SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


C-type lectin-like alignments

These alignments are sequences aligned to the 0035288 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1b08a1 pngq........................................................................................
d1b6ea_ csc.........................................................................................
d1bnla_ hshrdfqpvlhlvalnaplsggmrgirgadfqcfqqaravglagtfraflssrlqdlysivrradraavpivnlkdellfpswealfsgseg
d1byfa_ dy..........................................................................................
d1cwva5 nrwiydggr...................................................................................
d1dv8a_ ............................................................................................
d1e87a_ ssc.........................................................................................
d1egia_ cpedwgassr..................................................................................
d1f00i3 livpnms.....................................................................................
d1g1ta1 w...........................................................................................
d1gz2a_ gc..........................................................................................
d1h8ua_ r...........................................................................................
d1hyra_ esycgp......................................................................................
d1jzna_ nn..........................................................................................
d1kg0c_ htfqvpqnytkanctycntreyt.....................................................................
d1li1a2 amvmavhsqtiqippcpsgw........................................................................
d1o7bt_ gvyhrearsgk.................................................................................
d1p4ld_ rgvky.......................................................................................
d1prea1 epvypdqlrlfslgqgvcgdkyrpv...................................................................
d1prtc2 givippkalftqqggaygrcpngtraltvaelrgnaelqtylrqitpg............................................
d1qdda_ qeaqtelpqaris...............................................................................
d1qo3c_ stvldslqhtgrgdkvy...........................................................................
d1sl6a_ peksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrh...........................................
d1t61c1 llvkhsqtdqepmcpvgmnklwsgysllyfegqekahnqdlglagsclarfstmpflycnp...............................
d1t8ca1 sgfvcnt.....................................................................................
d1tdqb_ eqcee.......................................................................................
d1tn3a_ alqtvclkgtkv................................................................................
d1ukmb_ ............................................................................................
d1uuha_ aqidlnitcrfagvfhvekngrys....................................................................
d1wk1a_ gssgssgvkf..................................................................................
d1wmza_ nq..........................................................................................
d1ypqa1 csap........................................................................................
d1yu3a2 kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgsaaysdgawynfaevmthhgkrlpnynefqala
d1z70x1 lahskmvpipagvftmgtddpqikqdgeaparrvtidafymdayevsntefekfvnstgylteaekfgdsfvfegmlseqvktniqqavaaa
d2afpa_ qragpn......................................................................................
d2bphb1 qscl........................................................................................
d2c6ua_ sp..........................................................................................
d2kv3a1 sca.........................................................................................
d2msba_ kk..........................................................................................
d2nana_ md..........................................................................................
d2ox8d_ s...........................................................................................
d2yhfa_ m...........................................................................................
d2ziba1 alv.........................................................................................
d3altb_ lts.........................................................................................
d3bdwd_ arhcgh......................................................................................
d3cfwa1 ............................................................................................
d3ff7d_ ............................................................................................
d3l9jc_ lqtvclkgtkhm................................................................................
d3vppa_ sp..........................................................................................
d4cajb_ lcrl........................................................................................
d4dn8a1 pngrg.......................................................................................
d4kzvb1 ............................................................................................
d4qkha1 qaa.........................................................................................
d4uxma_ k...........................................................................................
d5aoha_ ilpidevnvdggdfyvglvfgkedyaahanthltpfsimrtevtyhqyqalqawaetrgyqisggcngatfedcwpsekdggrhpvtnvsww
d5f2qa_ n...........................................................................................
d5j2sa_ k...........................................................................................
d5thpk_ v...........................................................................................


                                                                                                  10
                                                                                                   |
d1b08a1 ...............................................................................--...--SVGEKI
d1b6ea_ ...............................................................................-Qek.WVGYRCNC
d1bnla_ .......................................................plkpgarifsfdgkdvlrhptwpq--...--------
d1byfa_ ...............................................................................--...-------E
d1cwva5 ...............................................................................--...--------
d1dv8a_ ...............................................................................CPvn.WVEHERSC
d1e87a_ ...............................................................................-Sed.WVGYQRKC
d1egia_ ...............................................................................--...----TSLC
d1f00i3 ...............................................................................--...--------
d1g1ta1 ...............................................................................--...-------S
d1gz2a_ ...............................................................................-Gpg.WVPTPGGC
d1h8ua_ ...............................................................................--...--------
d1hyra_ ...............................................................................CPkn.WICYKNNC
d1jzna_ ...............................................................................CPld.WLPMNGLC
d1kg0c_ ...............................................................................--...-FSYKGCC
d1li1a2 ...............................................................................--...--------
d1o7bt_ ...............................................................................--...--------
d1p4ld_ ...............................................................................--...WFCYSTKC
d1prea1 ...............................................................................--...--------
d1prtc2 ...............................................................................--...--------
d1qdda_ ...............................................................................CPeg.TNAYRSYC
d1qo3c_ ...............................................................................--...WFCYGMKC
d1sl6a_ ...............................................................................CPkd.WTFFQGNC
d1t61c1 ...............................................................................--...----GDVC
d1t8ca1 ...............................................................................CPek.WINFQRKC
d1tdqb_ ...............................................................................-G...WTKFQGHC
d1tn3a_ ...............................................................................--...----HMKC
d1ukmb_ ...............................................................................CPlg.WSSFDQHC
d1uuha_ ...............................................................................--...--------
d1wk1a_ ...............................................................................--...--------
d1wmza_ ...............................................................................CPtd.WEAEGDHC
d1ypqa1 ...............................................................................CPqd.WIWHGENC
d1yu3a2 fgtteatssggtdvpttgvngtgatsawniftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalf--...--------
d1z70x1 ................................................pwwlpvkganwrhpegpdstilhrpdhpvlh--...--------
d2afpa_ ...............................................................................CPag.WQPLGDRC
d2bphb1 ...............................................................................PN...WIMHGKSC
d2c6ua_ ...............................................................................CDtn.WRYYGDSC
d2kv3a1 ...............................................................................PG...WFYHKSNC
d2msba_ ...............................................................................--...-------F
d2nana_ ...............................................................................CPsstWIQFQDSC
d2ox8d_ ...............................................................................CPph.WKNFTDKC
d2yhfa_ ...............................................................................CPkd.WEFYQARC
d2ziba1 ...............................................................................CPag.WTLHGQRC
d3altb_ ...............................................................................CPpl.WTGFNGKC
d3bdwd_ ...............................................................................CPee.WITYSNSC
d3cfwa1 ...............................................................................--...------WT
d3ff7d_ ...............................................................................CPdr.WMKYGNHC
d3l9jc_ ...............................................................................--...------KC
d3vppa_ ...............................................................................CPnn.WIQNRESC
d4cajb_ ...............................................................................CPwd.WTFLLGNC
d4dn8a1 ...............................................................................--...---VGEKI
d4kzvb1 ...............................................................................CPlk.WFHFQSSC
d4qkha1 ...............................................................................CPes.WIGFQRKC
d4uxma_ ...............................................................................CPkg.WLDFRGNC
d5aoha_ ............davifanalsaqhnlqpyyvtadgqalkippeegtdrgirenpqasgyrlptlaewqvaarggnkgl--...--------
d5f2qa_ ...............................................................................CPqd.WLPMNGLC
d5j2sa_ ...............................................................................CPkd.WHSHQDKC
d5thpk_ ...............................................................................--...--------


                       20        30                            40        50                  60     
                        |         |                             |         |                   |     
d1b08a1 FKTA....GFV...KPFTEAQLLCTQA.......G...........GQLAS..PRSAAENAALQQLVVAKN..........EAAFLSMTDSK
d1b6ea_ YFIS....SEQ...KTWNESRHLCASQ.......K...........SSLLQ..LQNTDELDFMSSSQ----..........QFYWIGLSYSE
d1bnla_ ----....---...-------------.......-...........-----..------------------..........-----------
d1byfa_ ILFS....DET...MNYADAGTYCQSR.......G...........MALVSsaMRDSTMVKAILAFTEVKG..........HDYWVGADNLQ
d1cwva5 ----....-SL...VSSLEASRQCQGS.......D...........MSAVL..ESSRAT------------..........-----------
d1dv8a_ YWFS....RSG...KAWADADNYCRLE.......D...........AHLVV..VTSWEEQKFVQHHIGPV-..........-NTWMGLHDQN
d1e87a_ YFIS....TVK...RSWTSAQNACSEH.......G...........ATLAV..IDSEKDMNFLKRYAGRE-..........-EHWVGLKKEP
d1egia_ FKLYakgkHEK...KTWFESRDFCRAL.......G...........GDLAS..INNKEEQQTIWRLITASGsyh.......KLFWLGLTYGS
d1f00i3 ----....-KR...VTYNDAVNTCKNF.......G...........GKLPS..SQNELENVF---------..........-----------
d1g1ta1 YNTS....TEA...MTYDEASAYCQQR.......Y...........THLVA..IQNKEEIEYLNSILSYSP..........SYYWIGIRKVN
d1gz2a_ LGFF....SRE...LSWSRAESFCRRWgp.....G...........SHLAA..VRSAAELRLLAELLNASRggdgsgegadGRVWIGLHRPA
d1h8ua_ YLLV....RSL...QTFSQAWFTCRRCy......R...........GNLVS..IHNFNINYRIQCSVSALNq.........GQVWIGGRITG
d1hyra_ YQFF....DES...KNWYESQASCMSQ.......N...........ASLLK..VYSKEDQDLLKLVK----..........SYHWMGLVHIP
d1jzna_ YKIF....NQL...KTWEDAEMFCRKYkp.....G...........CHLAS..FHRYGESLEIAEYISDYHkgq.......ENVWIGLRDKK
d1kg0c_ FYFT....KKK...HTWNGCFQACAEKy......P...........CTYFY..GPTPDILPVVTRNLNAI-..........ESLWVGVYRVG
d1li1a2 ----....---...-------------.......-...........-----..------------------..........SSLWIGYSFVM
d1o7bt_ ----....-YK...LTYAEAKAVCEFE.......G...........GHLAT..YKQLEAARKI--------..........-----------
d1p4ld_ YYFI....MNK...TTWSGCKANCQHY.......G...........VPILK..IEDEDELKFLQRHVIPG-..........-NYWIGLSYDK
d1prea1 ----....---...-------------.......-...........-----..--NREEAQSVKSNIVGMM..........GQWQISGLA--
d1prtc2 ----....---...-------------.......-...........-----..------------------..........-W---------
d1qdda_ YYFN....EDR...ETWVDADLYCQNMn......S...........GNLVS..VLTQAEGAFVASLIKESGtdd.......FNVWIGLHDPK
d1qo3c_ YYFV....MDR...KTWSGCKQTCQSS.......S...........LSLLK..IDDEDELKFLQLVVPSD-..........-SCWVGLSYDN
d1sl6a_ YFMS....NSQ...RNWHDSVTACQEV.......R...........AQLVV..IKTAEEQNFLQLQTSRSN..........RFSWMGLSDLN
d1t61c1 YYAS....RND...-------------.......-...........-----..------------------..........-----------
d1t8ca1 YYFG....KGT...KQWVHARYACDDM.......E...........GQLVS..IHSPEEQDFLTKHASHT-..........-GSWIGLRNLD
d1tdqb_ YRHF....PDR...ETWVDAERRCREQ.......Q...........SHLSS..IVTPEEQEFVNKNAQDY-..........--QWIGLNDRT
d1tn3a_ FLAF....TQT...KTFHEASEDCISR.......G...........GTLST..PQTGSENDALYEYLRQSVgne.......AEIWLGLNDMA
d1ukmb_ YKVF....EPV...KNWTEAEEICMQQhk.....G...........SRLAS..IHSSEEEAFVSKLASKALkf........TSMWIGLNNPW
d1uuha_ ----....---...ISRTEAADLCKAF.......N...........STLPT..MAQMEKALSIGFE-----..........-----------
d1wk1a_ LTVN....DDI...LSMPQARNFCASA.......G...........GYLAD..DLGDDKNNFYSSIAANT-..........-QFWIGLFK-N
d1wmza_ YRFF....NTL...TTWENAHHECVSYscstlnvR...........SDLVS..VHSAAEQAYVFNYWRGIDsqa.......GQLWIGLYDKY
d1ypqa1 YLFS....SGS...FNWEKSQEKCLSL.......D...........AKLLK..INSTADLDFIQQAISYSS..........FPFWMGLSRRN
d1yu3a2 ----....---...-------------.......-...........-----..------------------..........-----------
d1z70x1 ----....---...VSWNDAVAYCTWA.......G...........KRLPT..------------------..........-----------
d2afpa_ IYYE....TTA...MTWALAETNCMKL.......G...........GHLAS..IHSQEEHSFIQTLNAGV-..........--VWIGGSACL
d2bphb1 YLFS....FSG...NSWYGSKRHCSQL.......G...........AHLLK..IDNSKEFEFIESQTSSHRi.........NAFWIGLSRNQ
d2c6ua_ YGFF....RHN...LTWEESKQYCTDM.......N...........ATLLK..IDNRNIVEYIKARTHLI-..........--RWVGLSRQK
d2kv3a1 YGYF....RKL...RNWSDAELECQSYgn.....G...........AHLAS..ILSLKEASTIAEYISGYQrs........QSIWIGLHDPQ
d2msba_ FVTN....HER...MPFSKVKALCSEL.......R...........GTVAI..PRNAEENKAIQEVAKTS-..........--AFLGITDEV
d2nana_ YIFL....QEAikvESIEDVRNQCTDH.......G...........ADMIS..IHNEEENAFILDTLKKQWkgp.......DDILLGMFYDT
d2ox8d_ YYFS....VEK...EIFEDAKLFCEDK.......S...........SHLVF..INTREEQQWIKKQMVGR-..........ESHWIGLTDSE
d2yhfa_ FFLS....TSE...SSWNESRDFCKGK.......G...........STLAI..VNTPEKLKFLQDITDAE-..........-KYFIGLIYHR
d2ziba1 FYSE....ATA...MTWDLAEANCVNK.......G...........GHLAS..IHSLEEQLYIKDIVAGI-..........--VWIGGSACK
d3altb_ FRLF....HNH...LNFDNAENACRQF.......GlascsgdelatGHLAS..IHSAESQAFLTELVKTSLpdlitggwa.PQVYIGMKVGS
d3bdwd_ YYIG....KER...RTWEESLLACTSK.......N...........SSLLS..IDNEEEMKFLSIISPSS-..........---WIGVFRNS
d3cfwa1 YHYS....EKP...MNWQRARRFCRDN.......Y...........TDLVA..IQNKAEIEYLEKTLPFSR..........SYYWIGIRKIG
d3ff7d_ YYFS....VEE...KDWNSSLEFCLAR.......D...........SHLLV..ITDNQEMSLLQVFLSEA-..........-FSWIGLRN--
d3l9jc_ FLAF....TQT...KTFHEASEDCISR.......G...........GTLST..PQTGSENDALYEYLRQSVgne.......AEIWLGLNKRW
d3vppa_ YYVS....EIW...SIWHTSQENCLKE.......G...........STLLQ..IESKEEMDFITGSLRKIKgs........YDYWVGLSQDG
d4cajb_ YFFS....KSQ...RNWNDAVTACKEV.......K...........AQLVI..INSDEEQTFLQQTSKAK-..........GPTWMGLSDLK
d4dn8a1 FKTG....GFE...KTFQDAQQVCTQA.......G...........GQMAS..PRSETENEALSQLVTAQN..........KAAFLSMTDIK
d4kzvb1 YLFS....PDT...MSWRASLKNCSSM.......G...........AHLVV..INTQEEQEFLYYTKPRK-..........KEFYIGLTDQV
d4qkha1 FYFS....DDT...KNWTSSQRFCDSQ.......D...........ADLAQ..VESFQELNFLLRYKGPS-..........-DHWIGLSREQ
d4uxma_ YGYF....RYE...LPWKRAEAWCRSIra.....G...........AHLAS..IHTSEEHRAIAKFISQYHhgeee.....EDVWIGLFRWN
d5aoha_ ----....---...-------------.......-...........-----..------------------..........-------S---
d5f2qa_ YKIF....NEL...KAWKDAEMFCRKYkp.....G...........CHLAS..IHLYGESPEIAEYISDYHkgq.......SEVWIGLCDKK
d5j2sa_ FHVS....QTS...ITWKGSLADCGGK.......G...........ATLLL..VQDQEELRFLRNLTKRIS..........SSFWIGLSYTL
d5thpk_ ---F....SEL...KTWEDAESFCYAQhk.....G...........SRLAS..IHSREEEAFVGKLASQTLky........TSMWLGLNNPW


             70                 80           90            100              110         120         
              |                  |            |              |                |           |         
d1b08a1 TE..GKFTYP..TGESL.......VYSNWAPG...EPND.....DGGSEDCVEIFT..N.....GKWNDRACGEKR..LVVCEF........
d1b6ea_ EH..TAWLWE..NGSAL.......SQYLFPSF...ET--.....-FNTKNCIAYNP..N.....GNALDESCEDKN..RYICK-qqli....
d1bnla_ --..------..-----.......-KSVWHGS...DPNG.....------------..-.....------------..------rrltesyc
d1byfa_ DGa.YNFLWN..DGVSLpt.....DSDLWSPN...EPSN.....PQSWQLCVQIWS..Ky....NLLDDVGCGGAR..RVICEKeld.....
d1cwva5 --..------..-----.......--------...----.....------------..-.....------------..------ngtrapdg
d1dv8a_ --..GPWKWV..DGTDYet.....GFKNWRPE...QPDDwyghgLGGGEDCAHFTD..D.....GRWNDDVCQRPY..RWVCE-tel.....
d1e87a_ G-..HPWKWS..NGKEF.......--NNWFNV...----.....-TGSDKCVFLK-..N.....TEVSSMECEKNL..YWICN-kpyk....
d1egia_ PS..EGFTWS..DGSPV.......SYENWAYG...EPNN.....YQNVEYCGELKG..Dpt...MSWNDINCEHLN..NWICQ-iq......
d1f00i3 --..------..-----.......--------...----.....------------..-.....------------..------kawgaank
d1g1ta1 --..NVWVWVg.TQKPLte.....EAKNWAPG...EPNN.....RQKDEDCVEIYI..KrekdvGMWNDERCSKKK..LALCY-........
d1gz2a_ GS..RSWRWS..DGTAP.......RFASWHRT...AKA-.....-RRGGRCAALRD..Eeaf..TSWAARPCTERN..AFVCK-aaa.....
d1h8ua_ SGrcRRFQWV..DGSRW.......NFAYWAAH...QPW-.....-SRGGHCVALCTr.G.....GYWRRAHCLRRL..PFICS-y.......
d1hyra_ TN..GSWQWE..DGSIL.......SPNLLTI-...---I.....EMQKGDCALYAS..S.....FKGYIENCSTPN..TYIC--mqrtv...
d1jzna_ KD..FSWEWT..DRSCT.......DYLTWDKN...QPDH.....YQNKEFCVELVSl.Tgy...RLWNDQVCESKD..AFLCQ-ckf.....
d1kg0c_ E-..GNWTSL..DGGTFk......VYQIFGS-...----.....-----HCTYVSKfsT.....VPVSHHECSFLK..PCLC--vsqrs...
d1li1a2 HT..------..-----.......--------...----.....------------..-.....------------..------sagaegsg
d1o7bt_ --..------..-----.......--------...----.....------------..-.....------------..------gfhvcaag
d1p4ld_ KK..KEWAWI..DNGPS.......KLDMKIKK...---M.....NFKSRGCVFLS-..K.....ARIEDIDCNIPY..YCICG-kkldk...
d1prea1 --..------..-----.......--------...----.....------------..-.....------------..------ngwvimgp
d1prtc2 --..------..-----.......--------...----.....------------..-.....------------..------siyglydg
d1qdda_ KN..RAWHWS..SGSLV.......SYKSWGIG...APSS.....-VNPGYCVSLTS..Stgf..QKWKDVPCEDKF..SFVCKFkn......
d1qo3c_ KK..KDWAWI..DNRPSk......LALNTRK-...---Y.....NIRDGGCMLLS-..K.....TRLDNGNCDQVF..ICICG-krld....
d1sl6a_ QE..GTWQWV..DGSPLsps....FQRYWNSG...EPNN.....-SGNEDCAEFSG..S.....G-WNDNRCDVDN..YWICKKpaacfr..
d1t61c1 --..------..-----.......--------...----.....------------..-.....------------..------ksywlstt
d1t8ca1 LK..GEFIWV..DGSHV.......DYSNWAPG...EPTS.....RSQGEDCVMMRG..S.....GRWNDAFCDRKLg.AWVCD-rlatctpp
d1tdqb_ IE..GDFRWS..DGHSL.......QFEKWRPN...QPDNf....FATGEDCVVMIW..Her...GEWNDVPCNYQL..PFTCKKg.......
d1tn3a_ AE..GTWVDM..TGARI.......AYKNWETEitaQPDG.....-GKTENCAVLSGaaN.....GKWFDKRCRDQL..PYICQ-fgiv....
d1ukmb_ KD..CKWEWS..DNARF.......DYKAWKR-...----.....---RPYCTVMVV..Kpdr..IFWFTRGCEKSV..SFVCKFlt......
d1uuha_ --..------..-----.......--------...----.....------------..-.....------------..------tcrygfie
d1wk1a_ SD..GQFYWD..RGQGInpdllnqPITYWANG...EPSN.....-DPTRQCVYFDG..RsgdksKVWTTDTCATPR..PFICQKhrydsdhk
d1wmza_ NE..GDFIWT..DGSKV.......GYTKWAGG...QPDN.....WNNAEDYGQFRH..Teg...GAWNDNSAAAQA..KYMCK-ltfe....
d1ypqa1 PS..YPWLWE..DGSPLm......PHLFRVRG...AVSQ.....TYPSGTCAYIQ-..R.....GAVYAENCILAA..FSICQKkanl....
d1yu3a2 -G..GSWFYT..SYSGS.......RAAYWNAG...----.....------------..-.....------------..------psnssani
d1z70x1 --..------..-----.......--------...----.....------------..-.....------------..------eaeweysc
d2afpa_ QA..GAWTWS..DGTPM.......NFRSWCST...KPDD.....-VLAACCMQMTAaaD.....QCWDDLPCPASH..KSVC--amtf....
d2bphb1 SE..GPWFWE..DGSAFfp.....NSFQVRNA...VPQE.....-SLLHNCVWIH-..G.....SEVYNQICNTSS..YSICEKel......
d2c6ua_ SN..EVWKWE..DGSVI.......SENMFEFL...EDG-.....-KGNMNCAYFH-..N.....GKMHPTFCENKH..YLMCE-rkag....
d2kv3a1 KR..QQWQWI..DGAMY.......LYRSWSGK...---S.....MGGNKHCAEMSS..Nnnf..LTWSSNECNKRQ..HFLCK-yrp.....
d2msba_ TE..GQFMYV..TGGRL.......TYSNWKKD...EPND.....HGSGEDCVTIVD..N.....GLWNDISCQASH..TAVCEFp.......
d2nana_ DD..ASFKWF..DNSNM.......TFDKWTDQ...DDDE.....-DLVDTCAFLHIk.T.....GEWKKGNCEVSSveGTLCK-taipykr.
d2ox8d_ RE..NEWKWL..DGTSP.......DYKNWKAG...QPDNwghg.HGPGEDCAGLIY..A.....GQWNDFQCEDVN..NFICEKdr......
d2yhfa_ EE..KRWRWI..NNSVF.......NGNVTNQ-...----.....-NQNFNCATIGL..T.....KTFDAASCDISY..RRICEKna......
d2ziba1 VA..GAWSWT..DGTPV.......DYRTWCPT...KPND.....-ILSDCCMQMTAavD.....KCWDDLPCPASH..ASIC--akaai...
d3altb_ TN..SDQTWT..DGSSV.......DYDGWVSG...EPNNg....PNSRGAIAAGDY..Sr....GFWADVYSNNNF..KYICQ-lpcvhytl
d3bdwd_ SH..HPWVTM..NGLAF.......KHEIKDSD...----.....-NAELNCAVLQV..N.....R-LKSAQCGSSI..IYHCK-hk......
d3cfwa1 --..GIWTWVgtNKSLTe......EAENWGDG...EPNN.....KKNKEDCVEIYI..KrnkdaGKWNDDACHKLK..AALCY-........
d3ff7d_ -N..SGWRWE..DGSPL.......NFSRISSN...----.....-SFVQTCGAINK..N.....G-LQASSCEVPL..HWVCKK........
d3l9jc_ SR..YFWVDM..TGTRI.......AYKNWEHSsdaQPDP.....-SNWENCAVLSGaaN.....GKWFGKRCRDQL..PYICQ-fgi.....
d3vppa_ HS..GRWLWQ..DGSSP.......SPGLLPAE...RS--.....QSANQVCGYVK-..S.....NSLLSSNCDTWK..YFICEKyal.....
d4cajb_ KE..ATWLWV..DGSTLssr....FQKYWNRG...EPNN.....-IGEEDCVEFAG..D.....G-WNDSKCELKK..FWICKKsatpct..
d4dn8a1 TE..GQFTYP..TGEPL.......VYANWAPG...EPNNngg..SSGAENCVEIFP..N.....GKWNDKACGELR..LVICEF........
d4kzvb1 TE..GQWQWV..DGTPFtk.....SLSFWDAG...EPNN.....LVTVEDCATIRD..Ssnpr.QNWNDVPCFFNM..FRVCE-mper....
d4qkha1 G-..QPWKWI..NGTEW.......TRQFPILG...----.....---AGECAYLN-..D.....KGASSARCYTER..KWICS-ksdihv..
d4uxma_ --..SVWAWI..DGSKK.......HYSALDDD...---D.....YPKGKHCAVLDE..Ssgf..LSWDNDSCGERN..AFICK-cta.....
d5aoha_ --..------..-----.......--------...----.....------------..-.....------------..------dgtygsry
d5f2qa_ KD..FSWEWT..DRSCT.......DYLSWDKN...QPDH.....YQNKEFCVELVS..Ntgy..RLWNDQVCESKN..AFLCQ-ckf.....
d5j2sa_ SD..EKWKWI..NGSTLns.....DALNITGD...----.....-TEKDSCASVS-..Q.....DKVLSESCDSDN..IWICQ-xel.....
d5thpk_ KE..CKWEWS..DDAKL.......DYKVWLR-...----.....---RPYCAVMVV..Ktdr..IFWFNRGCEKTV..SFVCKF........


                                                                                                    
                                                                                                    
d1b08a1 ............................................................................................
d1b6ea_ ............................................................................................
d1bnla_ etwrteapsatgqassllggrllgqsaaschhayivlciensf.................................................
d1byfa_ ............................................................................................
d1cwva5 tlwgewgsltayssdwqsgeywvkktstdfetmnmdtgalqpgpaylafplcalsi....................................
d1dv8a_ ............................................................................................
d1e87a_ ............................................................................................
d1egia_ ............................................................................................
d1f00i3 yeyykssqtiiswvqqtaqdaksgvastydlvkqnplnnikasesnayatcvk.......................................
d1g1ta1 ............................................................................................
d1gz2a_ ............................................................................................
d1h8ua_ ............................................................................................
d1hyra_ ............................................................................................
d1jzna_ ............................................................................................
d1kg0c_ ............................................................................................
d1li1a2 qalaspgscleefrsapfiechgrgtcnyyanaysfwlatiersemfkkptpstlkagelrthvsrcqvcmrrt..................
d1o7bt_ wmakgrvgypivkpgpncgfgktgiidygirlnrserwdaycynphak............................................
d1p4ld_ ............................................................................................
d1prea1 gyngeikpgtasntwcyptnpvtge...................................................................
d1prtc2 tylgqayggiikdappgagfiyretfcit...............................................................
d1qdda_ ............................................................................................
d1qo3c_ ............................................................................................
d1sl6a_ ............................................................................................
d1t61c1 aplpmmpvaeedirpyisrcsvceapava...............................................................
d1t8ca1 asegsae.....................................................................................
d1tdqb_ ............................................................................................
d1tn3a_ ............................................................................................
d1ukmb_ ............................................................................................
d1uuha_ ghvviprihpnsicaanntgvyiltsntsqydtycfnasappeedctsvtdlpnafdgpititivnrdgtryvqkgeyrtnpediy......
d1wk1a_ pntigdasgpssg...............................................................................
d1wmza_ ............................................................................................
d1ypqa1 ............................................................................................
d1yu3a2 gargvcdhlil.................................................................................
d1z70x1 rgglhnrlfpwgnklqpkgqhyaniwqgefpvtntgedgfqgtapvdafppngyglynivgnawewtsdwwtvhhsveetlnpkgppsgkdr
d2afpa_ ............................................................................................
d2bphb1 ............................................................................................
d2c6ua_ ............................................................................................
d2kv3a1 ............................................................................................
d2msba_ ............................................................................................
d2nana_ ............................................................................................
d2ox8d_ ............................................................................................
d2yhfa_ ............................................................................................
d2ziba1 ............................................................................................
d3altb_ e...........................................................................................
d3bdwd_ ............................................................................................
d3cfwa1 ............................................................................................
d3ff7d_ ............................................................................................
d3l9jc_ ............................................................................................
d3vppa_ ............................................................................................
d4cajb_ ............................................................................................
d4dn8a1 ............................................................................................
d4kzvb1 ............................................................................................
d4qkha1 ............................................................................................
d4uxma_ ............................................................................................
d5aoha_ agkdqpasvanlpvsgtqtfstlpvaskqpnslglydmsgnvsewlnenyavkggkkmyyfcggsymdrvgslascdvhtpgfamsdigfrl
d5f2qa_ ............................................................................................
d5j2sa_ ............................................................................................
d5thpk_ ............................................................................................


                                                    
                                                    
d1b08a1 ............................................
d1b6ea_ ............................................
d1bnla_ ............................................
d1byfa_ ............................................
d1cwva5 ............................................
d1dv8a_ ............................................
d1e87a_ ............................................
d1egia_ ............................................
d1f00i3 ............................................
d1g1ta1 ............................................
d1gz2a_ ............................................
d1h8ua_ ............................................
d1hyra_ ............................................
d1jzna_ ............................................
d1kg0c_ ............................................
d1li1a2 ............................................
d1o7bt_ ............................................
d1p4ld_ ............................................
d1prea1 ............................................
d1prtc2 ............................................
d1qdda_ ............................................
d1qo3c_ ............................................
d1sl6a_ ............................................
d1t61c1 ............................................
d1t8ca1 ............................................
d1tdqb_ ............................................
d1tn3a_ ............................................
d1ukmb_ ............................................
d1uuha_ ............................................
d1wk1a_ ............................................
d1wmza_ ............................................
d1ypqa1 ............................................
d1yu3a2 ............................................
d1z70x1 vkkggsymchrsycyryrcaarsqntpdssasnlgfrcaadrlp
d2afpa_ ............................................
d2bphb1 ............................................
d2c6ua_ ............................................
d2kv3a1 ............................................
d2msba_ ............................................
d2nana_ ............................................
d2ox8d_ ............................................
d2yhfa_ ............................................
d2ziba1 ............................................
d3altb_ ............................................
d3bdwd_ ............................................
d3cfwa1 ............................................
d3ff7d_ ............................................
d3l9jc_ ............................................
d3vppa_ ............................................
d4cajb_ ............................................
d4dn8a1 ............................................
d4kzvb1 ............................................
d4qkha1 ............................................
d4uxma_ ............................................
d5aoha_ vrpid.......................................
d5f2qa_ ............................................
d5j2sa_ ............................................
d5thpk_ ............................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0035288 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Caenorhabditis elegans 57 (pseudogenes) - Roundworm
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Hansenula polymorpha v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Micromonas sp. RCC299
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Cryptosporidium muris
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Conexibacter woesei DSM 14684
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Modestobacter marinus
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium efficiens YS-314
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Microbacterium testaceum StLB037
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter arilaitensis Re117
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Micrococcus luteus NCTC 2665
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Deinococcus deserti VCD115
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ruminococcus sp.
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium cellulovorans 743B
NoYes   Acetohalobium arabaticum DSM 5501
NoYes   Lactobacillus casei ATCC 334
NoYes   Streptococcus pneumoniae P1031
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Pedobacter heparinus DSM 2366
NoYes   Sphingobacterium sp. 21
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Waddlia chondrophila WSU 86-1044
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Parachlamydia acanthamoebae UV-7
NoYes   Simkania negevensis Z
NoYes   Chlamydophila pecorum E58
NoYes   Chlamydia muridarum Nigg
NoYes   Chlamydophila pneumoniae TW-183
NoYes   Chlamydophila caviae GPIC
NoYes   Chlamydophila felis Fe/C-56
NoYes   Chlamydophila abortus S26/3
NoYes   Chlamydia psittaci 01DC11
NoYes   Chlamydia trachomatis B/Jali20/OT
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. L550
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Brachyspira murdochii DSM 12563
NoYes   Borrelia garinii PBi
NoYes   Borrelia bissettii DN127
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi B31
NoYes   Borrelia recurrentis A1
NoYes   Borrelia duttonii Ly
NoYes   Borrelia crocidurae str. Achema
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Terriglobus saanensis SP1PR4
NoYes   Terriglobus roseus DSM 18391
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Neisseria meningitidis alpha14
NoYes   Neisseria meningitidis FAM18
NoYes   Neisseria lactamica 020-06
NoYes   Neisseria gonorrhoeae NCCP11945
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Alicycliphilus denitrificans K601
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Taylorella asinigenitalis MCE3
NoYes   Taylorella equigenitalis MCE9
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter sphaeroides ATCC 17029
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Acidiphilium multivorum AIU301
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   Candidatus Pelagibacter sp. IMCC9063
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Ochrobactrum anthropi ATCC 49188
NoYes   Brucella microti CCM 4915
NoYes   Brucella pinnipedialis B2/94
NoYes   Brucella canis ATCC 23365
NoYes   Brucella suis ATCC 23445
NoYes   Brucella melitensis ATCC 23457
NoYes   Brucella ovis ATCC 25840
NoYes   Brucella abortus S19
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium tumefaciens str. C58
NoYes   Agrobacterium radiobacter K84
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Hyphomicrobium denitrificans ATCC 51888
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Bartonella tribocorum CIP 105476
NoYes   Bartonella grahamii as4aup
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Pasteurella multocida subsp. multocida str. 3480
NoYes   Haemophilus parainfluenzae T3T1
NoYes   Oceanimonas sp. GK1
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Rhodanobacter denitrificans
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Halothiobacillus neapolitanus c2
NoYes   Spiribacter sp. UAH-SP71
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus watsonii C-113
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   Legionella longbeachae NSW150
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. ATCC 39006
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Enterobacter sp. 638
NoYes   Citrobacter rodentium ICC168
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Moraxella catarrhalis RH4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Acinetobacter sp. ADP1
NoYes   Methylophaga sp. JAM1
NoYes   Cycloclasticus sp. P1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Thioalkalimicrobium cyclicum ALM1
NoYes   Cenarchaeum symbiosum A
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Haloquadratum walsbyi DSM 16790
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Cyanobium gracile PCC 6307
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Synechococcus sp. CC9902
NoYes   Synechococcus sp. RCC307
NoYes   Synechococcus sp. CC9605
NoYes   Synechococcus sp. WH 8102
NoYes   Synechococcus sp. WH 7803
NoYes   Synechococcus sp. PCC 7002
NoYes   Prochlorococcus marinus str. MIT 9313
NoYes   Prochlorococcus marinus str. MIT 9303
NoYes   Prochlorococcus marinus str. NATL2A
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Spiroplasma taiwanense CT-1
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium avium subsp. paratuberculosis MAP4
NoYes   Mycobacterium avium subsp. paratuberculosis K-10
NoYes   Mycobacterium canettii CIPT 140070017
NoYes   Mycobacterium canettii CIPT 140060008
NoYes   Mycobacterium canettii CIPT 140070008
NoYes   Mycobacterium canettii CIPT 140070010
NoYes   Mycobacterium tuberculosis EAI5/NITR206
NoYes   Mycobacterium tuberculosis EAI5
NoYes   Mycobacterium tuberculosis CAS/NITR204
NoYes   Mycobacterium tuberculosis str. Beijing/NITR203
NoYes   Mycobacterium tuberculosis UT205
NoYes   Mycobacterium tuberculosis RGTB423
NoYes   Mycobacterium tuberculosis RGTB327
NoYes   Mycobacterium tuberculosis CTRI-2
NoYes   Mycobacterium tuberculosis str. Erdman = ATCC 35801
NoYes   Mycobacterium tuberculosis KZN 605
NoYes   Mycobacterium tuberculosis KZN 4207
NoYes   Mycobacterium tuberculosis CCDC5180
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis CCDC5079
NoYes   Mycobacterium tuberculosis H37Ra
NoYes   Mycobacterium tuberculosis str. Haarlem/NITR202
NoYes   Mycobacterium tuberculosis str. Haarlem
NoYes   Mycobacterium tuberculosis F11
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Mycobacterium tuberculosis CDC1551
NoYes   Mycobacterium bovis AF2122/97
NoYes   Mycobacterium bovis BCG str. Korea 1168P
NoYes   Mycobacterium bovis BCG str. Mexico
NoYes   Mycobacterium bovis BCG str. Tokyo 172
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Mycobacterium smegmatis JS623
NoYes   Corynebacterium halotolerans YIM 70093 = DSM 44683
NoYes   Chthonomonas calidirosea T49
NoYes   Clostridium thermocellum DSM 1313
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Clostridium difficile BI1
NoYes   Clostridium saccharolyticum Clostridium cf. saccharolyticum K10
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Enterococcus casseliflavus EC20
NoYes   Lactobacillus paracasei subsp. paracasei 8700:2
NoYes   Lactobacillus casei LOCK919
NoYes   Lactobacillus casei W56
NoYes   Lactobacillus casei LC2W
NoYes   Lactobacillus casei BD-II
NoYes   Lactobacillus casei BL23
NoYes   Lactobacillus casei str. Zhang
NoYes   Streptococcus pneumoniae SPNA45
NoYes   Streptococcus pneumoniae SPN994039
NoYes   Streptococcus pneumoniae SPN994038
NoYes   Streptococcus pneumoniae SPN034183
NoYes   Streptococcus pneumoniae INV104
NoYes   Streptococcus pneumoniae INV200
NoYes   Streptococcus pneumoniae OXC141
NoYes   Streptococcus pneumoniae gamPNI0373
NoYes   Streptococcus pneumoniae AP200
NoYes   Streptococcus pneumoniae ATCC 700669
NoYes   Streptococcus pneumoniae CGSP14
NoYes   Streptococcus pneumoniae G54
NoYes   Streptococcus pneumoniae JJA
NoYes   Streptococcus pneumoniae 70585
NoYes   Streptococcus pneumoniae Hungary19A-6
NoYes   Exiguobacterium antarcticum B7
NoYes   Thermobacillus composti KWC4
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Paenibacillus polymyxa E681
NoYes   Bacillus subtilis PY79
NoYes   Bacillus subtilis QB928
NoYes   Bacillus subtilis BSn5
NoYes   Bacillus subtilis subsp. subtilis str. BSP1
NoYes   Bacillus subtilis subsp. subtilis 6051-HGW
NoYes   Bacillus subtilis subsp. spizizenii TU-B-10
NoYes   Bacillus cereus subsp. cytotoxis NVH 391-98
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar kurstaki str. HD73
NoYes   Bacillus thuringiensis BMB171
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus FRI-35
NoYes   Bacillus cereus AH820
NoYes   Bacillus cereus AH187
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus Q1
NoYes   Bacillus cereus NC7401
NoYes   Bacillus cereus ATCC 14579
NoYes   Bacillus cereus ATCC 10987
NoYes   Chlorobium phaeobacteroides BS1
NoYes   Salinibacter ruber DSM 13855
NoYes   Rhodothermus marinus SG0.5JP17-172
NoYes   Echinicola vietnamensis DSM 17526
NoYes   Emticicia oligotrophica DSM 17448
NoYes   Prevotella sp. oral taxon 299 str. F0039
NoYes   Prevotella dentalis DSM 3688
NoYes   Porphyromonas gingivalis TDC60
NoYes   Porphyromonas gingivalis W83
NoYes   Alistipes shahii WAL 8301
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Riemerella anatipestifer RA-CH-2
NoYes   Riemerella anatipestifer RA-CH-1
NoYes   Riemerella anatipestifer RA-GD
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Chlamydia pecorum P787
NoYes   Chlamydia pecorum W73
NoYes   Chlamydia pecorum PV3056/3
NoYes   Chlamydophila pneumoniae LPCoLN
NoYes   Chlamydophila pneumoniae J138
NoYes   Chlamydophila pneumoniae CWL029
NoYes   Chlamydophila pneumoniae AR39
NoYes   Chlamydia psittaci 01DC12
NoYes   Chlamydia psittaci WC
NoYes   Chlamydia psittaci M56
NoYes   Chlamydia psittaci WS/RT/E30
NoYes   Chlamydia psittaci VS225
NoYes   Chlamydia psittaci MN
NoYes   Chlamydia psittaci GR9
NoYes   Chlamydia psittaci 84/55
NoYes   Chlamydia psittaci 08DC60
NoYes   Chlamydia psittaci 02DC15
NoYes   Chlamydia psittaci C19/98
NoYes   Chlamydia psittaci NJ1
NoYes   Chlamydia psittaci CP3
NoYes   Chlamydophila psittaci RD1
NoYes   Chlamydia psittaci Mat116
NoYes   Chlamydophila psittaci 6BC
NoYes   Chlamydophila psittaci 6BC
NoYes   Chlamydia trachomatis C/TW-3
NoYes   Chlamydia trachomatis L2/434/Bu(f)
NoYes   Chlamydia trachomatis L2/434/Bu(i)
NoYes   Chlamydia trachomatis IU888
NoYes   Chlamydia trachomatis IU824
NoYes   Chlamydia trachomatis L2b/Canada2
NoYes   Chlamydia trachomatis L2b/Canada1
NoYes   Chlamydia trachomatis L3/404/LN
NoYes   Chlamydia trachomatis L2b/Ams5
NoYes   Chlamydia trachomatis L2b/Ams4
NoYes   Chlamydia trachomatis L2b/Ams3
NoYes   Chlamydia trachomatis L2b/Ams2
NoYes   Chlamydia trachomatis L2b/Ams1
NoYes   Chlamydia trachomatis L2b/795
NoYes   Chlamydia trachomatis L2b/CV204
NoYes   Chlamydia trachomatis L2b/LST
NoYes   Chlamydia trachomatis L2b/UCH-2
NoYes   Chlamydia trachomatis L2b/8200/07
NoYes   Chlamydia trachomatis L2/25667R
NoYes   Chlamydia trachomatis L1/224
NoYes   Chlamydia trachomatis L1/115
NoYes   Chlamydia trachomatis L1/440/LN
NoYes   Chlamydia trachomatis K/SotonK1
NoYes   Chlamydia trachomatis Ia/SotonIa3
NoYes   Chlamydia trachomatis Ia/SotonIa1
NoYes   Chlamydia trachomatis G/SotonG1
NoYes   Chlamydia trachomatis F/SotonF3
NoYes   Chlamydia trachomatis F/SW5
NoYes   Chlamydia trachomatis F/SW4
NoYes   Chlamydia trachomatis E/SotonE8
NoYes   Chlamydia trachomatis E/SotonE4
NoYes   Chlamydia trachomatis E/SW3
NoYes   Chlamydia trachomatis D/SotonD6
NoYes   Chlamydia trachomatis D/SotonD5
NoYes   Chlamydia trachomatis D/SotonD1
NoYes   Chlamydia trachomatis A/5291
NoYes   Chlamydia trachomatis A/363
NoYes   Chlamydia trachomatis RC-J/971
NoYes   Chlamydia trachomatis RC-L2/55
NoYes   Chlamydia trachomatis J/6276tet1
NoYes   Chlamydia trachomatis RC-J/966
NoYes   Chlamydia trachomatis RC-J(s)/122
NoYes   Chlamydia trachomatis RC-F(s)/342
NoYes   Chlamydia trachomatis RC-L2(s)/3
NoYes   Chlamydia trachomatis RC-J/953
NoYes   Chlamydia trachomatis RC-J943
NoYes   Chlamydia trachomatis RC-Fs852
NoYes   Chlamydia trachomatis RC-L2s46
NoYes   Chlamydia trachomatis RC-F69
NoYes   Chlamydia trachomatis L2c
NoYes   Chlamydia trachomatis D-LC
NoYes   Chlamydia trachomatis D-EC
NoYes   Chlamydia trachomatis G/9301
NoYes   Chlamydia trachomatis G/11074
NoYes   Chlamydia trachomatis G/11222
NoYes   Chlamydia trachomatis G/9768
NoYes   Chlamydia trachomatis E/150
NoYes   Chlamydia trachomatis E/11023
NoYes   Chlamydia trachomatis B/TZ1A828/OT
NoYes   Chlamydia trachomatis Sweden2
NoYes   Chlamydia trachomatis E/Bour
NoYes   Chlamydia trachomatis A2497
NoYes   Chlamydia trachomatis A2497
NoYes   Chlamydia trachomatis L2b/UCH-1/proctitis
NoYes   Chlamydia trachomatis 434/Bu
NoYes   Chlamydia trachomatis A/HAR-13
NoYes   Chlamydia trachomatis D/UW-3/CX
NoYes   Singulisphaera acidiphila DSM 18658
NoYes   Leptospira borgpetersenii serovar Hardjo-bovis str. JB197
NoYes   Leptospira interrogans serovar Lai str. 56601
NoYes   Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Ames)'
NoYes   Borrelia garinii NMJW1
NoYes   Borrelia garinii BgVir
NoYes   Borrelia afzelii HLJ01
NoYes   Borrelia afzelii PKo
NoYes   Borrelia burgdorferi CA382
NoYes   Borrelia burgdorferi JD1
NoYes   Borrelia burgdorferi N40
NoYes   Borrelia burgdorferi ZS7
NoYes   Borrelia miyamotoi LB-2001
NoYes   Treponema pedis str. T A4
NoYes   Spirochaeta thermophila DSM 6578
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Fusobacterium nucleatum subsp. animalis 4_8
NoYes   Acidithiobacillus ferrooxidans ATCC 23270
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Arcobacter butzleri 7h1h
NoYes   Arcobacter butzleri ED-1
NoYes   Desulfobacula toluolica Tol2
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Geobacter sp. M18
NoYes   Geobacter sulfurreducens PCA
NoYes   Sorangium cellulosum So0157-2
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Neisseria meningitidis WUE 2594
NoYes   Neisseria meningitidis G2136
NoYes   Neisseria meningitidis M04-240196
NoYes   Neisseria meningitidis M01-240149
NoYes   Neisseria meningitidis NZ-05/33
NoYes   Neisseria meningitidis M01-240355
NoYes   Neisseria meningitidis 8013
NoYes   Neisseria meningitidis Z2491
NoYes   Neisseria meningitidis H44/76
NoYes   Neisseria meningitidis alpha710
NoYes   Neisseria meningitidis MC58
NoYes   Neisseria gonorrhoeae TCDC-NG08107
NoYes   Neisseria gonorrhoeae FA 1090
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Ralstonia pickettii 12J
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum PSI07
NoYes   Ralstonia solanacearum CMR15
NoYes   Ralstonia solanacearum GMI1000
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia mallei NCTC 10229
NoYes   Burkholderia mallei NCTC 10247
NoYes   Burkholderia mallei ATCC 23344
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Candidatus Symbiobacter mobilis Comamonadaceae bacterium CR
NoYes   Alicycliphilus denitrificans BC
NoYes   Variovorax paradoxus B4
NoYes   Variovorax paradoxus EPS
NoYes   Taylorella asinigenitalis 14/45
NoYes   Taylorella equigenitalis 14/56
NoYes   Taylorella equigenitalis ATCC 35865
NoYes   Bordetella pertussis CS
NoYes   Bordetella parapertussis 18323
NoYes   Bordetella parapertussis Bpp5
NoYes   Bordetella bronchiseptica MO149
NoYes   Bordetella bronchiseptica 253
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Nitrosomonas sp. AL212
NoYes   Sulfuricella denitrificans skB26
NoYes   Caulobacter crescentus CB15
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Phaeobacter gallaeciensis DSM 26640
NoYes   Leisingera methylohalidivorans DSM 14336
NoYes   Octadecabacter antarcticus 307
NoYes   Rhodobacter sphaeroides KD131
NoYes   Rhodobacter sphaeroides ATCC 17025
NoYes   Rhodobacter sphaeroides 2.4.1
NoYes   Paracoccus aminophilus JCM 7686
NoYes   Magnetospirillum gryphiswaldense MSR-1 v2
NoYes   Rhodospirillum rubrum ATCC 11170
NoYes   Gluconobacter oxydans H24
NoYes   Micavibrio aeruginosavorus EPB
NoYes   Candidatus Pelagibacter ubique HTCC1062
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Brucella ceti TE10759-12
NoYes   Brucella ceti TE28753-12
NoYes   Brucella canis HSK A52141
NoYes   Brucella suis VBI22
NoYes   Brucella suis 1330
NoYes   Brucella suis 1330
NoYes   Brucella melitensis NI
NoYes   Brucella melitensis M5-90
NoYes   Brucella melitensis M28
NoYes   Brucella melitensis bv. 1 str. 16M
NoYes   Brucella abortus A13334
NoYes   Brucella melitensis biovar Abortus 2308
NoYes   Brucella abortus bv. 1 str. 9-941
NoYes   Sinorhizobium fredii USDA 257
NoYes   Sinorhizobium fredii HH103
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti GR4
NoYes   Sinorhizobium meliloti Rm41
NoYes   Sinorhizobium meliloti SM11
NoYes   Sinorhizobium meliloti BL225C
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium etli CFN 42
NoYes   Rhizobium etli bv. mimosae str. Mim1
NoYes   Rhizobium leguminosarum bv. trifolii WSM2304
NoYes   Rhizobium leguminosarum bv. trifolii WSM1325
NoYes   Mesorhizobium australicum WSM2073
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Hyphomicrobium denitrificans 1NES1
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Pasteurella multocida 36950
NoYes   Pasteurella multocida subsp. multocida str. HN06
NoYes   Pasteurella multocida subsp. multocida str. Pm70
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio fischeri ES114
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Vibrio vulnificus CMCP6
NoYes   Vibrio vulnificus YJ016
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Idiomarina loihiensis GSL 199
NoYes   Shewanella sp. W3-18-1
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Shewanella putrefaciens 200
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Alcanivorax dieselolei B5
NoYes   Thalassolituus oleivorans MIL-1
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Xylella fastidiosa subsp. fastidiosa GB514
NoYes   Xylella fastidiosa M12
NoYes   Xylella fastidiosa Temecula1
NoYes   Xylella fastidiosa 9a5c
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Xanthomonas oryzae pv. oryzae MAFF 311018
NoYes   Xanthomonas oryzae pv. oryzae KACC 10331
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Spiribacter salinus M19-40
NoYes   Thioalkalivibrio nitratireducens DSM 14787
NoYes   Thioflavicoccus mobilis 8321
NoYes   Edwardsiella tarda C07-087
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis PA13
NoYes   Pantoea ananatis AJ13355
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Erwinia amylovora CFBP1430
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Azotobacter vinelandii CA6
NoYes   Azotobacter vinelandii CA
NoYes   Pseudomonas denitrificans ATCC 13867
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 10701
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas poae RE*1-1-14
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Acinetobacter genomosp. 13TU RUH2624
NoYes   Acinetobacter sp. SH024
NoYes   Acinetobacter calcoaceticus ruh2202
NoYes   Acinetobacter baumannii ZW85-1
NoYes   Acinetobacter baumannii TYTH-1
NoYes   Acinetobacter baumannii BJAB0868
NoYes   Acinetobacter baumannii BJAB0715
NoYes   Acinetobacter baumannii BJAB07104
NoYes   Acinetobacter baumannii TCDC-AB0715
NoYes   Acinetobacter baumannii D1279779
NoYes   Acinetobacter baumannii MDR-TJ
NoYes   Acinetobacter baumannii 1656-2
NoYes   Acinetobacter baumannii ATCC 19606
NoYes   Acinetobacter baumannii AB307-0294
NoYes   Acinetobacter baumannii AYE
NoYes   Acinetobacter baumannii MDR-ZJ06
NoYes   Acinetobacter baumannii AB0057
NoYes   Acinetobacter baumannii ACICU
NoYes   Acinetobacter radioresistens SH164
NoYes   Acinetobacter junii SH205
NoYes   Acinetobacter lwoffii SH145
NoYes   Methylophaga sp. JAM7
NoYes   Cycloclasticus zancles 7-ME
NoYes   Candidatus Nitrosoarchaeum koreensis Candidatus Nitrosopumilus koreensis AR1
NoYes   Methanomethylovorans hollandica DSM 15978
NoYes   Methanolobus psychrophilus R15
NoYes   Methanosarcina mazei Tuc01
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Mycobacterium tuberculosis H37Rv
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Crater Hills (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   Mouse Gut Community lean1 (meta-genome)
NoYes   Mouse Gut Community lean2 (meta-genome)
NoYes   Mouse Gut Community ob1 (meta-genome)
NoYes   Mouse Gut Community ob2 (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta4 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Gamma3 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]