SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Prim-pol domain alignments in Streptomyces avermitilis MA-4680

These alignments are sequences aligned to the 0037965 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1g71a_                         ....................................................................
gi|29830757|ref|NP_825391.1|  lahalsaaerglaviplsrtklpalrsphratsdrtpsdrgtprhdvpgptapvchgecgrfghgvyd
gi|29830764|ref|NP_825398.1|  llawatqtaqrgrhviplrpndkrpag.........................................

d1g71a_                         ...................................................MLMREVTKEERSEFYSK
gi|29830757|ref|NP_825391.1|  astdprrirrlfaaapwatgygiacglhphfligidldtksgtdssaalre-----------------
gi|29830764|ref|NP_825398.1|  ...................................................-----------------

                                 20        30        40        50        60        70        80     
                                  |         |         |         |         |         |         |     
gi|29830757|ref|NP_825391.1|  --------------------------------------------------------------------
gi|29830764|ref|NP_825398.1|  --------------------------------------------------------------------

                                   90       100       110       120       130       140        150  
                                    |         |         |         |         |         |          |  
gi|29830757|ref|NP_825391.1|  --------------------------------------------LALRHLFTIPDTVVVLTPsGGRHV
gi|29830764|ref|NP_825398.1|  --------------------------------------------------------------.-----

                                     160       170       180       190       200       210       220
                                       |         |         |         |         |         |         |
gi|29830757|ref|NP_825391.1|  WLSG----------------------------------------------------------------
gi|29830764|ref|NP_825398.1|  -------------------------------------------------H------------------

                                       230       240       250       260       270       280       2
                                         |         |         |         |         |         |        
gi|29830757|ref|NP_825391.1|  --------------------------------------------------------------------
gi|29830764|ref|NP_825398.1|  --------------------------------------------------------------------

                                90       300       310       320       330       340                
                                 |         |         |         |         |         |                
gi|29830757|ref|NP_825391.1|  --------------------------------------------------------ppdvvvpnsagr
gi|29830764|ref|NP_825398.1|  --------------------------------------------------------aeqycpatgrca

d1g71a_                         ............................................................
gi|29830757|ref|NP_825391.1|  lapgidirgaggylvgpgsrtrhgvystapgtarlapapcptallrlltppprthhptpp
gi|29830764|ref|NP_825398.1|  dghktpeqrattdvelliaawaqapynvriatgpsglrvidldg................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0037965 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Bathycoccus prasinos
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Microcoleus sp. PCC 7113
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Microlunatus phosphovorus NM-1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium marinum M
NoYes   Corynebacterium efficiens YS-314
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Xylanimonas cellulosilytica DSM 15894
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter arilaitensis Re117
NoYes   Kocuria rhizophila DC2201
NoYes   Micrococcus luteus NCTC 2665
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium bifidum S17
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Deinococcus gobiensis I-0
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Meiothermus silvanus DSM 9946
NoYes   Meiothermus ruber DSM 1279
NoYes   Thermus scotoductus SA-01
NoYes   Thermus thermophilus HB27
NoYes   Finegoldia magna ATCC 29328
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium lentocellum DSM 5427
NoYes   Eubacterium rectale M104/1
NoYes   Clostridium novyi NT
NoYes   Clostridium cellulovorans 743B
NoYes   Mahella australiensis 50-1 BON
NoYes   Caldicellulosiruptor lactoaceticus 6A
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Ammonifex degensii KC4
NoYes   Enterococcus faecium Aus0004
NoYes   Leuconostoc kimchii IMSNU 11154
NoYes   Leuconostoc citreum KM20
NoYes   Leuconostoc gasicomitatum LMG 18811
NoYes   Lactobacillus rhamnosus Lc 705
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus salivarius CECT 5713
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus equi subsp. equi 4047
NoYes   Streptococcus mitis B6
NoYes   Streptococcus agalactiae A909
NoYes   Streptococcus salivarius 57.I
NoYes   Exiguobacterium sp. AT1b
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Anoxybacillus flavithermus WK1
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Marinitoga piezophila KA3
NoYes   Elusimicrobium minutum Pei191
NoYes   Terriglobus roseus DSM 18391
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfovibrio magneticus RS-1
NoYes   Pelobacter propionicus DSM 2379
NoYes   Corallococcus coralloides DSM 2259
NoYes   Azoarcus sp. BH72
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia cenocepacia HI2424
NoYes   Polaromonas sp. JS666
NoYes   Magnetococcus marinus MC-1
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium chlorophenolicum L-1
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Acidiphilium cryptum JF-5
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium meliloti AK83
NoYes   Genome sequence of Rhizobium sp. strain IRBG74
NoYes   Agrobacterium sp. H13-3
NoYes   Candidatus Liberibacter asiaticus str. psy62
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Rhodomicrobium vannielii ATCC 17100
NoYes   Hyphomicrobium sp. MC1
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Nitrosococcus halophilus Nc4
NoYes   Legionella longbeachae NSW150
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Nanoarchaeum equitans Kin4-M
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Cenarchaeum symbiosum A
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Candidatus Korarchaeum cryptofilum OPF8
NoYes   Acidilobus saccharovorans 345-15
NoYes   Fervidicoccus fontis Kam940
NoYes   Pyrolobus fumarii 1A
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Thermogladius cellulolyticus 1633
NoYes   Ignisphaera aggregans DSM 17230
NoYes   Aeropyrum pernix K1
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Thermosphaera aggregans DSM 11486
NoYes   Staphylothermus hellenicus DSM 12710
NoYes   Staphylothermus marinus F1
NoYes   Desulfurococcus fermentans DSM 16532
NoYes   Desulfurococcus kamchatkensis 1221n
NoYes   Desulfurococcus mucosus DSM 2162
NoYes   Metallosphaera cuprina Ar-4
NoYes   Metallosphaera sedula DSM 5348
NoYes   Acidianus hospitalis W1
NoYes   Sulfolobus tokodaii str. 7
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   Thermofilum sp. 1910b
NoYes   Thermofilum pendens Hrk 5
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Vulcanisaeta distributa DSM 14429
NoYes   Caldivirga maquilingensis IC-167
NoYes   Pyrobaculum sp. 1860
NoYes   Pyrobaculum calidifontis JCM 11548
NoYes   Pyrobaculum arsenaticum DSM 13514
NoYes   Pyrobaculum oguniense TE7
NoYes   Thermoproteus neutrophilus V24Sta
NoYes   Pyrobaculum aerophilum str. IM2
NoYes   Pyrobaculum islandicum DSM 4184
NoYes   Thermoproteus uzoniensis 768-20
NoYes   Thermoproteus tenax Kra 1
NoYes   halophilic archaeon DL31
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella conradii HZ254
NoYes   Methanocella paludicola SANAE
NoYes   Methanosaeta harundinacea 6Ac
NoYes   Methanosaeta thermophila PT
NoYes   Methanosaeta concilii GP6
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanohalobium evestigatum Z-7303
NoYes   Methanococcoides burtonii DSM 6242
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Methanosphaerula palustris E1-9c
NoYes   Methanoregula boonei 6A8
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanocorpusculum labreanum Z
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanoculleus bourgensis MS2
NoYes   Methanoculleus marisnigri JR1
NoYes   Methanopyrus kandleri AV19
NoYes   Ferroglobus placidus DSM 10642
NoYes   Archaeoglobus profundus DSM 5631
NoYes   Archaeoglobus veneficus SNP6
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Thermococcus sp. 4557
NoYes   Thermococcus onnurineus NA1
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus gammatolerans EJ3
NoYes   Thermococcus sibiricus MM 739
NoYes   Thermococcus barophilus MP
NoYes   Pyrococcus sp. ST04
NoYes   Pyrococcus yayanosii CH1
NoYes   Pyrococcus horikoshii OT3
NoYes   Pyrococcus abyssi GE5
NoYes   Pyrococcus furiosus COM1
NoYes   Thermoplasmatales archaeon BRNA1
NoYes   Thermoplasma volcanium GSS1
NoYes   Thermoplasma acidophilum DSM 1728
NoYes   Picrophilus torridus DSM 9790
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Halopiger xanaduensis SH-6
NoYes   Methanobacterium sp. AL-21
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Natrinema sp. J7-2
NoYes   Natrialba magadii ATCC 43099
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Haloquadratum walsbyi DSM 16790
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Haloferax volcanii DS2
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Natronomonas pharaonis DSM 2160
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Halalkalicoccus jeotgali B3
NoYes   Halobacterium salinarum R1
NoYes   Halobacterium sp. NRC-1
NoYes   Methanotorris igneus Kol 5
NoYes   Methanocaldococcus sp. FS406-22
NoYes   Methanocaldococcus fervens AG86
NoYes   Methanocaldococcus vulcanius M7
NoYes   methanocaldococcus infernus ME
NoYes   Methanocaldococcus jannaschii DSM 2661
NoYes   Methanothermococcus okinawensis IH1
NoYes   Methanococcus aeolicus Nankai-3
NoYes   Methanococcus maripaludis C5
NoYes   Methanococcus voltae A3
NoYes   Methanococcus vannielii SB
NoYes   Methanothermus fervidus DSM 2088
NoYes   Methanothermobacter marburgensis str. Marburg
NoYes   Methanothermobacter thermautotrophicus str. Delta H
NoYes   Methanosphaera stadtmanae DSM 3091
NoYes   Methanobrevibacter sp. AbM4
NoYes   Methanobrevibacter ruminantium M1
NoYes   Methanobrevibacter smithii ATCC 35061
NoYes   Complete genome sequence of Methanobacterium sp. Mb1
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Cyanothece sp. PCC 7822
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium avidum 44067
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes   Mycobacterium gilvum Spyr1
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Corynebacterium maris DSM 45190
NoYes   Corynebacterium halotolerans YIM 70093 = DSM 44683
NoYes   Corynebacterium terpenotabidum Y-11
NoYes   Corynebacterium glutamicum SCgG2
NoYes   Corynebacterium glutamicum SCgG1
NoYes   Clavibacter michiganensis subsp. nebraskensis NCPPB 2581
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222
NoYes   Bifidobacterium longum subsp. longum JCM 1217
NoYes   Dehalococcoides mccartyi GY50
NoYes   Deinococcus peraridilitoris DSM 19664
NoYes   Thermus oshimai JL-2
NoYes   Thermus thermophilus SG0.5JP17-16
NoYes   Clostridium thermocellum DSM 1313
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Enterococcus faecium DO
NoYes   Lactobacillus paracasei subsp. paracasei 8700:2
NoYes   Lactobacillus casei LOCK919
NoYes   Lactobacillus casei W56
NoYes   Lactobacillus casei LC2W
NoYes   Lactobacillus casei BD-II
NoYes   Lactobacillus casei BL23
NoYes   Lactobacillus casei str. Zhang
NoYes   Lactobacillus rhamnosus LOCK908
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus rhamnosus GG
NoYes   Lactobacillus salivarius UCC118
NoYes   Lactobacillus fermentum CECT 5716
NoYes   Lactobacillus reuteri TD1
NoYes   Lactobacillus reuteri I5007
NoYes   Lactobacillus reuteri SD2112
NoYes   Lactobacillus plantarum 16
NoYes   Lactobacillus plantarum ZJ316
NoYes   Lactobacillus plantarum subsp. plantarum P-8
NoYes   Lactobacillus plantarum WCFS1
NoYes   Lactobacillus helveticus CNRZ32
NoYes   Lactobacillus brevis KB290
NoYes   Pediococcus pentosaceus SL4
NoYes   Lactococcus lactis subsp. lactis KLDS 4.0325
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. lactis Il1403
NoYes   Lactococcus lactis subsp. cremoris KW2
NoYes   Lactococcus lactis subsp. cremoris A76
NoYes   Lactococcus lactis subsp. cremoris NZ9000
NoYes   Lactococcus lactis subsp. cremoris SK11
NoYes   Streptococcus pyogenes HSC5
NoYes   Streptococcus pyogenes MGAS1882
NoYes   Streptococcus pyogenes Alab49
NoYes   Streptococcus pyogenes MGAS10750
NoYes   Streptococcus pyogenes MGAS10270
NoYes   Streptococcus pyogenes MGAS9429
NoYes   Streptococcus pyogenes MGAS6180
NoYes   Streptococcus pyogenes MGAS8232
NoYes   Streptococcus pyogenes MGAS315
NoYes   Streptococcus pyogenes SSI-1
NoYes   Streptococcus suis T15
NoYes   Streptococcus suis ST3
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
NoYes   Paenibacillus polymyxa CR1
NoYes   Bacillus thuringiensis HD-771
NoYes   Bacillus thuringiensis HD-789
NoYes   Bacillus thuringiensis serovar chinensis CT-43
NoYes   Bacillus thuringiensis Bt407
NoYes   Bacillus thuringiensis serovar thuringiensis str. IS5056
NoYes   Bacillus cereus G9842
NoYes   Bacillus cereus ATCC 14579
NoYes   Staphylococcus pasteuri SP1
NoYes   Staphylococcus aureus subsp. aureus T0131
NoYes   Staphylococcus aureus subsp. aureus LGA251
NoYes   Psychroflexus torquis ATCC 700755
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Helicobacter cinaedi ATCC BAA-847
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Campylobacter jejuni Waterborne C.jejuni Outbreak
NoYes   Campylobacter jejuni RM1221
NoYes   Campylobacter jejuni subsp. jejuni 00-2544
NoYes   Campylobacter jejuni subsp. jejuni 00-2538
NoYes   Campylobacter jejuni subsp. jejuni 00-2426
NoYes   Campylobacter jejuni subsp. jejuni 00-2425
NoYes   Campylobacter jejuni subsp. jejuni PT14
NoYes   Campylobacter jejuni subsp. jejuni ICDCCJ07001
NoYes   Campylobacter jejuni subsp. jejuni S3
NoYes   Campylobacter jejuni subsp. jejuni M1
NoYes   Campylobacter jejuni subsp. jejuni IA3902
NoYes   Campylobacter jejuni subsp. jejuni 81116
NoYes   Campylobacter jejuni subsp. jejuni 81-176
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
NoYes   Campylobacter coli 76339
NoYes   Campylobacter coli 15-537360
NoYes   Campylobacter coli CVM N29710
NoYes   Helicobacter cetorum MIT 99-5656
NoYes   Helicobacter pylori BM012S
NoYes   Helicobacter pylori BM012A
NoYes   Helicobacter pylori SouthAfrica20
NoYes   Helicobacter pylori UM298
NoYes   Helicobacter pylori UM066
NoYes   Helicobacter pylori UM037
NoYes   Helicobacter pylori UM299
NoYes   Helicobacter pylori OK310
NoYes   Helicobacter pylori OK113
NoYes   Helicobacter pylori Rif2
NoYes   Helicobacter pylori Rif1
NoYes   Helicobacter pylori HUP-B14
NoYes   Helicobacter pylori PeCan18
NoYes   Helicobacter pylori Shi169
NoYes   Helicobacter pylori Shi112
NoYes   Helicobacter pylori Shi417
NoYes   Helicobacter pylori XZ274
NoYes   Helicobacter pylori Aklavik86
NoYes   Helicobacter pylori Aklavik117
NoYes   Helicobacter pylori SNT49
NoYes   Helicobacter pylori Puno135
NoYes   Helicobacter pylori Puno120
NoYes   Helicobacter pylori ELS37
NoYes   Helicobacter pylori Gambia94/24
NoYes   Helicobacter pylori SouthAfrica7
NoYes   Helicobacter pylori India7
NoYes   Helicobacter pylori Lithuania75
NoYes   Helicobacter pylori 2017
NoYes   Helicobacter pylori 2018
NoYes   Helicobacter pylori 908
NoYes   Helicobacter pylori F57
NoYes   Helicobacter pylori F30
NoYes   Helicobacter pylori F16
NoYes   Helicobacter pylori Sat464
NoYes   Helicobacter pylori Cuz20
NoYes   Helicobacter pylori PeCan4
NoYes   Helicobacter pylori SJM180
NoYes   Helicobacter pylori B8
NoYes   Helicobacter pylori 52
NoYes   Helicobacter pylori v225d
NoYes   Helicobacter pylori 83
NoYes   Helicobacter pylori 35A
NoYes   Helicobacter pylori P12
NoYes   Helicobacter pylori G27
NoYes   Helicobacter pylori Shi470
NoYes   Helicobacter pylori HPAG1
NoYes   Helicobacter pylori 51
NoYes   Helicobacter pylori F32
NoYes   Helicobacter pylori J99
NoYes   Helicobacter pylori 26695
NoYes   Helicobacter pylori 26695
NoYes   Geobacter sp. M18
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Ralstonia solanacearum PSI07
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Variovorax paradoxus B4
NoYes   Octadecabacter arcticus 238
NoYes   Magnetospirillum gryphiswaldense MSR-1 v2
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Sinorhizobium fredii HH103
NoYes   Candidatus Liberibacter solanacearum CLso-ZC1
NoYes   Candidatus Liberibacter americanus str. Sao Paulo
NoYes   Candidatus Liberibacter asiaticus str. gxpsy
NoYes   Hyphomicrobium nitrativorans NL23
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 10701
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Acinetobacter lwoffii SH145
NoYes   Candidatus Nitrososphaera gargensis Ga9.2
NoYes   Candidatus Nitrosoarchaeum koreensis Candidatus Nitrosopumilus koreensis AR1
NoYes   Caldisphaera lagunensis DSM 15908
NoYes   Aeropyrum camini SY1 = JCM 12091
NoYes   Sulfolobus islandicus LAL14/1
NoYes   Sulfolobus islandicus REY15A
NoYes   Sulfolobus islandicus HVE10/4
NoYes   Sulfolobus islandicus Y.G.57.14
NoYes   Sulfolobus islandicus L.S.2.15
NoYes   Sulfolobus islandicus M.16.27
NoYes   Sulfolobus islandicus M.14.25
NoYes   Sulfolobus islandicus M.16.4
NoYes   Sulfolobus islandicus L.D.8.5
NoYes   Sulfolobus solfataricus 98/2
NoYes   Sulfolobus acidocaldarius SUSAZ
NoYes   Sulfolobus acidocaldarius Ron12/I
NoYes   Sulfolobus acidocaldarius N8
NoYes   Methanomethylovorans hollandica DSM 15978
NoYes   Methanolobus psychrophilus R15
NoYes   Methanosarcina mazei Tuc01
NoYes   Methanoregula formicica Methanoregula formicicum SMSP
NoYes   Archaeoglobus sulfaticallidus PM70-1
NoYes   Thermococcus sp. AM4
NoYes   Thermococcus sp. CL1
NoYes   Thermococcus litoralis DSM 5473
NoYes   Pyrococcus sp. NA2
NoYes   Pyrococcus furiosus DSM 3638
NoYes   Candidatus Methanomethylophilus alvus Mx1201
NoYes   Candidatus Methanomassiliicoccus intestinalis Issoire-Mx1
NoYes   Ferroplasma acidarmanus fer1
NoYes   Halovivax ruber XH-70
NoYes   Natrinema pellirubrum DSM 15624
NoYes   Natronococcus occultus SP4
NoYes   Natronobacterium gregoryi SP2
NoYes   Haloquadratum walsbyi C23
NoYes   Halorhabdus tiamatea SARL4B
NoYes   Natronomonas moolapensis 8.8.11
NoYes   Haloarcula hispanica N601
NoYes   Methanococcus maripaludis X1
NoYes   Methanococcus maripaludis C6
NoYes   Methanococcus maripaludis C7
NoYes   Methanococcus maripaludis S2
NoYes   Methanobacterium sp. SWAN-1
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   1_050719N (meta-genome)
NoYes   1_Upper_euphotic (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Morges-2009 (Newbler) (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Bath Hot Springs, filamentous community (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Core Eukaryotic Genes 458 (CEGMA)
NoYes   Crater Hills (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot Spring microbial communities from Yellowstone Obsidian Hot Spring, Sample 10594 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP12 from Calcite Springs, Tower Falls Region (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP14 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP19 from Cistern Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP2 from Nymph Lake 10 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP3 from Monarch Geyser, Norris Geyser Basin (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP4 from Joseph's Coat Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]