................................................................................
ENSP00000418735  .................................................................................
ENSP00000260228  .................................................................................
ENSP00000458585  .................................................................................
ENSP00000270328  .................................................................................
ENSP00000471851  .................................................................................
ENSP00000476000  .................................................................................
ENSP00000353892  .................................................................................
ENSP00000271836  .................................................................................
ENSP00000357397  .................................................................................
ENSP00000432347  .................................................................................
ENSP00000434227  .................................................................................
ENSP00000432927  .................................................................................
ENSP00000349436  .................................................................................
ENSP00000403843  .................................................................................
ENSP00000348227  .................................................................................
ENSP00000352226  .................................................................................
ENSP00000246186  .................................................................................
ENSP00000344847  .................................................................................
ENSP00000422554  .................................................................................
ENSP00000401004  .................................................................................
ENSP00000427573  .................................................................................
ENSP00000279441  .................................................................................
ENSP00000260227  .................................................................................
ENSP00000236826  .................................................................................
ENSP00000300762  .................................................................................
ENSP00000369753  .................................................................................
ENSP00000378911  .................................................................................
ENSP00000448341  .................................................................................
ENSP00000484172  .................................................................................
ENSP00000374071  .................................................................................
ENSP00000256389  .................................................................................
ENSP00000286614  .................................................................................
ENSP00000308208  .................................................................................
ENSP00000465895  .................................................................................
ENSP00000421631  .................................................................................
ENSP00000419217  .................................................................................
ENSP00000282849  .................................................................................
ENSP00000260229  .................................................................................
ENSP00000215743  .................................................................................
ENSP00000483349  .................................................................................
ENSP00000274181  .................................................................................
ENSP00000299164  .................................................................................
ENSP00000284987  .................................................................................
ENSP00000474385  .................................................................................
ENSP00000284984  .................................................................................
ENSP00000435966  .................................................................................
ENSP00000219271  .................................................................................
ENSP00000369238  .................................................................................
ENSP00000484817  .................................................................................
ENSP00000407614  .................................................................................
ENSP00000269202  .................................................................................
ENSP00000463280  .................................................................................
ENSP00000260408  .................................................................................
ENSP00000356975  .................................................................................
ENSP00000430400  .................................................................................
ENSP00000420101  .................................................................................
ENSP00000265707  .................................................................................
ENSP00000482348  .................................................................................
ENSP00000352177  .................................................................................
ENSP00000384229  .................................................................................
ENSP00000414544  .................................................................................
ENSP00000423517  .................................................................................
ENSP00000478469  .................................................................................
ENSP00000484862  .................................................................................
ENSP00000268070  .................................................................................
ENSP00000428993  .................................................................................
ENSP00000256412  .................................................................................
ENSP00000429352  .................................................................................
ENSP00000478636  .................................................................................
ENSP00000483607  .................................................................................
ENSP00000265708  .................................................................................
ENSP00000482337  .................................................................................
ENSP00000257359  .................................................................................
ENSP00000408070  .................................................................................
ENSP00000274487  .................................................................................
ENSP00000362304  .................................................................................
ENSP00000464428  .................................................................................
ENSP00000343674  .................................................................................
ENSP00000274609  .................................................................................
ENSP00000465537  .................................................................................
ENSP00000295903  .................................................................................
ENSP00000230588  .................................................................................
ENSP00000443773  .................................................................................
ENSP00000480465  .................................................................................
ENSP00000251582  .................................................................................
ENSP00000200557  .................................................................................
ENSP00000362303  .................................................................................
ENSP00000264377  .................................................................................
ENSP00000363536  .................................................................................
ENSP00000378638  .................................................................................
ENSP00000286657  .................................................................................
ENSP00000480055  .................................................................................
ENSP00000337816  .................................................................................
ENSP00000464786  .................................................................................
ENSP00000381261  .................................................................................
ENSP00000381260  .................................................................................
ENSP00000381262  .................................................................................
ENSP00000265727  .................................................................................
ENSP00000381267  .................................................................................
ENSP00000343854  .................................................................................
ENSP00000484999  .................................................................................
ENSP00000358407  .................................................................................
ENSP00000313437  .................................................................................
ENSP00000353767  .................................................................................
ENSP00000479124  .................................................................................
ENSP00000483299  .................................................................................
ENSP00000348308  .................................................................................
ENSP00000482367  .................................................................................
ENSP00000403404  .................................................................................
ENSP00000401854  .................................................................................
ENSP00000481051  .................................................................................
ENSP00000473853  .................................................................................
ENSP00000484430  .................................................................................
ENSP00000444603  .................................................................................
ENSP00000441106  .................................................................................
ENSP00000364464  .................................................................................
ENSP00000347927  .................................................................................
ENSP00000360997  .................................................................................
ENSP00000429557  .................................................................................
ENSP00000361405  .................................................................................
ENSP00000360979  .................................................................................
ENSP00000435274  .................................................................................
ENSP00000346941  .................................................................................
ENSP00000428249  .................................................................................
ENSP00000348997  .................................................................................
ENSP00000369195  .................................................................................
ENSP00000446979  .................................................................................
ENSP00000329614  .................................................................................
ENSP00000380805  .................................................................................
ENSP00000380813  .................................................................................
ENSP00000219070  .................................................................................
ENSP00000444143  .................................................................................
ENSP00000461421  .................................................................................
ENSP00000394237  .................................................................................
ENSP00000436733  .................................................................................
ENSP00000442104  .................................................................................
ENSP00000456096  .................................................................................
ENSP00000357798  .................................................................................
ENSP00000429422  .................................................................................
ENSP00000483377  .................................................................................
ENSP00000405978  .................................................................................
ENSP00000420011  .................................................................................
ENSP00000453952  .................................................................................
ENSP00000417595  .................................................................................
ENSP00000423780  .................................................................................
ENSP00000435305  .................................................................................
ENSP00000340675  .................................................................................
ENSP00000426265  .................................................................................
ENSP00000465545  .................................................................................
ENSP00000482854  .................................................................................
ENSP00000277198  .................................................................................
ENSP00000457949  .................................................................................
ENSP00000484562  .................................................................................
ENSP00000431856  .................................................................................
ENSP00000462599  .................................................................................
ENSP00000405867  .................................................................................
ENSP00000457084  .................................................................................
ENSP00000431065  .................................................................................
ENSP00000419889  .................................................................................
ENSP00000461938  .................................................................................
ENSP00000427418  .................................................................................
ENSP00000427500  .................................................................................
ENSP00000422492  .................................................................................
ENSP00000482173  .................................................................................
ENSP00000427574  .................................................................................
ENSP00000456518  .................................................................................
ENSP00000418886  .................................................................................
ENSP00000441485  .................................................................................
ENSP00000380808  .................................................................................
ENSP00000391334  .................................................................................
ENSP00000391268  .................................................................................
ENSP00000418791  .................................................................................
ENSP00000463673  .................................................................................
ENSP00000402171  .................................................................................
ENSP00000369182  .................................................................................
ENSP00000480574  .................................................................................
ENSP00000297979  .................................................................................
ENSP00000447822  .................................................................................
ENSP00000436633  .................................................................................
ENSP00000453545  .................................................................................
ENSP00000386625  .................................................................................
ENSP00000356974  .................................................................................
ENSP00000352976  .................................................................................
ENSP00000376481  .................................................................................
ENSP00000463012  .................................................................................
ENSP00000464133  .................................................................................
ENSP00000464635  .................................................................................
ENSP00000483162  .................................................................................
ENSP00000441710  .................................................................................
ENSP00000412107  .................................................................................
ENSP00000367406  .................................................................................
ENSP00000423748  .................................................................................
ENSP00000352831  .................................................................................
ENSP00000330658  .................................................................................
ENSP00000446989  .................................................................................
ENSP00000367945  .................................................................................
ENSP00000482664  .................................................................................
ENSP00000380915  .................................................................................
ENSP00000427950  .................................................................................
ENSP00000428798  .................................................................................
ENSP00000430977  .................................................................................
ENSP00000390872  .................................................................................
ENSP00000484600  .................................................................................
ENSP00000418728  .................................................................................
ENSP00000462038  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000380806  .................................................................................
ENSP00000420542  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000430832  .................................................................................
ENSP00000462995  .................................................................................
ENSP00000356633  .................................................................................
ENSP00000356634  .................................................................................
ENSP00000425758  .................................................................................
ENSP00000469559  .................................................................................
ENSP00000469901  .................................................................................
ENSP00000414661  .................................................................................
ENSP00000411451  .................................................................................
ENSP00000462002  .................................................................................
ENSP00000308149  .................................................................................


                                                                                                    
                                                                                                    
d1sata2            .................................................................................
ENSP00000367668  .................................................................................
ENSP00000484606  .................................................................................
ENSP00000405088  .................................................................................
ENSP00000349581  .................................................................................
ENSP00000264205  .................................................................................
ENSP00000364028  .................................................................................
ENSP00000353679  .................................................................................
ENSP00000417079  .................................................................................