SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Growth factor receptor domain alignments in Sus scrofa 76_10.2

These alignments are sequences aligned to the 0053842 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2dspb1               de............................................................................
ENSSSCP00000006199  svchpecgdkgcdgpnadqclncvhfslgsvktsrkcvstcplgyfgdtgarrcrrchkgcetcsgrsatqclscrrg
ENSSSCP00000009595  hscaachescaacwgpsekhclacrdpllvlregtcesscgdgfynkqgtcsacdqsckscgprsp............
ENSSSCP00000009595  hgvckachpscltcvgpepshctqcmkpeeglqveslsgtnitagkcllrcraqlylestgl................
ENSSSCP00000030152  dnracqpcdmhcrscdsqasctscrdpnkvllfgdcqhescapqyyldlssktckecdw...................
ENSSSCP00000009595  dnracqpcdmhcrscdsqasctscrdpnkvllfgdcqhescapqyyldlssktckecdw...................
ENSSSCP00000029508  csscrppllmqhgqcvstcgngfyqdhhscaachescaacwgpsekhclacrdpllvlregtce..............
ENSSSCP00000025452  icn...........................................................................
ENSSSCP00000018516  a.............................................................................
ENSSSCP00000030152  chplcqhcaadlhhtgsvclrcqnarhlllgdrcvpdcpsgyfvergackrchsscrtchgrg...............
ENSSSCP00000017120  vcnhl.........................................................................
ENSSSCP00000029843  cy............................................................................
ENSSSCP00000018545  cy............................................................................
ENSSSCP00000030723  cy............................................................................
ENSSSCP00000017138  v.............................................................................
ENSSSCP00000017718  ..............................................................................
ENSSSCP00000022942  dvdeca........................................................................
ENSSSCP00000000030  dineclvnnggcdhfcrntvgsfecgcrkgyklltdertcqdidecsfertcdhvcinspgsfqclchrgytlyg...
ENSSSCP00000014445  dvnecaenpgvcsnglcvntdgs.......................................................
ENSSSCP00000002645  ecrygycqqlcanvpgsysc..........................................................
ENSSSCP00000013927  cpvgfsmtetavgirctdideclsasceghcvnteggfvcecgpgm................................
ENSSSCP00000017120  c.............................................................................
ENSSSCP00000030683  pclvptqgslcpqcr...............................................................
ENSSSCP00000005408  nretcehnhercsrhafctdyatgfcchcqsrfygngkhclpegaphrvngkvsghllvghtpvhftdvdlhayvvgn
ENSSSCP00000012373  icgrgyhasqdgtkcvdvnecetgvhhcsetqvchnlpgsyrcdckagfqrdafgrtcidvne...............
ENSSSCP00000023772  qdvdeca.......................................................................
ENSSSCP00000009595  chpdcltcsqsp..................................................................
ENSSSCP00000000011  cgrgyhlneegtrcvdvdecsppae.....................................................
ENSSSCP00000005017  qcndrnecqeipnicshgqcidtvgsfyclchtgfktnadqtmcldinecerda........................
ENSSSCP00000015165  eciqngvlckngrcvntdgsfqcicnagfelttdgkncvdhdectttnmclngmcinedgsfk...............
ENSSSCP00000024250  eciqngvlckngrcvntdgsfqcicnagfelttdgkncvdhdectttnmclngmcinedgsfk...............
ENSSSCP00000029508  chpdcltcsqsp..................................................................
ENSSSCP00000029508  ecpg..........................................................................
ENSSSCP00000015505  decqtrnggcdhvcrntagsfdcscrkgfklltdekscqdvdecslert.............................
ENSSSCP00000024250  dvneclespgicsngqcintdgs.......................................................
ENSSSCP00000015165  dvneclespgicsngqcintdgs.......................................................
ENSSSCP00000007665  cvicseengcstcqqrlflfirregirqygkcvhdcppgyfgvrgqevnrckkcg.......................
ENSSSCP00000001667  decvegtdnchidaicqntprsykcicksgytgdgkhck.......................................
ENSSSCP00000029843  sra...........................................................................
ENSSSCP00000018545  sra...........................................................................
ENSSSCP00000030723  sra...........................................................................
ENSSSCP00000005017  nvtdycqlfry...................................................................
ENSSSCP00000024250  decsqspkpcnfickntegsyqcscprgyvlqedgktckdldecq.................................
ENSSSCP00000015165  decsqspkpcnfickntegsyqcscprgyvlqedgktckdldecq.................................
ENSSSCP00000014445  crfgqclntagsfhclcqdgfeltndgkncmdtneclslsg.....................................
ENSSSCP00000015165  cssgvgitvdgrdinecaldpdicangicenlrgsyrcncnsgyepdpsgrncididecl..................
ENSSSCP00000015165  cvdrnecleipnvcshglcvdlqgsyqcichngfkasqdqtmcmdvdecer...........................
ENSSSCP00000024250  cssgvgitvdgrdinecaldpdicangicenlrgsyrcncnsgyepdpsgrncididecl..................
ENSSSCP00000013809  ceagd.........................................................................
ENSSSCP00000024250  cvdrnecleipnvcshglcvdlqgsyqcichngfkasqdqtmcmdvdecer...........................
ENSSSCP00000015165  nqtidickhhanlcln..............................................................
ENSSSCP00000024250  nqtidickhhanlcln..............................................................
ENSSSCP00000026721  cpsvcgk.......................................................................
ENSSSCP00000001667  decrlnnggcdhicrntvgsfecsckkgykllinerncqdidecsfdrt.............................
ENSSSCP00000009595  chplcqhcaadlhhtgsvclrcqnarhlllgdrcvpdcpsgyfvergackrchsscr.....................
ENSSSCP00000022942  gcvasadtdecragnggcqvhcvntegsyqc...............................................
ENSSSCP00000004554  cqggcatcsdyngclsckpklffvlerigmkqigvclsscpsgyygtrypdinkctkcka..................
ENSSSCP00000005181  ivgnkppkecgdlcpgtleekplcekttinneyny...........................................
ENSSSCP00000015165  cmdidecernpllcrggtcvntegsfqcdcplghelspsredcvdvnecslsdnlcrngkcvnmigtyq.........
ENSSSCP00000005017  deckepdvckhgqcin..............................................................
ENSSSCP00000005017  dinecaldpdicpngicenlrgtykcicnsgyevdstgkncvdinecv..............................
ENSSSCP00000005017  cnngrcintdgsfhcvcnagfhvtrdgkncedmdecsirnmclngmcinedgsf........................
ENSSSCP00000024250  fykdineckafpgmctygkcrntigsfkcrcnsgfaldm.......................................
ENSSSCP00000014445  vgrnecreipnicshgdcmdtvdsytcqchrgfrasadqtlctdvdecd.............................
ENSSSCP00000013792  ecvdidecryrycqhrcvnlpgsfrcqcepgfqlgpnnrscv....................................
ENSSSCP00000005017  fcvdidecsimnggcetfctnsegsyecscqpgfalmpdqrsctdidecednpn........................
ENSSSCP00000001667  dvdecvegtdnchidaicqntprsykcicksgytgdgkhckdvde.................................
ENSSSCP00000015165  kgttgctdvdeceigahncdmhasclnvpgsfk.............................................
ENSSSCP00000023772  pdvdecardpllcrggtctntdgsy.....................................................
ENSSSCP00000024250  kgttgctdvdeceigahncdmhasclnvpgsfk.............................................
ENSSSCP00000005017  gktgctdineceigahncdrha........................................................
ENSSSCP00000009507  a.............................................................................
ENSSSCP00000007874  kdlcaegghgcqhqcvsapgtfhcacnpgyrlaadnksclainlcaeethgcehhcvsspgsy...............
ENSSSCP00000005017  ffkdineckmipnlcthgkcrntigsfkcrcdsgfaldseern...................................
ENSSSCP00000002566  ceegyrgqsgscvdvnecltpgvcahgtclnlegsfrcscepgyevtsdekgcqdvdecasr................
ENSSSCP00000014416  neecgdicpgtakgktncpatvingqf...................................................
ENSSSCP00000024250  vdvnecslsdnlcrngkcvnmigtyqcscnpgyqatpdrqgctdidecmimnggcdtq....................
ENSSSCP00000024250  decaeni.......................................................................
ENSSSCP00000015165  decaeni.......................................................................
ENSSSCP00000012319  qcglgyfeaernsshlvcsacfgpcarcsgpeesnclqckkgwalhhlkcvdidecgterascgadqfcvntegsyec
ENSSSCP00000006447  gclscskdngcsrcqqklffflrregmrqygeclhscpsgyyghrapdm.............................
ENSSSCP00000011407  g.............................................................................
ENSSSCP00000001667  ecrpgfeltknqrdckltcnygnggcqh..................................................
ENSSSCP00000023772  tmcangvclnedgsfaclckpgfllapggrhcmdidecqtpgicmnghctntegsfhcrclggl..............
ENSSSCP00000005017  lcafrcvntygsyeckcptgyvlredrrmckdedeceegkhdcaekqmecknligmyic...................
ENSSSCP00000023772  lcvfgicenlpgmfrcvcdegyeldrrypqctdvn...........................................
ENSSSCP00000007154  qcplgytgsyceeqldecssnpcqhgatcrdfiggyrcecvpgyqgvnceyevdecqnqpcq................
ENSSSCP00000028498  cvpgwmgvnchinindcrgqcqhggtckdlvngyqcvcprgfggrh................................
ENSSSCP00000001987  gcktltsgqacvvceegfslhqktcvqhcppgfapqvldthyntendveiiras........................
ENSSSCP00000000276  ..............................................................................
ENSSSCP00000013792  ectdgyewdpdsqhcrdvnecltipeackgemkcinhyggylclprsaavindlhgegppppvspaehatpclpgyep
ENSSSCP00000002768  cvpgwmgvnchinindcrgqcqhggtckdlvngyqcvcprgfggrh................................
ENSSSCP00000025452  s.............................................................................
ENSSSCP00000020647  qlcqaggqcvdkdgshycvcpegrtgshceqevdpclaqp......................................
ENSSSCP00000001049  gdgscqchagyrgplctdcvdgyfsslrna................................................
ENSSSCP00000030663  icpeqwvgatcqldindcrgqcqhggtckdlvngyqcvcprgfggr................................
ENSSSCP00000023772  chdrdecafqehgcspradclnipgsyrcschpgftgdgfscedrdecaenvd.........................
ENSSSCP00000023563  icgrgyhasqdgtkcvdvnecetgvh....................................................
ENSSSCP00000007530  clpgwm........................................................................
ENSSSCP00000014445  decssrqhncqffcvntigaf.........................................................
ENSSSCP00000021308  tnecldnkggcshi................................................................
ENSSSCP00000026405  dqcnp.........................................................................
ENSSSCP00000007154  clpgfigdkcqtdmneclsepcknggtcsdyvnsytckcqag....................................
ENSSSCP00000028139  icnpgymgaicsdqidecysspclnegrcidlvngyqcncqpgtsgvncein..........................
ENSSSCP00000006106  rcmnllgsy.....................................................................
ENSSSCP00000007154  eclkgyagprcemdinechsdpcqndatcldkiggftclcmpgfkgvhceleinecqsnpcvns..............
ENSSSCP00000004772  ..............................................................................
ENSSSCP00000028139  snpcehagkcvntdgafhceclkgyagp..................................................
ENSSSCP00000021312  qlcqaggqcvdkdgshycvcpegrtgshceqevdpclaqpc.....................................
ENSSSCP00000023772  ykadvneckafpglcaqgtcrntvgsfhcscaggfaldaqer....................................
ENSSSCP00000008961  ipsnpshriqcatgyeqsehnvcqdidectagt.............................................
ENSSSCP00000029826  pdinecapptavscgkgadcqntegsyhcicvpgyelasgapvfrnenentcqdvdecqqklr...............
ENSSSCP00000023563  cfpgyaimadgvscedinecvtdmhtcsrsehcvntvgsfrcykaltce.............................
ENSSSCP00000027947  g.............................................................................
ENSSSCP00000021312  tcppgyggfrceqdlpdcspsscfnggtcvdgvtsftclcrpgyt.................................
ENSSSCP00000016757  p.............................................................................
ENSSSCP00000006411  q.............................................................................
ENSSSCP00000030721  q.............................................................................
ENSSSCP00000022942  decaenvdl.....................................................................
ENSSSCP00000028139  tckkgfkghncqvnidecasnpclnqgtcfddisgytchcvlpytgkncqtvl.........................
ENSSSCP00000005851  ecssspchnngickdqvggficecpsgytgql..............................................
ENSSSCP00000020647  tgqfcted......................................................................
ENSSSCP00000000011  ggpckqqcrdtgqevvcscfvgyqllpdgvscedinecikgsqncrlgetcintvgsfrcqrdsscgtgyeltedndc
ENSSSCP00000011618  icpagyagrfceldhdecgsspcrngamcqdgingysc........................................
ENSSSCP00000002566  pckgrgrcvnrvgsyscfcypgymlatsgatqecqdideceqpglcsggrctntvgsyhc..................
ENSSSCP00000005753  p.............................................................................
ENSSSCP00000024343  cyigthgcdtnaacrpgpg...........................................................
ENSSSCP00000024250  cdgnhrcqhgcqnilggyrcgcpqgyiqhyqwnqcvdenecsnpnacgsascyntlgsykcacpsgfs..........
ENSSSCP00000015165  cdgnhrcqhgcqnilggyrcgcpqgyiqhyqwnqcvdenecsnpnacgsascyntlgsykcacpsgfs..........
ENSSSCP00000025758  crpgytgancetevdeckaspcrnggsctdlen.............................................
ENSSSCP00000007862  ..............................................................................
ENSSSCP00000013809  cpdgkgytqdnnivnygipahrdidecilfgaeickegkcvntqpgyecyckqgfyydgnllecvdvdeclde.....
ENSSSCP00000009174  tgsyhcecyegytlnedrktcsardqcalgthgcqhic........................................
ENSSSCP00000017222  cdpgyhglyceeeyneclsspclnaatcrdlvngyecvclaeykgih...............................
ENSSSCP00000001551  eclsqpchpgstcldllatfhclcppglegrlcevetdecasapclnqadchdlpngfr...................
ENSSSCP00000030663  cppgwrgst.....................................................................
ENSSSCP00000001551  cvsgwggtdceenlddcaaatcapg.....................................................
ENSSSCP00000007401  a.............................................................................
ENSSSCP00000028117  gtnpclhqnggcehickesfgtaqclchegflkapdgkmclalngqeilagrgkdlsdgvmpvdtlprsrelednlte
ENSSSCP00000014445  r.............................................................................
ENSSSCP00000006890  carttfsghtdyrc................................................................
ENSSSCP00000021312  ldvdecastpcrngakcvdqpdgyecrcaegfegtvcernvddcspd...............................
ENSSSCP00000018024  cplgfegqrceinpddcedndcennatcvdginnyvcvcpp.....................................
ENSSSCP00000006356  ..............................................................................
ENSSSCP00000028498  cppgwrgst.....................................................................
ENSSSCP00000014657  eclntdrgyhcictpgyelasgaptfrnesentcqdvdecqqk...................................
ENSSSCP00000007154  vcspgftgqrcnididecasnpcrkgatcindvngfrcmcpegphhpscys...........................
ENSSSCP00000007579  cispklgcdfnnggceqdcfeggdgsfrcgcrpgyrllddlvscasrnpcsss.........................
ENSSSCP00000005851  fcrpgsvlrgrmcvncplgtyyslehsvcesclmgsyqdeegqlecklc.............................
ENSSSCP00000007154  ckkgfkghncqvnidecasnpclnqgtcfddisgytchcvlpytgkncqtvl..........................
ENSSSCP00000021312  rcppgttgvncevniddcasn.........................................................
ENSSSCP00000004525  c.............................................................................
ENSSSCP00000005127  ecppnftgsncekkvdrctsnpcanggqclnrgpnrvcrcrpgftgahce............................
ENSSSCP00000013809  lcgdggfcinfpghykcncypgyrlkasrppvcedidecrdps...................................
ENSSSCP00000012373  aqrcsqecaniygsyqcycrqgyqlaedghtcidide.........................................
ENSSSCP00000013809  tdecrlnqn.....................................................................
ENSSSCP00000006106  wcppgfirqngictdldecqvgnlcqhacrntegsyqc........................................
ENSSSCP00000007154  pkgqfctedvdecllq..............................................................
ENSSSCP00000020647  capgytgtrcesqvdecrsqpcrhggkcldlvdkylcrcppg....................................
ENSSSCP00000007578  acgvenggcqhacngsagesrclcpadaalqedgrsceapaehpchrlcehicfhdpldaptny..............
ENSSSCP00000007530  cpegysgpnceiaehaclsdpch.......................................................
ENSSSCP00000027035  crpgqhrsgakcvscpqgtyyhgqteqcvpcpagtfqeregqlscdlcpgsdahgplgatnittcagqcspgqhsvdg
ENSSSCP00000001667  crpgqhrsgakcvscpqgtyyhgqteqcvpcpagtfqeregqlscdlcpgsdahgplgatnittcagqcspgqhsvdg
ENSSSCP00000022329  fsspdidecsqsppacgphsvcrnlpgsykcsclpgfssptgddwipakggrfacvdineclqsgvcpehsqctnslg
ENSSSCP00000023132  cvpspclgsapcqaleagmfhcqcppgrf.................................................
ENSSSCP00000020647  cardvdeclsspcscfnggtcvdgvtsftclcrpgytgahcqheadpclsrp..........................
ENSSSCP00000014445  cgeipvicangicinqigsfrcecp.....................................................
ENSSSCP00000021312  qcpagftgplcespav..............................................................
ENSSSCP00000017222  vclagytgelcqskidycvldpcrngatcishlsgftcqcpegylgatceekvd........................
ENSSSCP00000012904  sqdvnecgvkprpcqhrcvnthgsykcfclsghmlmpdatcsnsrtcavtscqyg.......................
ENSSSCP00000002566  glqaeecgilng..................................................................
ENSSSCP00000002566  ycaprgeclnshgsffclcapgfasadggtscqdvd..........................................
ENSSSCP00000000030  lsctrcpssdglglagarnvsecggqcspgffssdgfrpcq.....................................
ENSSSCP00000001551  cqdrv.........................................................................
ENSSSCP00000026016  y.............................................................................
ENSSSCP00000017908  y.............................................................................
ENSSSCP00000027537  y.............................................................................
ENSSSCP00000010270  ecsrpnrg......................................................................
ENSSSCP00000017355  celetdacrvqpcrnggscrglrgafvcqcppgftgv.........................................
ENSSSCP00000020581  ppcspackashcwgesskdcrlgtpslgqevspeggagegllprlppcshpalcltvtrtixlpvpqacfhfnhsgic
ENSSSCP00000002768  vcdsgftgtycheniddclgqpcrnggtcidevdafrcfcpsgwegelcdtnpnd.......................
ENSSSCP00000007579  egacqdvdecapgrspcaqgctntigsfscscedgyilageegt..................................
ENSSSCP00000012373  hcvntvgsfrcykaltcepgymlk......................................................
ENSSSCP00000027290  sacvqrdteglcqechspayilghlclaycppryfnhtqqtvtagpgrpatp..........................
ENSSSCP00000020647  cppgwvgewcqled................................................................
ENSSSCP00000010782  qcfrgrchpvdgtcscepgyrgkycrepcpagfygpglppp.....................................
ENSSSCP00000023085  pklts.........................................................................
ENSSSCP00000006198  psreecihcatnfhfqdwrcvpacgegfypeempglphk.......................................
ENSSSCP00000002645  lclpspgdaqqqctngfdldrssgqcldidecrtipeacrgdmmcvnqnggylciprtnpvyrgpysnpysnpysgpy
ENSSSCP00000009298  ..............................................................................
ENSSSCP00000014405  decsqsppacgphsvcrnlpgsykcsclpgfssptgddwipakggrfacvdineclqsgvcpehs.............
ENSSSCP00000014076  knrcgdnnggcthlclpsgqnytcacptgfrkisshacaqsldkfllfa.............................
ENSSSCP00000000451  cvaeallcngqddcgdgsdergchvneclshklsgcsqdcedlkigfkcrcrpgfrlkddgrtcadvdecsttfpcsq
ENSSSCP00000001551  vcdvgwtgpecdaelggcistpcahggtchpqpfg...........................................
ENSSSCP00000021567  qcfrgrchpvdgtcscepgyrgkycrepcpagfyggcrr.......................................
ENSSSCP00000029769  gcgpdnggceh...................................................................
ENSSSCP00000030031  ccygwrrsskgvcea...............................................................
ENSSSCP00000003828  rcmckagfeavengtvcrgcpsgtfkanqgdeacthcpinsrttsegatncvcr........................
ENSSSCP00000011618  asgyicicppgrtgihceedld........................................................
ENSSSCP00000014445  wsqcvdenecvlsptacgsaschntlggfr................................................
ENSSSCP00000009075  aee...........................................................................
ENSSSCP00000006520  tcghnqyfdisal.................................................................
ENSSSCP00000022247  tnpcadrnggcshlcfftpratkcgcpiglellsdmktcivpeaflvftsraaihrisldtnnndvaiplagvkeasa
ENSSSCP00000013700  tnpcadrnggcshlcfftpratkcgcpiglellsdmktcivpeaflvftsraaihrisldtnnndvaiplagvkeasa
ENSSSCP00000028117  vcpptssecintegg...............................................................
ENSSSCP00000015505  ddchtnalcqntptshkcscgpgyqgegrrceglrscirfngekkrhagnavsatlctrlsgrfhaahegrdcldade
ENSSSCP00000019577  cpayatctntsdsyycsckrgflstngqmqfkvegllgvdvnecanpktcpehaicrnsvgsyscvckpgfessrgkt
ENSSSCP00000012631  s.............................................................................
ENSSSCP00000025137  s.............................................................................
ENSSSCP00000027035  ncmnknhgcahicretpkggiacecrpgfeltknqrdckltcnygnggcqh...........................
ENSSSCP00000003671  pcsncsagt.....................................................................
ENSSSCP00000028153  ..............................................................................
ENSSSCP00000026160  ..............................................................................
ENSSSCP00000007291  cfpckpgtyadkqgssfcklcpantysnkgetschqcdpdkysekgsstcrvrpactdkdyfsthtacdasgetqlmy
ENSSSCP00000020747  lcfllslsgavarkttg.............................................................
ENSSSCP00000015505  cavgqgrvgsqcvscragtyydgaqercilcpdgtfqneegqitcepcprpenpgvqktpeawnvsecgglcqpgeys
ENSSSCP00000016321  asscracalgse..................................................................
ENSSSCP00000008197  vtgcscapgfeaaegntrcracgqgtfksq................................................
ENSSSCP00000009514  kcmckagyeekngt................................................................
ENSSSCP00000023658  pigkcscnagyeergfmceacrpgfykasdgnm.............................................
ENSSSCP00000004152  kfggaic.......................................................................
ENSSSCP00000001540  grrvcstyrttyrvawrevrrevqqthavccqgwkkrhpga.....................................
ENSSSCP00000007291  v.............................................................................
ENSSSCP00000000030  tcgtgqvlqdgkcvacepgtyfsgepgq..................................................
ENSSSCP00000030683  pkltscatna....................................................................
ENSSSCP00000003769  qclcqagyekvedacqacspgffksease.................................................
ENSSSCP00000025638  dtg...........................................................................
ENSSSCP00000016321  cfpckpgtfsdkpgsficqvcprntysekgakecikcdedsqfseegssecterppctmkdyfqihtpcdeegktqim
ENSSSCP00000011522  iqsflycnengllgsfseeth.........................................................
ENSSSCP00000003272  cppedecanghhdcnetqnchdrphgyecscktgytmdnvtglcrpv...............................
ENSSSCP00000000911  cregsagrfchkhtsacgpymefchihat.................................................


                                                                                                    
                                                                                                    
d2dspb1               ..............................................................................
ENSSSCP00000006199  fyhhqemnt.....................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000018516  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000017138  ..............................................................................
ENSSSCP00000017718  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000013927  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000030683  ..............................................................................
ENSSSCP00000005408  dgraytaishipqpaaqallplmpigglfgwlfalekpgwengfsltgatfihdmevtfhpggervritqtaegldpe
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000007665  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000026721  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000004554  ..............................................................................
ENSSSCP00000005181  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000009507  ..............................................................................
ENSSSCP00000007874  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000014416  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000012319  rdca..........................................................................
ENSSSCP00000006447  ..............................................................................
ENSSSCP00000011407  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000001987  ..............................................................................
ENSSSCP00000000276  ..............................................................................
ENSSSCP00000013792  deqencvdvde...................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000001049  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021308  ..............................................................................
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000004772  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000008961  ..............................................................................
ENSSSCP00000029826  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000027947  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000016757  ..............................................................................
ENSSSCP00000006411  ..............................................................................
ENSSSCP00000030721  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000000011  kdvpdidecesgihnclpdficq.......................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000005753  ..............................................................................
ENSSSCP00000024343  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000025758  ..............................................................................
ENSSSCP00000007862  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000009174  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000007401  ..............................................................................
ENSSSCP00000028117  sqhilvaeimvsddedcga...........................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000006890  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000006356  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000014657  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000004525  ..............................................................................
ENSSSCP00000005127  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000007578  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000027035  fkp...........................................................................
ENSSSCP00000001667  fkp...........................................................................
ENSSSCP00000022329  syscschvgftstnsicegrsilat.....................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000012904  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000026016  ..............................................................................
ENSSSCP00000017908  ..............................................................................
ENSSSCP00000027537  ..............................................................................
ENSSSCP00000010270  ..............................................................................
ENSSSCP00000017355  ..............................................................................
ENSSSCP00000020581  elhcpalvtyntdtfesmpnpegcvtacpynylst...........................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000027290  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000010782  ..............................................................................
ENSSSCP00000023085  ..............................................................................
ENSSSCP00000006198  ..............................................................................
ENSSSCP00000002645  paaapplsapnyptisrplicrfgyqmdesnqcvdvdec.......................................
ENSSSCP00000009298  ..............................................................................
ENSSSCP00000014405  ..............................................................................
ENSSSCP00000014076  ..............................................................................
ENSSSCP00000000451  rcinth........................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000021567  ..............................................................................
ENSSSCP00000029769  ..............................................................................
ENSSSCP00000030031  ..............................................................................
ENSSSCP00000003828  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000009075  ..............................................................................
ENSSSCP00000006520  ..............................................................................
ENSSSCP00000022247  ldfdvstnhiywtdvslktisrafmngssvehviefgldypegmavdwmgknlywadtgtnrievarldgqfrqvlvw
ENSSSCP00000013700  ldfdvstnhiywtdvslktisrafmngssvehviefgldypegmavdwmgknlywadtgtnrievarldgqfrqvlvw
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000019577  svqgpgqmc.....................................................................
ENSSSCP00000012631  ..............................................................................
ENSSSCP00000025137  ..............................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000003671  ..............................................................................
ENSSSCP00000028153  ..............................................................................
ENSSSCP00000026160  ..............................................................................
ENSSSCP00000007291  kwaqpkicsedlegavklpasgvk......................................................
ENSSSCP00000020747  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000008197  ..............................................................................
ENSSSCP00000009514  ..............................................................................
ENSSSCP00000023658  ..............................................................................
ENSSSCP00000004152  ..............................................................................
ENSSSCP00000001540  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000030683  ..............................................................................
ENSSSCP00000003769  ..............................................................................
ENSSSCP00000025638  ..............................................................................
ENSSSCP00000016321  ykwiepkicredltdairlppsgekk....................................................
ENSSSCP00000011522  ..............................................................................
ENSSSCP00000003272  ..............................................................................
ENSSSCP00000000911  ..............................................................................


                                                                                                    
                                                                                                    
d2dspb1               ..............................................................................
ENSSSCP00000006199  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000018516  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000017138  ..............................................................................
ENSSSCP00000017718  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000013927  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000030683  ..............................................................................
ENSSSCP00000005408  nylsiktniqgqvpyipanftvhitpykelyhysgsavtstssraysltygainqtrsysihqnityqtcrhaprhwa
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000007665  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000026721  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000004554  ..............................................................................
ENSSSCP00000005181  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000009507  ..............................................................................
ENSSSCP00000007874  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000014416  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000012319  ..............................................................................
ENSSSCP00000006447  ..............................................................................
ENSSSCP00000011407  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000001987  ..............................................................................
ENSSSCP00000000276  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000001049  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021308  ..............................................................................
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000004772  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000008961  ..............................................................................
ENSSSCP00000029826  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000027947  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000016757  ..............................................................................
ENSSSCP00000006411  ..............................................................................
ENSSSCP00000030721  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000005753  ..............................................................................
ENSSSCP00000024343  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000025758  ..............................................................................
ENSSSCP00000007862  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000009174  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000007401  ..............................................................................
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000006890  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000006356  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000014657  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000004525  ..............................................................................
ENSSSCP00000005127  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000007578  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000022329  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000012904  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000026016  ..............................................................................
ENSSSCP00000017908  ..............................................................................
ENSSSCP00000027537  ..............................................................................
ENSSSCP00000010270  ..............................................................................
ENSSSCP00000017355  ..............................................................................
ENSSSCP00000020581  ..............................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000027290  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000010782  ..............................................................................
ENSSSCP00000023085  ..............................................................................
ENSSSCP00000006198  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000009298  ..............................................................................
ENSSSCP00000014405  ..............................................................................
ENSSSCP00000014076  ..............................................................................
ENSSSCP00000000451  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000021567  ..............................................................................
ENSSSCP00000029769  ..............................................................................
ENSSSCP00000030031  ..............................................................................
ENSSSCP00000003828  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000009075  ..............................................................................
ENSSSCP00000006520  ..............................................................................
ENSSSCP00000022247  rdldnprslaldptkgyiywtewggkprivrafmdgtngmtlvdkvgrandltidyadqrlywtdldtnmiessnmlg
ENSSSCP00000013700  rdldnprslaldptkgyiywtewggkprivrafmdgtngmtlvdkvgrandltidyadqrlywtdldtnmiessnmlg
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000019577  ..............................................................................
ENSSSCP00000012631  ..............................................................................
ENSSSCP00000025137  ..............................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000003671  ..............................................................................
ENSSSCP00000028153  ..............................................................................
ENSSSCP00000026160  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000020747  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000008197  ..............................................................................
ENSSSCP00000009514  ..............................................................................
ENSSSCP00000023658  ..............................................................................
ENSSSCP00000004152  ..............................................................................
ENSSSCP00000001540  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000030683  ..............................................................................
ENSSSCP00000003769  ..............................................................................
ENSSSCP00000025638  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000011522  ..............................................................................
ENSSSCP00000003272  ..............................................................................
ENSSSCP00000000911  ..............................................................................


                                                                                                    
                                                                                                    
d2dspb1               ......................................................................--AIHCP.
ENSSSCP00000006199  ......................................................................-------.
ENSSSCP00000009595  ......................................................................----RCL.
ENSSSCP00000009595  ......................................................................-------.
ENSSSCP00000030152  ......................................................................-------.
ENSSSCP00000009595  ......................................................................-------.
ENSSSCP00000029508  ......................................................................-------.
ENSSSCP00000025452  ......................................................................------P.
ENSSSCP00000018516  ......................................................................---IHCP.
ENSSSCP00000030152  ......................................................................-------.
ENSSSCP00000017120  ......................................................................-------.
ENSSSCP00000029843  ......................................................................------Q.
ENSSSCP00000018545  ......................................................................------Q.
ENSSSCP00000030723  ......................................................................------Q.
ENSSSCP00000017138  ......................................................................----HCE.
ENSSSCP00000017718  ......................................................................---WHCA.
ENSSSCP00000022942  ......................................................................---LNSL.
ENSSSCP00000000030  ......................................................................-------.
ENSSSCP00000014445  ......................................................................-------.
ENSSSCP00000002645  ......................................................................-------.
ENSSSCP00000013927  ......................................................................-------.
ENSSSCP00000017120  ......................................................................------G.
ENSSSCP00000030683  ......................................................................-------.
ENSSSCP00000005408  ............ipttqqlnvdrvfalytdeekvlrfavtnqigpvegdsepapvnpcydgshtcattaq-------.
ENSSSCP00000012373  ......................................................................-------.
ENSSSCP00000023772  ......................................................................---LNSL.
ENSSSCP00000009595  ......................................................................-------.
ENSSSCP00000000011  ......................................................................----PCG.
ENSSSCP00000005017  ......................................................................-------.
ENSSSCP00000015165  ......................................................................-------.
ENSSSCP00000024250  ......................................................................-------.
ENSSSCP00000029508  ......................................................................-------.
ENSSSCP00000029508  ......................................................................-------.
ENSSSCP00000015505  ......................................................................-------.
ENSSSCP00000024250  ......................................................................-------.
ENSSSCP00000015165  ......................................................................-------.
ENSSSCP00000007665  ......................................................................-------.
ENSSSCP00000001667  ......................................................................-------.
ENSSSCP00000029843  ......................................................................-----CP.
ENSSSCP00000018545  ......................................................................-----CP.
ENSSSCP00000030723  ......................................................................-----CP.
ENSSSCP00000005017  ......................................................................-------.
ENSSSCP00000024250  ......................................................................-------.
ENSSSCP00000015165  ......................................................................-------.
ENSSSCP00000014445  ......................................................................-------.
ENSSSCP00000015165  ......................................................................---VNRL.
ENSSSCP00000015165  ......................................................................------H.
ENSSSCP00000024250  ......................................................................---VNRL.
ENSSSCP00000013809  ......................................................................-------.
ENSSSCP00000024250  ......................................................................------H.
ENSSSCP00000015165  ......................................................................------G.
ENSSSCP00000024250  ......................................................................------G.
ENSSSCP00000026721  ......................................................................-------.
ENSSSCP00000001667  ......................................................................-------.
ENSSSCP00000009595  ......................................................................-------.
ENSSSCP00000022942  ......................................................................-------.
ENSSSCP00000004554  ......................................................................-------.
ENSSSCP00000005181  ......................................................................-------.
ENSSSCP00000015165  ......................................................................-------.
ENSSSCP00000005017  ......................................................................-------.
ENSSSCP00000005017  ......................................................................---LNSL.
ENSSSCP00000005017  ......................................................................-------.
ENSSSCP00000024250  ......................................................................-------.
ENSSSCP00000014445  ......................................................................-----WQ.
ENSSSCP00000013792  ......................................................................-------.
ENSSSCP00000005017  ......................................................................-------.
ENSSSCP00000001667  ......................................................................-------.
ENSSSCP00000015165  ......................................................................-------.
ENSSSCP00000023772  ......................................................................-------.
ENSSSCP00000024250  ......................................................................-------.
ENSSSCP00000005017  ......................................................................-------.
ENSSSCP00000009507  ......................................................................-----CG.
ENSSSCP00000007874  ......................................................................-------.
ENSSSCP00000005017  ......................................................................-------.
ENSSSCP00000002566  ......................................................................-------.
ENSSSCP00000014416  ......................................................................-------.
ENSSSCP00000024250  ......................................................................-------.
ENSSSCP00000024250  ......................................................................------N.
ENSSSCP00000015165  ......................................................................------N.
ENSSSCP00000012319  ......................................................................-------.
ENSSSCP00000006447  ......................................................................---NRCA.
ENSSSCP00000011407  ......................................................................-----CPe
ENSSSCP00000001667  ......................................................................-------.
ENSSSCP00000023772  ......................................................................-------.
ENSSSCP00000005017  ......................................................................-------.
ENSSSCP00000023772  ......................................................................-------.
ENSSSCP00000007154  ......................................................................-------.
ENSSSCP00000028498  ......................................................................-------.
ENSSSCP00000001987  ......................................................................----VCV.
ENSSSCP00000000276  ......................................................................-------.
ENSSSCP00000013792  ......................................................................-------.
ENSSSCP00000002768  ......................................................................-------.
ENSSSCP00000025452  ......................................................................-----CP.
ENSSSCP00000020647  ......................................................................-----CQ.
ENSSSCP00000001049  ......................................................................-------.
ENSSSCP00000030663  ......................................................................-------.
ENSSSCP00000023772  ......................................................................-------.
ENSSSCP00000023563  ......................................................................-------.
ENSSSCP00000007530  ......................................................................-------.
ENSSSCP00000014445  ......................................................................-------.
ENSSSCP00000021308  ......................................................................-------.
ENSSSCP00000026405  ......................................................................-------.
ENSSSCP00000007154  ......................................................................-------.
ENSSSCP00000028139  ......................................................................-------.
ENSSSCP00000006106  ......................................................................-------.
ENSSSCP00000007154  ......................................................................-------.
ENSSSCP00000004772  ......................................................................-------.
ENSSSCP00000028139  ......................................................................-------.
ENSSSCP00000021312  ......................................................................------Q.
ENSSSCP00000023772  ......................................................................-------.
ENSSSCP00000008961  ......................................................................-------.
ENSSSCP00000029826  ......................................................................-------.
ENSSSCP00000023563  ......................................................................-------.
ENSSSCP00000027947  ......................................................................-----CV.
ENSSSCP00000021312  ......................................................................-------.
ENSSSCP00000016757  ......................................................................-----CPa
ENSSSCP00000006411  ......................................................................----RCP.
ENSSSCP00000030721  ......................................................................----RCP.
ENSSSCP00000022942  ......................................................................-------.
ENSSSCP00000028139  ......................................................................------A.
ENSSSCP00000005851  ......................................................................-------.
ENSSSCP00000020647  ......................................................................-------.
ENSSSCP00000000011  ......................................................................-------.
ENSSSCP00000011618  ......................................................................-------.
ENSSSCP00000002566  ......................................................................-------.
ENSSSCP00000005753  ......................................................................----ECG.
ENSSSCP00000024343  ......................................................................-------.
ENSSSCP00000024250  ......................................................................-------.
ENSSSCP00000015165  ......................................................................-------.
ENSSSCP00000025758  ......................................................................-------.
ENSSSCP00000007862  ......................................................................-------.
ENSSSCP00000013809  ......................................................................------S.
ENSSSCP00000009174  ......................................................................-------.
ENSSSCP00000017222  ......................................................................-------.
ENSSSCP00000001551  ......................................................................-------.
ENSSSCP00000030663  ......................................................................-------.
ENSSSCP00000001551  ......................................................................-------.
ENSSSCP00000007401  ......................................................................-------.
ENSSSCP00000028117  ......................................................................-------.
ENSSSCP00000014445  ......................................................................-----CE.
ENSSSCP00000006890  ......................................................................-------.
ENSSSCP00000021312  ......................................................................-------.
ENSSSCP00000018024  ......................................................................-------.
ENSSSCP00000006356  ......................................................................-------.
ENSSSCP00000028498  ......................................................................-------.
ENSSSCP00000014657  ......................................................................-------.
ENSSSCP00000007154  ......................................................................-------.
ENSSSCP00000007579  ......................................................................-------.
ENSSSCP00000005851  ......................................................................-------.
ENSSSCP00000007154  ......................................................................------A.
ENSSSCP00000021312  ......................................................................-------.
ENSSSCP00000004525  ......................................................................-------.
ENSSSCP00000005127  ......................................................................-------.
ENSSSCP00000013809  ......................................................................-------.
ENSSSCP00000012373  ......................................................................-------.
ENSSSCP00000013809  ......................................................................-------.
ENSSSCP00000006106  ......................................................................-------.
ENSSSCP00000007154  ......................................................................-------.
ENSSSCP00000020647  ......................................................................-------.
ENSSSCP00000007578  ......................................................................-------.
ENSSSCP00000007530  ......................................................................-------.
ENSSSCP00000027035  ......................................................................-------.
ENSSSCP00000001667  ......................................................................-------.
ENSSSCP00000022329  ......................................................................-------.
ENSSSCP00000023132  ......................................................................-------.
ENSSSCP00000020647  ......................................................................-------.
ENSSSCP00000014445  ......................................................................-------.
ENSSSCP00000021312  ......................................................................-------.
ENSSSCP00000017222  ......................................................................-------.
ENSSSCP00000012904  ......................................................................-------.
ENSSSCP00000002566  ......................................................................-------.
ENSSSCP00000002566  ......................................................................-------.
ENSSSCP00000000030  ......................................................................-------.
ENSSSCP00000001551  ......................................................................-------.
ENSSSCP00000026016  ......................................................................--AVDCPe
ENSSSCP00000017908  ......................................................................--AVDCPe
ENSSSCP00000027537  ......................................................................--AVDCPe
ENSSSCP00000010270  ......................................................................-------.
ENSSSCP00000017355  ......................................................................-------.
ENSSSCP00000020581  ......................................................................-------.
ENSSSCP00000002768  ......................................................................-------.
ENSSSCP00000007579  ......................................................................-------.
ENSSSCP00000012373  ......................................................................-------.
ENSSSCP00000027290  ......................................................................-------.
ENSSSCP00000020647  ......................................................................-------.
ENSSSCP00000010782  ......................................................................-----CG.
ENSSSCP00000023085  ......................................................................-------.
ENSSSCP00000006198  ......................................................................-------.
ENSSSCP00000002645  ......................................................................-------.
ENSSSCP00000009298  ......................................................................-------.
ENSSSCP00000014405  ......................................................................-------.
ENSSSCP00000014076  ......................................................................-------.
ENSSSCP00000000451  ......................................................................-------.
ENSSSCP00000001551  ......................................................................-------.
ENSSSCP00000021567  ......................................................................----RCG.
ENSSSCP00000029769  ......................................................................-------.
ENSSSCP00000030031  ......................................................................-------.
ENSSSCP00000003828  ......................................................................-------.
ENSSSCP00000011618  ......................................................................-------.
ENSSSCP00000014445  ......................................................................-------.
ENSSSCP00000009075  ......................................................................-------.
ENSSSCP00000006520  ......................................................................----SCV.
ENSSSCP00000022247  qervviaddlphpfgltqysdyiywtdwnlhsieradktsgrnrtliqghldfvmdilvfhssrqdglnd-------.
ENSSSCP00000013700  qervviaddlphpfgltqysdyiywtdwnlhsieradktsgrnrtliqghldfvmdilvfhssrqdglnd-------.
ENSSSCP00000028117  ......................................................................-------.
ENSSSCP00000015505  ......................................................................-------.
ENSSSCP00000019577  ......................................................................-------.
ENSSSCP00000012631  ......................................................................-------.
ENSSSCP00000025137  ......................................................................-------.
ENSSSCP00000027035  ......................................................................-------.
ENSSSCP00000003671  ......................................................................-------.
ENSSSCP00000028153  ......................................................................-------.
ENSSSCP00000026160  ......................................................................-------.
ENSSSCP00000007291  ......................................................................---THCP.
ENSSSCP00000020747  ......................................................................----TCH.
ENSSSCP00000015505  ......................................................................-------.
ENSSSCP00000016321  ......................................................................-------.
ENSSSCP00000008197  ......................................................................-------.
ENSSSCP00000009514  ......................................................................-----CQ.
ENSSSCP00000023658  ......................................................................-------.
ENSSSCP00000004152  ......................................................................-------.
ENSSSCP00000001540  ......................................................................------L.
ENSSSCP00000007291  ......................................................................--ASYCR.
ENSSSCP00000000030  ......................................................................-----CV.
ENSSSCP00000030683  ......................................................................-------.
ENSSSCP00000003769  ......................................................................-------.
ENSSSCP00000025638  ......................................................................----RCE.
ENSSSCP00000016321  ......................................................................----DCP.
ENSSSCP00000011522  ......................................................................-------.
ENSSSCP00000003272  ......................................................................-------.
ENSSSCP00000000911  ......................................................................-------.


                       10               20                           30                             
                        |                |                            |                             
d2dspb1               PCSE....EKLARCR...PPV...GCEE.....LVR...........EP..G....CG....C..CA...TCA.....
ENSSSCP00000006199  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000009595  TCVE....KTVLHDG...K-Cis.ECPG.....GYY...........AD..A....TG....R..CR...VCH.....
ENSSSCP00000009595  ----....--CEACH...PSC...LGCA.....GKS...........PQ..N....CT....A..CL...PSH.....
ENSSSCP00000030152  SCNA....CSGPLRT...DCL...QCMD.....GYV...........LQ..D....GT....C..VE...QCSpsfyr
ENSSSCP00000009595  SCNA....CSGPLRT...DCL...QCMD.....GYV...........LQ..D....GT....C..VE...QCSpsfyr
ENSSSCP00000029508  ----....-------...SSC...GDGF.....YNK...........QG..T....CS....A..CD...QSC.....
ENSSSCP00000025452  LCSS....EGCWGPE...PRD...CMSC.....RNF...........SR..G....KE....C..VE...KCN.....
ENSSSCP00000018516  PCSE....EKLARCR...PPV...GCEE.....LVR...........EP..G....CG....C..CA...TCA.....
ENSSSCP00000030152  ----....-----PF...SCS...SCDS.....NLV...........LS..H....LG....T..CSs..TCFpghyl
ENSSSCP00000017120  -CSN....DGCWGPG...PDQ...CLSC.....RRF...........SR..G....RT....C..IE...SCN.....
ENSSSCP00000029843  LCAH....GHCWGPG...PTQ...CVNC.....SQF...........LR..G....QE....C..VK...ECR.....
ENSSSCP00000018545  LCAH....GHCWGPG...PTQ...CVNC.....SQF...........LR..G....QE....C..VK...ECR.....
ENSSSCP00000030723  LCAH....GHCWGPG...PTQ...CVNC.....SQF...........LR..G....QE....C..VK...ECR.....
ENSSSCP00000017138  PCDE....KALSMCP...PSP...LGCE.....LVK...........EP..G....CG....C..CM...TCA.....
ENSSSCP00000017718  PCSA....ERLALCP...PVPa..SCPE.....ATR...........PA..G....CG....C..CP...TCA.....
ENSSSCP00000022942  LCDN....GRCWNSP...GSY...SCSC.....PQG...........FS..F....RQ....D..TE...TC-.....
ENSSSCP00000000030  ----....-------...---...----.....---...........TT..H....CG....D..VD...E--.....
ENSSSCP00000014445  ----....-------...FRC...ECPF.....GYS...........LDftG....VS....C..MD...TDE.....
ENSSSCP00000002645  ----....-------...-TC...NPGF.....TLN...........ED..G....RS....C..QD...VN-.....
ENSSSCP00000013927  ----....-------...---...--QL.....SAD...........RH..S....CQ....D..TD...EC-.....
ENSSSCP00000017120  RCH-....-------...KSCt..GRCW.....GPT...........EN..H....CQ....TltRT...VCA.....
ENSSSCP00000030683  ----....--C----...---...RPGF.....RLK...........DD..G....RT....C..AD...V--.....
ENSSSCP00000005408  -CHP....ATGV--D...YTC...ECAS.....GYQ...........GD..G....RR....C..VD...V--.....
ENSSSCP00000012373  -CWA....SPSRLCQ...HTC...ENTL.....GSY...........RC..S....CA....S..GF...V-L.....
ENSSSCP00000023772  LCDN....GRCWNSP...GSY...SCSC.....PQG...........FS..F....RQ....D..TE...TC-.....
ENSSSCP00000009595  ----....DHCDLCQ...---...--DS.....TKL...........LR..N....GR....C..VH...SCGlgf..
ENSSSCP00000000011  PGHM....CVNSLGS...FRC...ECKA.....GYY...........FD..GisrtCV....D..IN...ECR.....
ENSSSCP00000005017  -CGN....GTCRNTI...GSFnc.RCNH.....GFI...........LS..H....NN....D..CIdvdECA.....
ENSSSCP00000015165  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000024250  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000029508  ----....DHCDLCQ...---...--DS.....TKL...........LR..N....GR....C..VH...SCGlgf..
ENSSSCP00000029508  ----....-------...---...----.....GYY...........AD..A....TG....R..CR...VCH.....
ENSSSCP00000015505  ----....-------...---...----.....---...........--..-....--....C..DH...SCI.....
ENSSSCP00000024250  ----....-------...FRC...ECPM.....GYN...........LD..Y....TGvr..C..VD...TDE.....
ENSSSCP00000015165  ----....-------...FRC...ECPM.....GYN...........LD..Y....TGvr..C..VD...TDE.....
ENSSSCP00000007665  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000001667  ----....-------...---...DVDE.....CER...........ED..N....AG....C..VH...DCV.....
ENSSSCP00000029843  PCSPackaSHCW--G...ESSk..DCQS.....LTR...........TI..C....AG....G..CA...RCK.....
ENSSSCP00000018545  PCSPackaSHCW--G...ESSk..DCQS.....LTR...........TI..C....AG....G..CA...RCK.....
ENSSSCP00000030723  PCSPackaSHCW--G...ESSk..DCQS.....LTR...........TI..C....AG....G..CA...RCK.....
ENSSSCP00000005017  LCQN....GRCIPTPgs.YRC...ECNK.....GFQ...........LD..L....RG....E..CI...DVD.....
ENSSSCP00000024250  ----....-------...---...----.....---...........TK..Q....HN....C..QF...LCV.....
ENSSSCP00000015165  ----....-------...---...----.....---...........TK..Q....HN....C..QF...LCV.....
ENSSSCP00000014445  TC--....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000015165  LCDN....GLCRNTP...GSY...SCTC.....PPG...........YV..-....--....-..--...--F.....
ENSSSCP00000015165  PCGN....GTCKNTV...GSY...NCLCypgfeLTH...........NN..D....CL....D..ID...ECS.....
ENSSSCP00000024250  LCDN....GLCRNTP...GSY...SCTC.....PPG...........YV..-....--....-..--...--F.....
ENSSSCP00000013809  VCDN....GICNNTP...GSF...QCQC.....LSG...........YH..L....SR....D..RS...RCE.....
ENSSSCP00000024250  PCGN....GTCKNTV...GSY...NCLCypgfeLTH...........NN..D....CL....D..ID...ECS.....
ENSSSCP00000015165  RCIP....TVSS---...YRC...ECNM.....GYK...........QD..A....NG....D..CI...DVD.....
ENSSSCP00000024250  RCIP....TVSS---...YRC...ECNM.....GYK...........QD..A....NG....D..CI...DVD.....
ENSSSCP00000026721  ----....RACT---...ENH...ECCH.....PEC...........LG..S....CS....A..--...---.....
ENSSSCP00000001667  ----....-------...---...----.....---...........--..-....--....C..DH...ICV.....
ENSSSCP00000009595  ---T....CHGRGPF...SCS...SCDS.....NLV...........LS..H....LG....T..CSs..TCFpghyl
ENSSSCP00000022942  ----....-------...-SC...GQGY.....SLM...........PD..G....RA....C..AD...L--.....
ENSSSCP00000004554  DC--....DTCFNKN...FCT...KCKS.....GFY...........LH..L....GK....C..LD...NC-.....
ENSSSCP00000005181  ----....-------...---...----.....---...........--..R....CW....T..TN...RCQ.....
ENSSSCP00000015165  ----....-------...CSC...NPGY.....QAT...........PD..R....QG....C..TD...I--.....
ENSSSCP00000005017  ----....TDG---S...YRC...ECPF.....GYI...........LE..G....NE....C..VD...TDE.....
ENSSSCP00000005017  LCDN....GQCRNTP...GSF...VCT-.....---...........--..-....--....-..--...---.....
ENSSSCP00000005017  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000024250  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000014445  PCGN....GTCKNVV...GSYnc.LCFS.....GFV...........AA..H....SG....D..CVdmdECT.....
ENSSSCP00000013792  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000005017  ICDG....GQCTNIP...GEY...RCLC.....---...........--..-....--....-..--...---.....
ENSSSCP00000001667  ----....-------...---...----.....CER...........ED..N....AG....C..VH...DCV.....
ENSSSCP00000015165  ----....-------...--C...SCRE.....GWV...........GN..G....IK....C..ID...L--.....
ENSSSCP00000023772  ----....-------...---...----.....---...........--..E....CH....C..PP...GHA.....
ENSSSCP00000024250  ----....-------...--C...SCRE.....GWV...........GN..G....IK....C..ID...L--.....
ENSSSCP00000005017  VCTN....TAGS---...FKC...SCSP.....GWI...........GD..G....IK....C..TD...L--.....
ENSSSCP00000009507  PCEP....ATCPPLP...-PR...GCPL.....GET...........RD..A....CG....C..CP...VCA.....
ENSSSCP00000007874  ----....-------...---...----.....---...........--..F....--....-..--...---.....
ENSSSCP00000005017  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000002566  ----....-------...ASC...PTGL.....CLN...........TE..G....SF....T..CS...A--.....
ENSSSCP00000014416  ----....-------...---...----.....---...........VE..R....CW....T..HS...HCQ.....
ENSSSCP00000024250  -CTN....SEGS-YE...CSC...SEGY.....ALM...........PD..G....RS....C..AD...---.....
ENSSSCP00000024250  LCEN....GQCLNVP...GAY...RCEC.....EMG...........FT..P....AS....D..SR...SCQ.....
ENSSSCP00000015165  LCEN....GQCLNVP...GAY...RCEC.....EMG...........FT..P....AS....D..SR...SCQ.....
ENSSSCP00000012319  ----....-------...KAC...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000006447  RCRI....ENCDSCF...SKDfctKCKI.....GFY...........LH..R....GR....C..FE...EC-.....
ENSSSCP00000011407  RCEP....ARCA--P...PPG...HCEG.....GRV...........RD..A....CG....C..CE...VCG.....
ENSSSCP00000001667  TCDD....TEQG---...PRC...GCHV.....KFVlh.........TD..G....KT....C..IE...TCA.....
ENSSSCP00000023772  ----....-------...---...----.....--M...........--..-....--....-..--...---.....
ENSSSCP00000005017  ----....-------...-IC...GPGY.....QRR...........PD..G....EG....-..--...---.....
ENSSSCP00000023772  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000007154  ----....-------...NGG...TCID.....LVN...........HF..K....CS....C..PP...---.....
ENSSSCP00000028498  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000001987  PCHA....-------...-SC...ATCQ.....GPA...........PT..D....--....-..--...---.....
ENSSSCP00000000276  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000013792  ----....-------...---...---C.....AQA...........LH..D....CR....P..SQ...DCH.....
ENSSSCP00000002768  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000025452  KCDP....GCLN---...---...GSCW.....GAG...........KE..N....CQkl..T..KV...ICA.....
ENSSSCP00000020647  HGGT....CQGYMGG...YVC...ECPA.....GYT...........GD..N....CE....Dd.VD...ECA.....
ENSSSCP00000001049  --TH....SVCSACD...QSC...KTCT.....GPT...........HR..D....CE....Q..CE...VGW.....
ENSSSCP00000030663  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000023772  LCEN....GQCLNAP...GGY...RCEC.....---...........--..-....--....-..--...---.....
ENSSSCP00000023563  ----....-------...---...----.....---...........--..H....CS....E..TQ...VCH.....
ENSSSCP00000007530  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000014445  ----....------T...CRC...PPGF.....TQH...........HQ..A....CF....D..ND...ECL.....
ENSSSCP00000021308  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000026405  ----....-------...LPC...NEDG.....YLT...........CK..D....GQ....A..MF...TCIcks..
ENSSSCP00000007154  ----....-------...---...----.....---...........F-..-....--....-..--...---.....
ENSSSCP00000028139  ----....-FDDCA-...-SN...PCVH.....GVC...........VD..Gvn..RY....S..CV...CSP.....
ENSSSCP00000006106  ----....----RCL...PDC...GPGF.....QVA...........AD..G....AS....C..ED...V--.....
ENSSSCP00000007154  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000004772  --WP....CQCPRRK...PSC...PPGV.....SLV...........RD..G....CG....C..CK...ICA.....
ENSSSCP00000028139  RCEM....DINE---...---...----.....-CH...........SD..P....CQ....N..DA...TCL.....
ENSSSCP00000021312  HGGT....CQGYMGG...YVC...ECPA.....G--...........--..-....--....-..--...---.....
ENSSSCP00000023772  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000008961  ----....-------...---...----.....---...........-H..S....CR....A..DQ...VCI.....
ENSSSCP00000029826  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000023563  ----....-------...---...-PGY.....MLK...........DG..E....CT....D..VD...---.....
ENSSSCP00000027947  PCRP....EECA---...TPR...GCLA.....GQV...........HD..A....CG....C..CW...ECA.....
ENSSSCP00000021312  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000016757  VCEP....MRCPPLP...-SC...SAGT.....APV...........LD..R....CG....C..CR...VCA.....
ENSSSCP00000006411  PSCP....APCPKKP...PTC...APGV.....RAV...........LD..D....CS....C..CL...VCA.....
ENSSSCP00000030721  PSCP....APCPKKP...PTC...APGV.....RAV...........LD..D....CS....C..CL...VCA.....
ENSSSCP00000022942  -CEN....GQCLNAP...GGY...RCEC.....EMGfnpt.......ED..Q....RA....C..QD...VDE.....
ENSSSCP00000028139  PCSP....NPCENAA...-VC...KEAP.....NFE...........SY..T....C-....-..--...LCAp....
ENSSSCP00000005851  -CEE....NINECSS...SPC...LNKG.....TCV...........DG..L....AG....Y..RC...TCV.....
ENSSSCP00000020647  ---V....DECQLQP...NAC...HNGG.....TCF...........NT..L....GG....H..SC...VCVn....
ENSSSCP00000000011  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000011618  ----....-------...---...----.....---...........--..-....--....-..--...FCVp....
ENSSSCP00000002566  ----....-------...---...E---.....---...........--..-....--....-..--...---.....
ENSSSCP00000005753  PCRP....ERCP-AP...SRC...PAPG.....IAA...........LD..E....CG....C..CT...RCL.....
ENSSSCP00000024343  ----....-----TQ...FTC...ECSI.....GFR...........GD..G....RT....C..YD...I--.....
ENSSSCP00000024250  ----....-------...---...---F.....DQF...........SS..A....CH....D..VN...ECS.....
ENSSSCP00000015165  ----....-------...---...---F.....DQF...........SS..A....CH....D..VN...ECS.....
ENSSSCP00000025758  ----....-------...---...----.....---...........SF..S....CT....C..P-...--P.....
ENSSSCP00000007862  --TP....CACPWPP...PRC...PPGV.....PLV...........LD..G....CN....C..CR...VCA.....
ENSSSCP00000013809  NCRN....GVCENTR...GGY...RCAC.....TPP...........AE..Y....SP....A..QR...QCL.....
ENSSSCP00000009174  ----....-------...---...----.....---...........--..-....--....-..--...--V.....
ENSSSCP00000017222  -CES....YKDPCAN...ISC...LNGG.....TCD...........SE..G....LN....G..TC...VCAp....
ENSSSCP00000001551  ----....-------...---...----.....---...........--..-....--....-..-C...VCQp....
ENSSSCP00000030663  -CNI....AKNSSCL...PNP...CVNG.....GTC...........VG..S....-G....D..SF...SCIcrd..
ENSSSCP00000001551  --ST....CIDRVGS...FSC...LCPP.....GRT...........GL..L....CH....M..ED...MCL.....
ENSSSCP00000007401  ---A....CHCPLEA...PKC...APGV.....GLV...........GD..G....CG....C..CK...VCA.....
ENSSSCP00000028117  ----....-------...---...----.....---...........-A..G....CS....A..QA...RCVt....
ENSSSCP00000014445  LCPL....PGTSAHR...KLC...PHGS.....GYT...........AD..G....QD....-..--...---.....
ENSSSCP00000006890  ----....-------...---...----.....---...........WT..S....SH....C..QR...VCP.....
ENSSSCP00000021312  PCHH....G------...---...RCVD.....GIA...........SF..S....CA....C..AP...---.....
ENSSSCP00000018024  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000006356  --WP....CECPPSP...PRC...PLGV.....SLI...........TD..G....CE....C..CK...MCA.....
ENSSSCP00000028498  -CNI....AKNSSCL...PNP...CVNG.....GTC...........VG..S....-G....D..SF...SCIcrd..
ENSSSCP00000014657  ----....-------...---...----.....---...........LR..I....CK....S..HS...ICI.....
ENSSSCP00000007154  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000007579  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000005851  ----....------P...TGT...YTEY.....LHS...........RS..S....SE....C..KA...QC-.....
ENSSSCP00000007154  PCSP....NPCENAA...-VC...KEAP.....NFE...........SY..T....C-....-..--...LCAp....
ENSSSCP00000021312  PCTF....GLCRDGL...NRY...D---.....---...........--..-....CV....C..QP...---.....
ENSSSCP00000004525  QCAA....GKA----...PRC...PAGV.....SLV...........LD..G....CG....C..CR...VCA.....
ENSSSCP00000005127  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000013809  SCPD....SKCE---...---...----.....--N...........KP..G....SF....K..CI...ACPpgyr.
ENSSSCP00000012373  ----....-------...---...----.....---...........--..-....--....-..--...-CA.....
ENSSSCP00000013809  ICGH....GECVPGP...SDY...SCHC.....NPG...........YR..S....HP....Q..HR...YCVdvn..
ENSSSCP00000006106  ----....-------...-LC...PAGY.....RLL...........PS..G....--....-..--...---.....
ENSSSCP00000007154  ----....------P...NAC...QNGG.....TCT...........NR..N....GG....Y..GC...VCVn....
ENSSSCP00000020647  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000007578  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000007530  ----....-------...NRG...SCKE.....TSL...........GF..E....CE....C..SP...---.....
ENSSSCP00000027035  ----....-------...-CQ...PCPR.....GTY...........QP..E....AG....-..--...---.....
ENSSSCP00000001667  ----....-------...-CQ...PCPR.....GTY...........QP..E....AG....-..--...---.....
ENSSSCP00000022329  ----....-------...---...----.....---...........M-..-....--....-..--...---.....
ENSSSCP00000023132  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000020647  ----....-------...--C...LHGG.....ICT...........AA..H....PG....F..RC...ACPe....
ENSSSCP00000014445  ----....-------...--S...GFSH.....NSA...........LL..V....CE....D..VD...ECA.....
ENSSSCP00000021312  PCAP....SPCR---...---...--NG.....GTC...........RQ..S....GD....L..TY...DCAclp..
ENSSSCP00000017222  ----....---PCAS...SPC...QNNG.....TC-...........--..-....--....-..--...---.....
ENSSSCP00000012904  -C--....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000002566  -CDN....GRCVRVR...EGYtc.DCFE.....GFQ...........LD..T....--....A..QM...ACV.....
ENSSSCP00000002566  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000000030  ----....-------...---...ACPV.....GTYqp.........EP..G....RT....G..CF...SCR.....
ENSSSCP00000001551  ----....--HPCES...RPC...QHGA.....TCV...........AQ..P....NG....Y..LC...QCAp....
ENSSSCP00000026016  RCDT....NECK---...-SS...LRCK.....RTV...........LD..D....CG....C..CR...VCA.....
ENSSSCP00000017908  RCDT....NECK---...-SS...LRCK.....RTV...........LD..D....CG....C..CR...VCA.....
ENSSSCP00000027537  RCDT....NECK---...-SS...LRCK.....RTV...........LD..D....CG....C..CR...VCA.....
ENSSSCP00000010270  ----....-------...---...----.....---...........--..-....-G....C..EQ...RCL.....
ENSSSCP00000017355  RCET....EVDACHP...SPC...QHGG.....RCE...........ND..G....GA....Y..LC...VCPe....
ENSSSCP00000020581  ----....-------...---...----.....---...........-D..V....GS....C..TL...VCPpnnqe
ENSSSCP00000002768  -CL-....-------...---...----.....---...........PD..P....CH....S..--...---.....
ENSSSCP00000007579  ----....-------...---...----.....---...........--..Q....CL....D..LD...ECE.....
ENSSSCP00000012373  ----....-------...---...----.....---...........DG..E....CT....D..VD...---.....
ENSSSCP00000027290  ----....-------...---...----.....--A...........LR..V....CS....S..CHs..SCY.....
ENSSSCP00000020647  PCHS....GPCA---...GRG...VCQS.....SVV...........AG..T....AR....F..SC...RCP.....
ENSSSCP00000010782  QCKG....QQPCTVA...EGR...CLTC.....EPG...........WN..G....TK....C..DQ...PCSt....
ENSSSCP00000023085  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000006198  ----....-VCRRCD...ESC...LSCE.....GS-...........SR..N....CS....R..CK...TGF.....
ENSSSCP00000002645  ----....-------...---...----.....ATD...........SH..Q....CN....P..TQ...ICI.....
ENSSSCP00000009298  -CDV....SRCP---...-SP...RCRG.....GYV...........PD..L....CN....C..CL...VCA.....
ENSSSCP00000014405  QCTN....SLGS---...YSC...SCHV.....GFTst.........NS..I....CE....D..VD...ECA.....
ENSSSCP00000014076  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000000451  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000001551  ----....-------...YNC...TCPT.....GYT...........GP..T....CReevtA..CH...SAP.....
ENSSSCP00000021567  QCKG....QQPCTVA...EGR...CLTC.....EPG...........WN..G....TK....C..DQ...PCSt....
ENSSSCP00000029769  ECVE....EADGRVS...CRC...TEGF.....RLA...........ED..G....RS....C..ED...PCA.....
ENSSSCP00000030031  ----....----TCE...PGC...KFGE.....CVG...........PN..K....CR....C..FP...---.....
ENSSSCP00000003828  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000011618  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000014445  ----....-----CV...CPS...GFNF.....DQA...........LG..G....CQ....D..VD...ECA.....
ENSSSCP00000009075  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000006520  PCGA....NQMQDAGgtsCVC...LPGF.....QMI...........SN..N....GG....P..DI...ICK.....
ENSSSCP00000022247  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000013700  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000028117  ----....-------...HVC...RCSE.....GYQ...........GD..G....IH....C..LD...I--.....
ENSSSCP00000015505  ----....-------...---...----.....-CL...........RD..N....GG....C..QH...SCV.....
ENSSSCP00000019577  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000012631  -CTP....RPC----...-LH...DGKC.....VVD...........PT..S....RG....H..RC...VCSp....
ENSSSCP00000025137  -CTP....RPC----...-LH...DGKC.....VVD...........PT..T....RG....H..RC...VCSp....
ENSSSCP00000027035  TCDD....TEQG---...PRC...GCHV.....KFVlh.........TD..G....KT....C..IE...TCA.....
ENSSSCP00000003671  FCGK....NIQELCM...-PC...PSNS.....FSS...........TS..G....QK....A..CN...VCR.....
ENSSSCP00000028153  --WP....CECPPSP...PRC...PLGV.....SLI...........TD..G....CE....C..CK...MCA.....
ENSSSCP00000026160  --WP....CECPPSP...PRC...PLGV.....SLI...........TD..G....CE....C..CK...MCA.....
ENSSSCP00000007291  PCNP....GFFKTNS...STCe..PCPY.....GSY...........SN..G....SD....C..S-...---.....
ENSSSCP00000020747  PCPQ....NAYCVNG...TYC...TCSH.....GYKsesgqiyftfpLE..T....CK....D..ID...ECK.....
ENSSSCP00000015505  ----....-------...---...----.....---...........AD..G....FA....P..CQ...LCA.....
ENSSSCP00000016321  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000008197  ----....-------...---...----.....---...........-S..G....EG....S..CQ...TCP.....
ENSSSCP00000009514  VCRP....GFFKASP...HSQ...SCS-.....---...........--..-....--....-..--...---.....
ENSSSCP00000023658  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000004152  ----....-------...---...---S.....GNV...........WD..Q....AS....C..HSpt.ECL.....
ENSSSCP00000001540  TCDE....AICA---...KPCq..NGGV.....CVR...........PD..Q....CE....C..AP...---.....
ENSSSCP00000007291  PCAL....EASDLGS...SCT...SCPA.....GYY...........ID..Rd...SG....T..CH...SCP.....
ENSSSCP00000000030  PCAP....GTYQ---...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000030683  ----....-------...---...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000003769  ----....-------...--S...----.....---...........--..-....--....-..--...---.....
ENSSSCP00000025638  SCEP....GWNGTQC...HQP...CPPG.....TFG...........ES..C....RQ....Q..CP...HC-.....
ENSSSCP00000016321  PCNP....GFFNNGS...SSCh..PCPP.....GMF...........SD..G....TK....E..CR...PCP.....
ENSSSCP00000011522  ---S....CTCPNDQ...VVC...TTFL.....PCT...........VG..D....AA....A..CL...TCA.....
ENSSSCP00000003272  ----....-----CA...QGC...VNGS.....CVE...........PD..H....CR....C..HF...---.....
ENSSSCP00000000911  ----....CEYSNGT...ASC...VCKA.....GYE...........GD..G....SL....C..--...---.....


                        40                                                    50                  60
                         |                                                     |                   |
d2dspb1               ...LG.L.G.....M........P........CGV.....................YTPRCGS.........GL.RCY
ENSSSCP00000006199  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000009595  ...NS.C.-.....A........S........CSGpras.................HCTACTHpqalr....QG.HCL
ENSSSCP00000009595  ...VL.L.D.....G........Q........CLSqcpdgyfs.............QEGSCTE.........--.---
ENSSSCP00000030152  ..dSG.L.C.....K........S........CGS.....................HCLQCQG.........PH.VCT
ENSSSCP00000009595  ..dSG.L.C.....K........S........CGS.....................HCLQCQG.........PH.VCT
ENSSSCP00000029508  ...--.-.-.....K........S........CGP.....................RSPRC--.........-L.TCV
ENSSSCP00000025452  ...VL.E.G.....E........PrefvenaeCVQ.....................CHPECLPqak......NV.TCM
ENSSSCP00000018516  ...LG.K.G.....M........P........CGV.....................YTPRCGS.........GL.RCY
ENSSSCP00000030152  .gdNR.A.C.....Q........P........CDM.....................HCRSCDS.........QA.SCT
ENSSSCP00000017120  ...LY.D.G.....EfrefengsI........CVE.....................CDPQCEKmedg.....IL.TCH
ENSSSCP00000029843  ...VQ.Q.G.....H........P........REYv....................KDRYCLPc........HP.ECQ
ENSSSCP00000018545  ...VQ.Q.G.....H........P........REYv....................KDRYCLPc........HP.ECQ
ENSSSCP00000030723  ...VQ.Q.G.....H........P........REYv....................KDRYCLPc........HP.ECQ
ENSSSCP00000017138  ...LA.E.G.....Q........S........CGV.....................YTERCAQ.........GL.RCL
ENSSSCP00000017718  ...LP.L.G.....A........A........CGV.....................ATARCAR.........GL.SCR
ENSSSCP00000022942  ...--.-.-.....-........-........-ED.....................ID-----.........--.ECL
ENSSSCP00000000030  ...--.-.-.....-........-........CSM.....................NNGSCDQgcvntkg..SY.ECV
ENSSSCP00000014445  ...CS.I.G.....H........P........CGE.....................G--TCTNvig......GF.ECA
ENSSSCP00000002645  ...--.-.-.....-........-........---.....................---ECAT.........EN.PCV
ENSSSCP00000013927  ...--.L.G.....T........P........CQ-.....................--QRCKNsig......SY.RCS
ENSSSCP00000017120  ...EQ.C.D.....G........R........CYGpy...................VSDCCHRec.......AG.GCS
ENSSSCP00000030683  ...--.-.-.....-........-........---.....................-D-ECST.........TF.PCS
ENSSSCP00000005408  ...--.-.-.....N........E........CAT.....................GFHRCGP.........NS.VCV
ENSSSCP00000012373  ...AA.D.G.....K........H........CED.....................-------.........VN.ECE
ENSSSCP00000023772  ...--.-.-.....-........-........-ED.....................ID-----.........--.ECL
ENSSSCP00000009595  ...YQ.A.G.....A........F........CLAcqp..................QCSTCSS.........GL.ECS
ENSSSCP00000000011  ...RY.P.G.....R........L........CGHkcentpgsyycsctigfrlssD------.........--.---
ENSSSCP00000005017  ...TG.N.G.....N........L........CRNgqcintvgs............F------.........--.QCQ
ENSSSCP00000015165  ...--.-.-.....-........-........---.....................--CICKP.........--.---
ENSSSCP00000024250  ...--.-.-.....-........-........---.....................--CICKP.........--.---
ENSSSCP00000029508  ...YQ.A.G.....A........F........CLAcqp..................QCSTCSS.........GL.ECS
ENSSSCP00000029508  ...NS.C.-.....A........S........CSGpras.................HCTACTHpqalr....QG.HCL
ENSSSCP00000015505  ...NR.P.G.....Sfac.....A........CNAgytly................GFTHCGD.........TD.ECS
ENSSSCP00000024250  ...CS.I.G.....N........P........CGN.....................--GTCTNvig......SF.ECN
ENSSSCP00000015165  ...CS.I.G.....N........P........CGN.....................--GTCTNvig......SF.ECN
ENSSSCP00000007665  ...--.-.-.....-........-........--A.....................TCESCFS.........QD.FCI
ENSSSCP00000001667  ...NI.P.G.....N........-........---.....................-------.........-Y.RCT
ENSSSCP00000029843  ...GP.L.P.....T........D........CCH.....................--EQCAA.........G-.-CT
ENSSSCP00000018545  ...GP.L.P.....T........D........CCH.....................--EQCAA.........G-.-CT
ENSSSCP00000030723  ...GP.L.P.....T........D........CCH.....................--EQCAA.........G-.-CT
ENSSSCP00000005017  ...EC.E.K.....N........P........CAGgecinnqgs............YTCQCRP.........GY.QST
ENSSSCP00000024250  ...NT.L.G.....Gf.......T........CKCppgftq...............HHTACID.........NN.ECG
ENSSSCP00000015165  ...NT.L.G.....Gf.......T........CKCppgftq...............HHTACID.........NN.ECG
ENSSSCP00000014445  ...--.-.-.....-........-........---.....................LPGTCQNleg......SF.RCI
ENSSSCP00000015165  ...RT.E.T.....E........T........CED.....................-------.........IN.ECE
ENSSSCP00000015165  ...SF.F.G.....Q........V........CRN.....................--GRCFNeig......SF.KCL
ENSSSCP00000024250  ...RT.E.T.....E........T........CED.....................-------.........IN.ECE
ENSSSCP00000013809  ...D-.-.-.....-........-........---.....................-IDECDF.........PA.ACI
ENSSSCP00000024250  ...SF.F.G.....Q........V........CRN.....................--GRCFNeig......SF.KCL
ENSSSCP00000015165  ...EC.T.S.....N........P........CTNgdc..................V-----Ntpg......SY.YCK
ENSSSCP00000024250  ...EC.T.S.....N........P........CTNgdc..................V-----Ntpg......SY.YCK
ENSSSCP00000026721  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000001667  ...NT.P.G.....Sfqc.....L........CHHgylly................GVTHCGD.........VD.ECS
ENSSSCP00000009595  .gdNR.A.C.....Q........P........CDM.....................HCRSCDS.........QA.SCT
ENSSSCP00000022942  ...--.-.-.....D........E........CEL.....................GGHSCDS.........HA.SCL
ENSSSCP00000004554  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000005181  ...KM.C.P.....S........V........CGK.....................R--ACTE.........NH.ECC
ENSSSCP00000015165  ...--.-.-.....D........E........CMI.....................MNGGCDTqctnseg..SY.ECS
ENSSSCP00000005017  ...CS.V.G.....N........P........CGN.....................--GTCKNvig......GF.ECT
ENSSSCP00000005017  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000005017  ...--.-.-.....-........-........---.....................-KCICKP.........--.---
ENSSSCP00000024250  ...--.-.-.....-........-........---.....................EERNCTD.........ID.ECR
ENSSSCP00000014445  ...TM.A.G.....Q........V........CRFgqclntags............F------.........--.HCL
ENSSSCP00000013792  ...--.-.-.....-........-........---.....................DVNECDM.........GA.PCE
ENSSSCP00000005017  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000001667  ...NI.P.G.....-........-........---.....................-------.........NY.RCT
ENSSSCP00000015165  ...--.-.-.....D........E........CSN.....................GTHQCSI.........NA.QCV
ENSSSCP00000023772  ...LA.M.G.....T........A........CED.....................ID-----.........--.ECS
ENSSSCP00000024250  ...--.-.-.....D........E........CSN.....................GTHQCSI.........NA.QCV
ENSSSCP00000005017  ...--.-.-.....D........E........CSN.....................GTHMCSQ.........HA.DCK
ENSSSCP00000009507  ...RG.E.G.....E........P........CGGgga..................GRGHCAP.........GM.ECV
ENSSSCP00000007874  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000005017  ...--.-.-.....-........-........---.....................----CTD.........ID.ECR
ENSSSCP00000002566  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000014416  ...KV.C.P.....T........I........CKS.....................HG--CTA.........EG.LCC
ENSSSCP00000024250  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000024250  ...DI.-.-.....-........-........---.....................--DECSF.........QN.ICV
ENSSSCP00000015165  ...DI.-.-.....-........-........---.....................--DECSF.........QN.ICV
ENSSSCP00000012319  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000006447  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000011407  ...AP.E.G.....A........E........CGL.....................QEGPCGE.........GL.QCV
ENSSSCP00000001667  ...VN.N.G.....-........-........--G.....................CDSKCHDaat......GV.HCS
ENSSSCP00000023772  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000005017  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000023772  ...--.-.-.....-........-........---.....................---ECAD.........PV.NCI
ENSSSCP00000007154  ...GT.R.G.....L........L........CEE.....................NIDDCAR.........GP.HCL
ENSSSCP00000028498  ...--.-.-.....-........-........CEReldecasspc...........HGGFCQDlvd......GF.RCH
ENSSSCP00000001987  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000000276  ...RR.E.G.....Q........Q........CGV.....................YTPNCAP.........GL.QCQ
ENSSSCP00000013792  ...NL.P.G.....S........-........---.....................YQCTCPD.........GY.RKI
ENSSSCP00000002768  ...--.-.-.....-........-........CEReldecasspc...........HGGFCQDlvd......GF.RCH
ENSSSCP00000025452  ...QQ.C.S.....G........R........CRG.....................RS----P.........SX.GCT
ENSSSCP00000020647  ...SQ.-.-.....-........-........---.....................---PCQH.........NG.TCV
ENSSSCP00000001049  ...VQ.E.D.....D........A........CVDvdecaa...............ETPPCGD.........GQ.YCE
ENSSSCP00000030663  ...--.-.-.....-........H........CEReldecasspc...........HGGFCQDlvd......GF.RCH
ENSSSCP00000023772  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000023563  ...NL.P.G.....S........Yr.......CDC.....................-------.........--.---
ENSSSCP00000007530  ...--.-.G.....Q........N........CDInind.................CLGQCQN.........GA.SCR
ENSSSCP00000014445  ...AQ.P.G.....-........-........---.....................---PCGP.........RG.RCH
ENSSSCP00000021308  ...--.-.-.....-........-........---.....................----CNDlki......GY.ECL
ENSSSCP00000026405  ...GW.E.G.....E........K........CEL.....................DINECKDpani.....NG.GCS
ENSSSCP00000007154  ...--.D.G.....V........H........CEN.....................-------.........--.---
ENSSSCP00000028139  ...GF.T.G.....Q........R........CNIdidec................ASNPCRK.........GA.TCI
ENSSSCP00000006106  ...--.-.-.....D........E........CLE.....................QMDECHP.........NQ.ICE
ENSSSCP00000007154  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000004772  ...KQ.P.G.....D........T........CNE.....................AD-VCDPhk.......GL.YCD
ENSSSCP00000028139  ...DK.I.G.....-........-........--G.....................FTCLCMPgfk......GV.HCE
ENSSSCP00000021312  ...-Y.T.G.....D........N........CEDdvdec................ASQPCQH.........GG.FCI
ENSSSCP00000023772  ...--.-.-.....-........-........---.....................---NCTD.........ID.ECH
ENSSSCP00000008961  ...NL.R.G.....S........-........---.....................FTCQCPPgyqkr....GE.QCV
ENSSSCP00000029826  ...--.-.-.....-........-........---.....................---ICKS.........HS.ICI
ENSSSCP00000023563  ...--.-.-.....-........E........CEL.....................GTHSCQV.........GF.TCQ
ENSSSCP00000027947  ...NL.E.G.....Q........L........CDLdpsah................FYGSCGE.........QL.ECR
ENSSSCP00000021312  ...--.-.G.....A........H........CQHeadpclsrpcl..........HGGICTAahp......GF.RCA
ENSSSCP00000016757  ...AA.E.G.....E........A........CGAa....................LRRPCAP.........GL.QCL
ENSSSCP00000006411  ...RQ.R.G.....E........S........CSV.....................ML-PCEEsr.......GL.FCD
ENSSSCP00000030721  ...RQ.R.G.....E........S........CSV.....................ML-PCEEsr.......GL.FCD
ENSSSCP00000022942  ...CV.L.G.....N........L........C--.....................VFGICENlpg......MF.RCV
ENSSSCP00000028139  ...GW.Q.G.....Q........R........CSVd....................ID-----.........--.ECI
ENSSSCP00000005851  ...K-.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000020647  ...GW.T.G.....E........S........CSQniddc................ATAVCFH.........GA.TCH
ENSSSCP00000000011  ...N-.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000011618  ...GY.Q.G.....R........H........CDLevdec................VSDPCKN.........EA.TCL
ENSSSCP00000002566  ...--.-.-.....-........-........CDQgyimv................RKGHCQD.........IN.ECR
ENSSSCP00000005753  ...GS.E.G.....A........S........CGGr....................AGTRCGP.........GL.VCA
ENSSSCP00000024343  ...--.-.-.....N........E........CSE.....................QPAVCGS.........HA.ICN
ENSSSCP00000024250  ...SS.K.-.....N........P........CNY.....................GCSNTEG.........GY.LCG
ENSSSCP00000015165  ...SS.K.-.....N........P........CNY.....................GCSNTEG.........GY.LCG
ENSSSCP00000025758  ...GF.Y.G.....R........I........CELsamac................ADGPCFN.........GG.RCS
ENSSSCP00000007862  ...RR.L.G.....E........P........CDH.....................LH-ICDSsq.......GL.VCQ
ENSSSCP00000013809  ...SP.E.E.....M........-........---.....................DVDECQD.........PT.ACR
ENSSSCP00000009174  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000017222  ...GF.T.G.....E........D........CDI.....................DINECDS.........N-.---
ENSSSCP00000001551  ...GF.T.G.....P........R........CEEdinec................RSSPCAN.........GG.QCQ
ENSSSCP00000030663  ...GW.E.G.....R........T........CTH.....................NTNDCNP.........-L.PC-
ENSSSCP00000001551  ...S-.-.-.....-........-........---.....................--QPCHG.........EA.QCS
ENSSSCP00000007401  ...KQ.L.N.....E........D........CSK.....................TQ-PCDHtk.......GL.ECN
ENSSSCP00000028117  ...EG.E.D.....A........T........CQC.....................LKGFAGD.........GN.LCS
ENSSSCP00000014445  ...--.-.V.....D........E........CHV.....................FAHLCPH.........G-.ECI
ENSSSCP00000006890  ...CP.R.G.....L........A........CTV.....................RGECCHT.........EC.---
ENSSSCP00000021312  ...GY.T.G.....T........R........CESqvdec................RSQPCRH.........GG.KC-
ENSSSCP00000018024  ...NY.T.G.....E........L........CDEvidhcvp..............GMNLCQHeakcvsldrGF.RCD
ENSSSCP00000006356  ...QQ.L.G.....D........N........CTE.....................AA-TCDPhr.......GL.YCD
ENSSSCP00000028498  ...GW.E.G.....R........T........CTH.....................NTNDCNP.........-L.PC-
ENSSSCP00000014657  ...NT.Q.G.....S........-........---.....................-------.........--.---
ENSSSCP00000007154  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000007579  ...--.-.-.....-........-........---.....................---PCRG.........GA.TCV
ENSSSCP00000005851  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000007154  ...GW.Q.G.....Q........R........CSVd....................ID-----.........--.ECI
ENSSSCP00000021312  ...GF.T.G.....P........L........CNMeinec................ASSPCGE.........GG.SCV
ENSSSCP00000004525  ...KQ.L.G.....E........L........CTE.....................RD-PCDPhk.......GL.FCD
ENSSSCP00000005127  ...--.-.-.....-........-........--Lhisdcarspca..........HGGTCHDlet......GF.VCT
ENSSSCP00000013809  ...SQ.G.G.....G........A........CRA.....................DVNECAE.........GN.PCS
ENSSSCP00000012373  ...QG.A.G.....V........L........CTFrcinvp...............G------.........SY.QCA
ENSSSCP00000013809  ...EC.E.A.....E........P........CGA.....................GRGICMNtgg......SY.NCH
ENSSSCP00000006106  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000007154  ...GW.S.G.....D........D........CSEniddc................AFASCTP.........GS.TCI
ENSSSCP00000020647  ...-T.T.G.....P........L........CNMeinec................ASSPCGE.........GG.SCV
ENSSSCP00000007578  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000007530  ...GW.T.G.....P........T........CSTniddcspnncs..........HGGTCQDlvn......GF.KCV
ENSSSCP00000027035  ...RT.L.C.....F........P........CGGglttkhegav...........SFQDCDT.........KV.QCS
ENSSSCP00000001667  ...RT.L.C.....F........P........CGGglttkhegav...........SFQDCDT.........KV.QCS
ENSSSCP00000022329  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000023132  ...--.-.G.....P........T........CAE.....................EKGPCQP.........N-.---
ENSSSCP00000020647  ...GF.T.G.....A........Q........CQTlvdwc................S------.........--.---
ENSSSCP00000014445  ...SG.E.-.....-........-........---.....................--SPCQQ.........NA.NCI
ENSSSCP00000021312  ...GF.E.G.....Q........N........CEVnvddc................PGHRCLN.........GG.TCV
ENSSSCP00000017222  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000012904  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000002566  ...DV.N.-.....-........E........CDDlngpaalc.............VHGHCENteg......SY.RCH
ENSSSCP00000002566  ...--.-.-.....-........-........---.....................---ECAV.........TD.RCL
ENSSSCP00000000030  ...GG.-.-.....-........-........--Lltkhegta.............SFQDCEA.........KV.HCS
ENSSSCP00000001551  ...GY.S.G.....Q........N........CSEepdac................QSQPCHN.........HG.TCT
ENSSSCP00000026016  ...AG.L.G.....E........T........CYRtvsgm................DGVKCGP.........GL.RCQ
ENSSSCP00000017908  ...AG.L.G.....E........T........CYRtvsgm................DGVKCGP.........GL.RCQ
ENSSSCP00000027537  ...AG.L.G.....E........T........CYRtvsgm................DGVKCGP.........GL.RCQ
ENSSSCP00000010270  ...NT.L.G.....S........-........---.....................YKCSCDP.........GY.---
ENSSSCP00000017355  ...GF.F.G.....Y........H........CETvsdpc................FSSPCGG.........RG.YCL
ENSSSCP00000020581  vtaED.G.T.....Q........R........CEK.....................CSKPCAQ.........GT.QC-
ENSSSCP00000002768  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000007579  ...GQ.G.A.....R........R........CG-.....................-------.........--.---
ENSSSCP00000012373  ...--.-.-.....-........E........CEL.....................GTHSCQV.........GF.TCQ
ENSSSCP00000027290  ...TC.R.G.....-........-........---.....................-------.........--.---
ENSSSCP00000020647  ...RGfR.G.....P........D........CSLpdpc.................LSSPCAH.........GA.RCS
ENSSSCP00000010782  ...GF.Y.G.....E........G........CGH.....................RCPPCRD.........GH.SCN
ENSSSCP00000023085  ...--.-.-.....-........-........CAT.....................NASICGD.........EA.RCV
ENSSSCP00000006198  ...TQ.L.G.....T........S........CIT.....................NH-TC--.........--.---
ENSSSCP00000002645  ...NT.E.G.....-........-........---.....................-------.........--.---
ENSSSCP00000009298  ...AV.E.G.....E........P........CVRp....................VDSPCGE.........SL.EC-
ENSSSCP00000014405  ...NP.R.-.....-........-........---.....................---ACPE.........HA.SCR
ENSSSCP00000014076  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000000451  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000001551  ...CL.N.G.....G........S........CSPspgg.................YSCTCPPsht......GL.HCQ
ENSSSCP00000021567  ...GF.Y.G.....E........G........CGH.....................RCPPCRD.........GH.SCN
ENSSSCP00000029769  ...HA.PcE.....Q........-........---.....................---QCEPggpq.....GY.SCH
ENSSSCP00000030031  ...GY.T.G.....K........T........CSQ.....................DVNECGVk........PR.PCQ
ENSSSCP00000003828  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000011618  ...--.-.-.....-........-........---.....................-------.........--.ECS
ENSSSCP00000014445  ...-G.R.G.....S........P........CSY.....................---SCANtpg......GF.LCG
ENSSSCP00000009075  ...--.-.-.....-........-........CGIlngc.................ENGRCVRvqe......GY.TCD
ENSSSCP00000006520  ...K-.-.-.....-........-........CPEs....................MKGVTED.........GW.NCI
ENSSSCP00000022247  ...--.-.-.....-........-........---.....................-------.........--.-C-
ENSSSCP00000013700  ...--.-.-.....-........-........---.....................-------.........--.-C-
ENSSSCP00000028117  ...--.-.-.....D........E........CQL.....................GVHTCGE.........NA.TCT
ENSSSCP00000015505  ...NL.M.G.....-........-........---.....................-------.........--.---
ENSSSCP00000019577  ...-R.D.G.....D........E........CSR.....................NSTPCGA.........SS.ACT
ENSSSCP00000012631  ...SW.Q.G.....Q........D........CSVdvnec................LSNPCPP.........--.---
ENSSSCP00000025137  ...SW.Q.G.....Q........D........CSVdvnec................LSNPCPP.........--.---
ENSSSCP00000027035  ...VN.N.-.....-........-........---.....................-------.........--.---
ENSSSCP00000003671  ...KC.E.GvfrtkK........E........CSStsn..................AVCECVP.........GF.RCL
ENSSSCP00000028153  ...QQ.L.G.....D........N........CX-.....................-------.........--.---
ENSSSCP00000026160  ...QQ.L.G.....D........N........CX-.....................-------.........--.---
ENSSSCP00000007291  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000020747  ...PP.I.N.....I........Y........CGV.....................NA-KCQNteg......SF.YCH
ENSSSCP00000015505  ...LG.T.F.....Q........-........---.....................-------.........--.---
ENSSSCP00000016321  ...-Q.S.G.....S........S........CV-.....................---PCPP.........GH.---
ENSSSCP00000008197  ...A-.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000009514  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000023658  ...--.-.-.....-........-........---.....................-------.........--.KCA
ENSSSCP00000004152  ...RQ.-.-.....A........Q........CGQ.....................DF-QCKE.........--.---
ENSSSCP00000001540  ...GW.G.G.....R........H........CHV.....................DVDECRT.........GVtLCS
ENSSSCP00000007291  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000000030  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000030683  ...--.-.-.....-........-........---.....................--SICGD.........EA.RCV
ENSSSCP00000003769  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000025638  ...-R.L.G.....E........A........CQP.....................DTGHCQScdpgrl...GL.RCE
ENSSSCP00000016321  ...--.-.-.....-........-........---.....................-------.........--.---
ENSSSCP00000011522  ...PD.N.R.....T........R........CG-.....................---ACNT.........GY.---
ENSSSCP00000003272  ...GF.V.G.....R........N........CST.....................EC-RCNR.........HS.ECA
ENSSSCP00000000911  ...-S.E.T.....D........P........CSGl....................TPGGCSR.........NA.ECI


                                70                80         90                                     
                                 |                 |          |                                     
d2dspb1               PPRGV.EKP.LHTL...MHG....Q.GVCME.LAE--------ieaiqesl...........................
ENSSSCP00000006199  -----.---.----...---....-.--C--.-----------vtlcpagfyadesqknclkchpsckkcvdepekct
ENSSSCP00000009595  PSCGE.GF-.----...YPD....H.GVCK-.-----------achpscltcvg........................
ENSSSCP00000009595  -----.---.----...---....-.-----.-----------chptcrqchgpldsdclschphvplaggtcrtsck
ENSSSCP00000030152  R----.---.----...---....-.-----.-----------cegpflllearcvqecgkgyfadhanhkctacprg
ENSSSCP00000009595  R----.---.----...---....-.-----.-----------cegpflllearcvqecgkgyfadhanhkctacprg
ENSSSCP00000029508  EKT--.---.----...---....-.-----.-----------vlhdgkcisecpggyyadatgrcrvchnsc.....
ENSSSCP00000025452  GRGPD.SCV.RCAH...YID....G.PHCVK.-----------tcpagiagenstliwkfadanhvchlchpnctygc
ENSSSCP00000018516  PPRGV.EKP.LHTL...MHG....Q.GLCME.-----------la.................................
ENSSSCP00000030152  SCRDP.NKV.LLFG...DCQ....H.ESCA-.-----------pqyyldlssktckecdwsc................
ENSSSCP00000017120  GPGPD.NCT.KCSH...FKD....G.PNC--.-----------vekcpdglqgansfifkyadedrechpchpnctqg
ENSSSCP00000029843  PQNGS.DTC.FGSE...ADQ....C.VACAH.YKDPPF-----cvarcpsgvkpdlsfmpiwkfpdedgmcqpcpinc
ENSSSCP00000018545  PQNGS.DTC.FGSE...ADQ....C.VACAH.YKDPPF-----cvarcpsgvkpdlsfmpiwkfpdedgmcqpcpinc
ENSSSCP00000030723  PQNGS.DTC.FGSE...ADQ....C.VACAH.YKDPPF-----cvarcpsgvkpdlsfmpiwkfpdedgmcqpcpinc
ENSSSCP00000017138  PRRTN.EVP.LEAG...VEG....A.GSCIC.KE---------kq.................................
ENSSSCP00000017718  ALPGE.PRP.LHAL...TRG....Q.GACMP.A----------psae...............................
ENSSSCP00000022942  SNPCV.NG-.----...---....-.-VCRN.LAGSYAC----ecapgsrlgpsgtvcldvnecevfpgvctnghcln
ENSSSCP00000000030  CPP--.---.----...---....-.-----.-----------grrlhwnqkdcvetgkc..................
ENSSSCP00000014445  CADGF.EPG.PMMT...CED....I.DEC--.-----------slnpllcafrchnsegsymctcptgytlredgamc
ENSSSCP00000002645  QTC--.---.--VN...TYG....S.FICRC.-----------dpgyeleddgvhcsdmdecsfseflcqhecvnqpg
ENSSSCP00000013927  CRTGF.HLHgNRHS...CVD....V.NECRR.PLE--------rrvchhschntvgsflctcrpgfrlradrvscea.
ENSSSCP00000017120  GPKDT.DCF.ACMN...FND....S.GACVT.QC---------pqtfvynpttfqlehnfnakytygafcvkkcphnf
ENSSSCP00000030683  QRCIN.T--.----...-HG....S.YKCLC.VEGY-------aprggdphsckavtdeepflifanryylrklnldg
ENSSSCP00000005408  NLPGS.YR-.----...---....-.--CQC.RSG--------yefvddrhtcvliapppnpcedgshnc........
ENSSSCP00000012373  AQRCS.QE-.-CAN...IYG....S.YQCYC.-----------rqgyqlaedghtcididec................
ENSSSCP00000023772  SNPCV.NG-.----...---....-.-VCRN.LAGSYAC----ecapgsrlgpsgtvcldvnecevfpgvctnghcln
ENSSSCP00000009595  SCRPP.---.---L...LMQ....H.GQCVS.T----------cgngfyqdhhscaachescaacwgps.........
ENSSSCP00000000011  -----.---.----...---....-.-----.-----------grscedvnechsspcsqecanvygsyqcycrrgyq
ENSSSCP00000005017  CNEG-.---.----...---....-.-----.-----------yevapdgrtcvd.......................
ENSSSCP00000015165  -----.---.----...---....-.-----.-----------gfvlapngryctdvdecqtpgicmnghcinnegsf
ENSSSCP00000024250  -----.---.----...---....-.-----.-----------gfvlapngryctdvdecqtpgicmnghcinnegsf
ENSSSCP00000029508  SCRPP.---.---L...LMQ....H.GQCVS.T----------cgngfyqdhhscaachesc................
ENSSSCP00000029508  PSCGE.GF-.----...YPD....H.GVCK-.-----------achpscltcvgpepshctqcmkpeeglqveslsgt
ENSSSCP00000015505  VHNGG.CQQ.VCVN...TVG....G.YECQC.LSGH-------tlhwngkdcv.........................
ENSSSCP00000024250  CNEGF.EPG.PMMN...CED....I.NECA-.-----------qnpllcafrcmntfgsyectcpigyalredqkmck
ENSSSCP00000015165  CNEGF.EPG.PMMN...CED....I.NECA-.-----------qnpllcafrcmntfgsyectcpigyalredqkmck
ENSSSCP00000007665  QCKR-.---.----...---....-.-----.-----------rfylykgkclptcppgttaqqsarecqanpidece
ENSSSCP00000001667  CYDGF.---.----...---....-.-----.-----------hlahdghncldvdecaegtggcqqscvnmmgsyec
ENSSSCP00000029843  GPKHS.DCL.ACFH...FNH....S.GICEL.HCP--------alvtyntdtfesmpnpegrytfgascvtacpynyl
ENSSSCP00000018545  GPKHS.DCL.ACFH...FNH....S.GICEL.HCP--------alvtyntdtfesmpnpegrytfgascvtacpynyl
ENSSSCP00000030723  GPKHS.DCL.ACFH...FNH....S.GICEL.HCP--------alvtyntdtfesmpnpegrytfgascvtacpynyl
ENSSSCP00000005017  LTRTE.CR-.----...---....-.-----.-----------dideclqngricnngrcintdgsfhcvcnagfhvt
ENSSSCP00000024250  SQPSL.C--.----...-GA....K.GICQN.TPGSFSCE---cqrgfsldatglncedvdecdgn............
ENSSSCP00000015165  SQPSL.C--.----...-GA....K.GICQN.TPGSFSCE---cqrgfsldatglncedvdecdgn............
ENSSSCP00000014445  CPPGF.QV-.----...--Q....S.DHCVD.-----------idecseepnlclfgtctnspgsfqclcppgfvlsd
ENSSSCP00000015165  SNP--.---.----...---....-.-----.-----------cvngacrnnlgsfncecspgsklsstglicidslk
ENSSSCP00000015165  CNEGY.---.----...---....-.-----.-----------eltpdgkncid........................
ENSSSCP00000024250  SNP--.---.----...---....-.-----.-----------cvngacrnnlgsfncecspgsklsstglicidslk
ENSSSCP00000013809  GGDCI.NT-.----...-NG....S.YRCLC.PQGHR------lvggrkcqdidecsqdpglclphgacenlqgsyvc
ENSSSCP00000024250  CNEGY.---.----...---....-.-----.-----------eltpdgkncid........................
ENSSSCP00000015165  CHAGF.QR-.----...---....-.-----.-----------tptkqacidideciqngvlckngrcvntdgsfqci
ENSSSCP00000024250  CHAGF.QR-.----...---....-.-----.-----------tptkqacidideciqngvlckngrcvntdgsfqci
ENSSSCP00000026721  -----.---.----...---....-.-----.-----------pdndtacvacrhyyyagvcvpscppntyrfegwrc
ENSSSCP00000001667  I----.---.----...---....-.-----.-----------nrggcrfgcintpgsyqctcpgqgrlhwngkdcae
ENSSSCP00000009595  -----.---.----...---....-.-----.-----------scr................................
ENSSSCP00000022942  NIPGS.FS-.----...---....-.--CRC.-----------qpgwvgdgfechdrdecafqehgcspradclnipg
ENSSSCP00000004554  -----.---.----...---....-.-----.-----------pegleannhtmecvsivh.................
ENSSSCP00000005181  HPECL.GS-.-CSA...PDN....D.TAC--.-----------vacrhyyyagvcvpscppntyrfegwrcvdrdfca
ENSSSCP00000015165  CSEGY.---.----...---....-.-----.-----------almpdgrscadidecennpdic.............
ENSSSCP00000005017  CEEGF.EPG.PMMT...CED....I.NECAQ.-----------npllcafrcvntygsyeckcptgyvlredrrmckd
ENSSSCP00000005017  -----.---.----...---....-.-----.-----------cpkgfiykpdlktcedidecesspcingvcknspg
ENSSSCP00000005017  -----.---.----...---....-.-----.-----------gfqlasdgryckdinecetsgicmngrcvntdgsy
ENSSSCP00000024250  ISPDL.C--.----...--G....S.GICVN.TPGSFEC----ecfegyesgfmmmkncmdidecernpllcrggtcv
ENSSSCP00000014445  CQDGF.---.----...---....-.-----.-----------eltndgkncmd........................
ENSSSCP00000013792  QRCFN.SY-.----...--G....T.FLCRC.HQGY-------elhrdgfscsdidecsyssylcqyrcvnepgrfsc
ENSSSCP00000005017  -----.---.----...---....-.-----.-----------ydgfmasedmktcvdvnecdlnpniclsgtcentk
ENSSSCP00000001667  CYDGF.---.----...---....-.-----.-----------hlahdghncldvdecvegtdnchidaicqntprsy
ENSSSCP00000015165  NTPGS.YR-.----...---....-.--CAC.-----------segftgdgftcsdvdecaeninlcengqclnvpga
ENSSSCP00000023772  LSDGL.---.----...-CP....H.GHCVN.VIGAFQC----schhgfqstadlqgcvdvneceenpdicdngqctn
ENSSSCP00000024250  NTPGS.YR-.----...---....-.--CAC.-----------segftgdgftcsdvdecaeninlcengqclnvpga
ENSSSCP00000005017  NTMGS.YR-.----...---....-.--CLC.KEG--------ytgdgftctdldecsenlnlcgngqclnapggyrc
ENSSSCP00000009507  KSRKR.RKG.KAGA...AAGgpgvS.GVCVC.KSRYPVCGSDG...................................
ENSSSCP00000007874  -----.---.----...---....-.-----.-----------crcragfvlqqdqrscraidycsfgnhscqhecvn
ENSSSCP00000005017  ISPDL.C--.----...--G....R.GQCVN.TPGDFEC----kcdegyesgfmmmkncmdidecqrdpllcrggvcl
ENSSSCP00000002566  -----.---.----...---....-.-----.-----------cesgywvnedgtacedldecafpgvcpsgvcanta
ENSSSCP00000014416  HSECL.G--.----...---....-.-----.-----------ncsepddptkcvacrnfyldgrcvetcpppyyhfq
ENSSSCP00000024250  -----.---.----...---....-.-----.-----------idecennpdicdggqctnipgeyrclcydgfmasm
ENSSSCP00000024250  FGTCN.NL-.----...-PG....M.FHCIC.-----------ddgyeldrtggnctdidecadpincvnglcvntpg
ENSSSCP00000015165  FGTCN.NL-.----...-PG....M.FHCIC.-----------ddgyeldrtggnctdidecadpincvnglcvntpg
ENSSSCP00000012319  -----.---.----...---....-.-----.-----------lgcmgagpgrckkcspgyqqvgskcldvdecetav
ENSSSCP00000006447  -----.---.----...---....-.-----.-----------pdgfapldetmecvegcevghwsewgtcsrnn...
ENSSSCP00000011407  VPFGV.PAS.ATVR...RRA....QaGLCVC.ASNEPVCGSD-...................................
ENSSSCP00000001667  CPVGF.---.--ML...QPD....R.KTC--.-----------kdidecrlnnggcdhicrntvgsfecsckkgykll
ENSSSCP00000023772  -----.---.----...---....-.-----.-----------vgadgrfcfyinecalnpdicangmcenlrgsyrc
ENSSSCP00000005017  -----.---.----...---....-.-----.-----------cvdenecqtkpgicengrclntrgsytcecndgft
ENSSSCP00000023772  NGLCV.NT-.----...-PG....S.YQCNC.PQ---------dfelnpsgvgcvdidecqelpglcqggdcvntfgs
ENSSSCP00000007154  -----.---.----...--N....G.GQCVD.RIG--------gyscrclpgfagercegdinec.............
ENSSSCP00000028498  CPQGF.SGP.LCEV...---....-.-----.-----------didfcepspcqngapcynlegdyycacpdhvsgkn
ENSSSCP00000001987  -----.---.----...---....-.-----.-----------cltcpshasldpveqtcs.................
ENSSSCP00000000276  PPEED.QAP.LRAL...LLG....R.GRCRR.-----------a..................................
ENSSSCP00000013792  GPECV.DID.ECRY...RYC....Q.HRCVN.LPGSFR-----cqcepgfqlgpnnrscv..................
ENSSSCP00000002768  CPQGF.SGP.LCEV...---....-.-----.-----------didfcepspcqngapcynlegdyycacpdhvsgkn
ENSSSCP00000025452  GPRES.DCL.VCRR...FRD....E.ATCKD.T----------cpplmlynpttyqmdvnplgysfgatcvkkcprny
ENSSSCP00000020647  -----.---.----...---....-.-----.-----------dlvggfrcscppgytglrceadinec.........
ENSSSCP00000001049  NSRGA.F--.----...---....-.-----.-----------tcedcdatcvgctgkgpegckecvpgyskdsgqct
ENSSSCP00000030663  CPQGF.SGP.LC--...---....-.-----.-----------evdidfcepspcqngapcynlegdyycacpdhvsg
ENSSSCP00000023772  -----.---.----...---....-.-----.-----------emgfnptedqracqdvdecvlgnlcvfgicenlpg
ENSSSCP00000023563  -----.---.----...---....-.-----.-----------kagfqrdafgrtcidvnecwaspsrlcqhtcentl
ENSSSCP00000007530  DLVNG.YRC.VCPP...GYA....G.-----.-----------dhcetdidecssnpclngghcqneinrfqclcptg
ENSSSCP00000014445  NSPGS.FN-.----...---....-.--CEC.-----------yqgftldssgrgckdvdecdgphrcqhgcqnelgg
ENSSSCP00000021308  CPEGF.QLV.DKHR...CED....I.DECQ-.-----------dpdacsqicvnlegsykcqceegfqlepltkacka
ENSSSCP00000026405  QICDN.TP-.----...--G....S.YHCSC.KS---------gfimlsnkkdckdvdecsvkpsicgtavcknipgd
ENSSSCP00000007154  -----.---.----...---....-.-----.-----------nidectesscfnggtcvdglnsfsclcpvgftgpf
ENSSSCP00000028139  NDVNG.FRC.MCPE...GPH....H.PSCY-.-----------sqvnecl............................
ENSSSCP00000006106  NTPGG.HR-.----...---....-.--CSC.-----------prgyriqgpglpcldineclqlprtcayqchnlqg
ENSSSCP00000007154  -----.---.----...---....-.GQCVD.KVNRFQC----lcppgftgpvcqididdcsstpclngakcidhpng
ENSSSCP00000004772  YSADG.PW-.----...-YE....T.GVCA-.-----------ylv................................
ENSSSCP00000028139  LEINE.CQ-.-SNP...CVN....S.GQCVD.KVNRFQC----lcppgftgpvcqididdc.................
ENSSSCP00000021312  -----.---.----...---....-.-----.-----------dlvarylcscppgtlgvlceineddc.........
ENSSSCP00000023772  ISPDL.C--.----...--G....Q.GTCVN.TPGSFEC----ecfhgyesgfmlilpdvdecardpllcrggtctnt
ENSSSCP00000008961  DVDEC.SI-.----...---....-.-----.-----------ppychqrcvntpgsfycqcspgfqlaannytcvdi
ENSSSCP00000029826  N----.---.----...---....-.-----.-----------tqgsytcqclpgfklnprdpklctdvnectlgsnp
ENSSSCP00000023563  NTKGS.FY-.----...CQP....R.QRCM-.-----------dgflqdpegncvdinectslsepcqpgfscvntvg
ENSSSCP00000027947  LDTGG.DL-.-SRG...EVP....E.PLCAC.RSQRPLCGSDG...................................
ENSSSCP00000021312  CPEGF.TG-.----...---....-.-----.-----------aqcqtlvdwcsrvpcqnggrcaragasfyclcppg
ENSSSCP00000016757  APPSP.RL-.--LG...SSG....L.GTCRCpAAGAAVCGSDG...................................
ENSSSCP00000006411  RRADP.SA-.----...--Q....T.GICM-.AIEGDNCVFDG...................................
ENSSSCP00000030721  RRADP.SA-.----...--Q....T.GICM-.AIEGDNCVFDG...................................
ENSSSCP00000022942  CDEGY.EL-.----...DRS....G.GNC--.-----------tdvnecadpvncinglcvntpgsyqcncpqdf...
ENSSSCP00000028139  SKPCM.NHG.LCHN...TQG....S.YMCE-.-----------cppgfsgmdceediddc..................
ENSSSCP00000005851  -----.---.----...---....-.-----.-----------gymglhcetevnecqsnpclnnaacedqlggfmck
ENSSSCP00000020647  DRVAS.---.----...---....-.-----.-----------fycacpmgktgllchlddacvsnpchedaicdtnp
ENSSSCP00000000011  -----.---.----...---....-.-----.-----------tlgsfrcrpklqcksgfiqdalgncidineclsis
ENSSSCP00000011618  NEI--.---.----...--G....R.YTCLC.PHN--------ysgvnceleveecwsqpclngatcrdaagsyacdc
ENSSSCP00000002566  HPGTC.---.----...---....-.-----.-----------pdgrcvnspgsytclpceegyrgqsgscvdvnec.
ENSSSCP00000005753  SRAAG.TA-.----...PEG....T.GLCVC.AQRGTVCGSDG...................................
ENSSSCP00000024343  NHPGT.FRC.ECVEgyrFSE....E.GTCVA.VVDQ-------rpinycetglhdcdiperaqciylggalytcsclp
ENSSSCP00000024250  CPPGY.YR-.----...-VG....Q.GHC--.-----------v..................................
ENSSSCP00000015165  CPPGY.YR-.----...-VG....Q.GHC--.-----------v..................................
ENSSSCP00000025758  DNPEG.GY-.----...---....-.-TCRC.-----------pggfsgfncekkmdsctsspcsngaqcvdlgdayl
ENSSSCP00000007862  LGAGP.GS-.----...--R....G.AVCLW.GE---------ddgscevn...........................
ENSSSCP00000013809  HGRCV.NL-.----...-PG....S.YRCEC.R----------ppwvpgpsgrdcql.....................
ENSSSCP00000009174  -----.---.----...---....-.-----.-----------ndgagshhcecyegyilnedkktcsvrnkcalgsh
ENSSSCP00000017222  -----.---.---P...CHH....A.GTCLD.QPNGYTCH---cphgwvgancei.......................
ENSSSCP00000001551  DQPGS.FHC.EC--...---....-.-----.-----------lpgfegprcqtevdecl..................
ENSSSCP00000030663  -----.---.----...-YN....G.GVCVD.GVNWFRCE---capgfagpdcrinidecqsspcaygatcvdeingy
ENSSSCP00000001551  TNPLT.GS-.----...--T....L.CLCQP.GYTGPTCH---qdldecqmaqqgpspcehggsclntpgsfeclcpp
ENSSSCP00000007401  FGASP.TA-.----...--Q....K.GICRA.QSEGRPCEYN-...................................
ENSSSCP00000028117  DIDEC.ELG.TSVC...PPT....S.SECIN.TEGG-------hvcrcsegyqgdgihcldidecqlgvhtc......
ENSSSCP00000014445  NSLGS.FR-.----...---....-.-----.-----------chcqagyapdtaatacldvdecsqapppcpflckn
ENSSSCP00000006890  -----.---.----...---....-.-----.-----------lggcsrpedpracvacrhlyfqgachrtcppgtyq
ENSSSCP00000021312  -----.---.----...---....-.-----.-----------ldlvdkylcrcppgttgvncevniddc........
ENSSSCP00000018024  CPPGY.SG-.----...---....-.-----.-----------klcevdnddctahrcrhgaqcvdavngytcicpqg
ENSSSCP00000006356  YSGDR.PR-.----...-YA....V.GVCAQ.V----------vg.................................
ENSSSCP00000028498  -----.---.----...-YN....G.GVCVD.GVNWFRCE---capgfagpdcrinidecqsspcaygatcvdeingy
ENSSSCP00000014657  -----.YI-.----...---....-.--CQC.-----------lpgfklnprdpklctdvnectpgsnpchnsthcfn
ENSSSCP00000007154  -----.---.----...---....-.-----.Q----------vneclsnpcihgnctgglsgykclcdagwvgince
ENSSSCP00000007579  PVQ--.---.----...---....-.-----.-----------lgkdfrchcppgyqldltgrdcvdvdecqdapctq
ENSSSCP00000005851  -----.---.----...---....-.-----.-----------kqgtyssngletcescplgsyqpafgsrgclscpe
ENSSSCP00000007154  SKPCM.NHG.LCHN...TQG....S.YMCE-.-----------cppgfsgmdceediddc..................
ENSSSCP00000021312  DGENG.FRC.LCP-...---....-.-----.-----------pgslpplclppshpcaqepcshgvchdapggfrcv
ENSSSCP00000004525  FGSPA.NR-.----...--K....I.GVCT-.AKDGAPCVFGG...................................
ENSSSCP00000005127  CPAGF.SGR.RCEV...RIP....T.EAC--.-----------asgpclngatcytglppdnfvcncpygfvgsrce.
ENSSSCP00000013809  PGWCE.NL-.----...-PG....S.FRCTC.AQGY-------apspdgrscldvdec....................
ENSSSCP00000012373  C----.---.----...---....-.-----.-----------pergytmtangrsckdldecalgthncseaetchn
ENSSSCP00000013809  CNRGY.RL-.--HV...GAG....G.RSCV-.-----------dlnecskphlcgdggfcinfpghykcncypgyrlk
ENSSSCP00000006106  -----.---.----...---....-.-----.-----------kncqdineceedgiecgpsqmcfntrgsyqcvdtp
ENSSSCP00000007154  DRVAS.F--.----...---....-.-----.-----------scmcpegkagllchlddacisnpchkgalcdtnpl
ENSSSCP00000020647  DGENG.FRC.LCP-...---....-.-----.-----------pgslpplclppshpcaqepcshgvchdapggfrcv
ENSSSCP00000007578  -----.---.----...---....-.-T---.-----------cfceagyrlaadghrcedvddcaevpspcpqscvn
ENSSSCP00000007530  CPPQW.TG-.----...---....-.-----.-----------ktcqldaneceakpcvnakscknliasyycdclpg
ENSSSCP00000027035  PGHYY.NT-.----...--S....I.HRC--.-----------ircavgsyqpdfrqnfctrcpg.............
ENSSSCP00000001667  PGHYY.NT-.----...--S....I.HRC--.-----------ircav..............................
ENSSSCP00000022329  -----.---.----...---....-.-----.-----------tlfscpdidecsqsppvcgphsicknlpgryrcsc
ENSSSCP00000023132  --PCHgAAP.CHVL...PQG....E.AQCEC.-----------prgrggslcqtaserddamqpfladfnsfsylelk
ENSSSCP00000020647  -----.---.----...---....-.-----.-----------rvpcqnggrcaragasfyclcppgwsgrlcdiqsl
ENSSSCP00000014445  NIPGS.YR-.----...---....-.--CKC.A----------rgyklspdgac........................
ENSSSCP00000021312  DGVNT.YNC.----...---....-.-----.-----------qcppewtgqfctedvdecqlqpnachnggtcfntl
ENSSSCP00000017222  -----.---.----...---....-.-----.-----------yadglhfgcscsagftgpacaqlvdfcalspcahg
ENSSSCP00000012904  -----.---.----...---....-.-----.-----------edteagprclcpspglrlapngracididectsdk
ENSSSCP00000002566  CPP--.---.----...---....-.-----.-----------gyvaeagpphct.......................
ENSSSCP00000002566  RGQCV.NT-.----...-EG....S.FNCL-.-----------cetgfqpspeseecvdidkcedsgdsacgawrcen
ENSSSCP00000000030  PGHHY.NT-.----...--T....T.HRC--.-----------ircpvgtyqpefgqnhcitcpgntstdfdgstnvt
ENSSSCP00000001551  PKPGG.FH-.----...---....-.--C--.-----------acppgfvglrcegdvdecldrpchptgtaachsla
ENSSSCP00000026016  FYSEE.DD-.---F...GDE....F.GICK-.-----------d..................................
ENSSSCP00000017908  FYSEE.DD-.---F...GDE....F.GICK-.-----------d..................................
ENSSSCP00000027537  FYSEE.DD-.---F...GDE....F.GICK-.-----------d..................................
ENSSSCP00000010270  -----.---.----...---....-.-----.-----------elapdkrrceaacggfltklngsitspgwpkeypp
ENSSSCP00000017355  ASNGS.HS-.----...---....-.--CTC.KV---------gftgkdcak..........................
ENSSSCP00000020581  -----.---.----...---....-.-----.-----------...................................
ENSSSCP00000002768  -----.---.----...---....R.GRCYD.LVNDFYCACD-dgwkgktchsresqcdaytcgnggtcydsgdtfrc
ENSSSCP00000007579  -----.---.----...---....-.-----.-----------glclntegsfrcgclpgwelapdgvsct.......
ENSSSCP00000012373  NTKGS.FY-.----...CQP....R.QRCM-.-----------dgflqdpegncvdinectslsepcqpgfscvntvg
ENSSSCP00000027290  -----.---.----...---....-.-----.-----------sspldctsclppstldeqrgsc.............
ENSSSCP00000020647  VGSDG.RY-.----...---....-.-ICSC.-----------ppgyqgrscrsdvdecrvggpcrhggtclntpgsf
ENSSSCP00000010782  HVTGK.---.----...---....-.-----.-----------ctrcnagwigdrcetkcsngtygedcafvcadcgs
ENSSSCP00000023085  RTEKA.AY-.----...---....-.--CAC.RS---------gfhtvpgqpgcqdineclrfgtcsqlcnntkgghl
ENSSSCP00000006198  -----.---.----...---....-.-----.-----------snadet.............................
ENSSSCP00000002645  -----.---.----...---....-.-----.-----------gytcsctdgywllegqcldi...............
ENSSSCP00000009298  -----.---.----...--A....R.GVCRC.RWAHAVCGTDG...................................
ENSSSCP00000014405  NSVGS.YS-.----...---....-.--CVC.K----------sgfes..............................
ENSSSCP00000014076  -----.---.----...---....-.-----.---------R-rmdirrisfdtedlsddvipladvrsavaldwdsr
ENSSSCP00000000451  -----.---.----...--G....S.YKCLC.VE---------gyaprggdphsckavtdeepflifanryylrklnl
ENSSSCP00000001551  TSIDH.CA-.-SAP...CLN....G.GTCVN.RPGAP------sclcapgfqgprce.....................
ENSSSCP00000021567  HVTG-.---.----...---....-.-----.-----------kctrcnagwigdrcetkcsngtygedcafvcadcg
ENSSSCP00000029769  CRLGF.RP-.---A...EDE....P.HRCVD.-----------tdecqiagvcqqmcvnyvggfecycsegheleadg
ENSSSCP00000030031  HRC--.---.--VN...THG....S.YKCFC.LSGHM------lmpdatcsnsrtcavtscqygcedteagprclcps
ENSSSCP00000003828  -----.---.----...---....-.-----.-N---------gyyradldpldmpcttipsapqavissvnetslml
ENSSSCP00000011618  SSPCK.NGG.TCEN...LTG....N.YTCRC.LFD--------shsgaffggrdcsdallgctdhpclssglciphlr
ENSSSCP00000014445  CPQGY.FR-.----...-AG....Q.GHCVS.-----------glgfhpgpqd.........................
ENSSSCP00000009075  CFDGY.HL-.----...---....-.-----.-----------dmakmtcvdvnecdelnnrmslcknakcintegsy
ENSSSCP00000006520  SCPDG.LT-.----...--A....E.GKCHC.PTGH-------ilverdvngtllsqatcklcddsensftvanalgt
ENSSSCP00000022247  -----.---.----...---....-.-----.-----------mhnngqcgqlclavpsghrcscashytldpssrnc
ENSSSCP00000013700  -----.---.----...---....-.-----.-----------mhnngqcgqlclavpsghrcscashytldpssrnc
ENSSSCP00000028117  NTEGN.YT-.----...---....-.--CTC.A----------grpsepgricpdptppshlgedgrysvvdsyacng
ENSSSCP00000015505  -----.---.----...---....-.-----.-----------syecrckegfflsdnqhtcihhsegtsalpgfsps
ENSSSCP00000019577  N----.---.----...---....-.-----.-----------llgkyncsclpgfs.....................
ENSSSCP00000012631  -----.-LA.TCNN...TQG....S.FTCRC.PV---------gyqlekgicnlvrtfmtefklkktflnttmeqhad
ENSSSCP00000025137  -----.-LA.TCNN...TQG....S.FTCRC.PV---------gyqlekgicnlvrtfmtefklkktflnttmeqhad
ENSSSCP00000027035  -----.---.----...---....-.-----.-----------ggcdskchdaatgvhcscpvgfmlqpdrktckg..
ENSSSCP00000003671  G----.---.----...---....-.-----.-----------agcamceeycqqgqeltqegckdcsfgtfndeehg
ENSSSCP00000028153  -----.---.----...---....-.-----.-----------g..................................
ENSSSCP00000026160  -----.---.----...---....-.-----.-----------g..................................
ENSSSCP00000007291  -----.---.----...---....-.-----.-----------hcpa...............................
ENSSSCP00000020747  CITGY.---.----...---....-.-----.-----------rll................................
ENSSSCP00000015505  -----.---.----...---....-.-----.-----------peagrtsclpcggglptkrlgatsfqdcetrvqcs
ENSSSCP00000016321  -----.-Y-.----...---....-.-----.-----------ieketnqckecppdtylsihqvygkeacipcgpgs
ENSSSCP00000008197  -NS--.---.-QSN...TIG....S.SVCQC.RIG--------yfrartdsrgapcttppsaprsvvsrlngsslrle
ENSSSCP00000009514  KCPPH.SY-.--TH...EEA....S.TSCVC.EKDY-------frresdpptmactrppsaprnaisnvnetsvflew
ENSSSCP00000023658  KCPPH.SS-.--TH...EDG....S.VNCRC.E----------nnyfradkdppsmactrppsaprnvisninetsvi
ENSSSCP00000004152  -----.---.----...---....T.GRCLK.-----------rhlvcngdrdcldgsdeddcedvrifeddcsqydp
ENSSSCP00000001540  HRCHN.TA-.----...---....-.-----.-----------gsftcgcphglvlgpdgrtcaegasepptsasils
ENSSSCP00000007291  -----.---.----...---....-.-----.-----------pntilkahqpygaqacircgpgtksnkihslcynd
ENSSSCP00000000030  -----.---.----...---....-.-----.-----------drdgqlsctrcpssdglglagarnvsecggqcspg
ENSSSCP00000030683  RTEKA.AY-.----...---....-.--CAC.RS---------gfhtvpgqpgcqdineclrfgtcsqlcnntkgghl
ENSSSCP00000003769  -----.---.----...---....-.-----.-----------pclecpahtlpssegataceceegyfrapqdplsm
ENSSSCP00000025638  DPCPT.GTF.GEDC...GST....C.PTCV-.-----------qgacdavtgecvcntgywgpscniscpsgfhgnnc
ENSSSCP00000016321  -----.---.----...---....-.-----.-----------ag.................................
ENSSSCP00000011522  -----.---.----...---....-.-----.-----------mlsqglckp..........................
ENSSSCP00000003272  GVGAR.DH-.----...---....C.LLC--.-----------hnhtkgshceqclplfvgsavgggtcrpchafc..
ENSSSCP00000000911  KTGR-.---.----...--G....T.HTCVC.HQG--------wtgdgrdcsaintcllpraggchhnatclyvgpgq


                                                                                                    
                                                                                                    
d2dspb1               ..............................................................................
ENSSSCP00000006199  vckegfslargscipdcepgtyfdseqircgechhtcqtcvg....................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000009595  eeqflnlvgycadchplcqhca........................................................
ENSSSCP00000030152  clqcs.........................................................................
ENSSSCP00000009595  clqcs.........................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000025452  vgpglegc......................................................................
ENSSSCP00000018516  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000017120  csgptshdc.....................................................................
ENSSSCP00000029843  thscvdlddkgc..................................................................
ENSSSCP00000018545  thscvdlddkgc..................................................................
ENSSSCP00000030723  thscvdlddkgc..................................................................
ENSSSCP00000017138  ..............................................................................
ENSSSCP00000017718  ..............................................................................
ENSSSCP00000022942  tagsfrcqcpegltldatgrlcvd......................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000014445  rdvdecadgqqdc.................................................................
ENSSSCP00000002645  tyfcscpagyilmddnrscqdinecehrnhtc..............................................
ENSSSCP00000013927  ..............................................................................
ENSSSCP00000017120  vvdssscvracpsskmeveengikmckpctdicp............................................
ENSSSCP00000030683  snytllkqglnnavaldfdyreqmiywtdvttqgsmirrmhlngsnvqvlhrtglsnpdglavdwvggnlywcdkgrd
ENSSSCP00000005408  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000023772  tagsfrcqcpegltldatgrlcvd......................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000000011  lsdvdgttcedi..................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000015165  rcdcppglavgvdgrvcvd...........................................................
ENSSSCP00000024250  rcdcppglavgvdgrvcvd...........................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000029508  nitagkcllrcraqlylestglc.......................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000024250  dldecteglhdc..................................................................
ENSSSCP00000015165  dldecteglhdc..................................................................
ENSSSCP00000007665  lgpwgswspcthngktc.............................................................
ENSSSCP00000001667  hcregfflsdnqhtciqrpeegmnc.....................................................
ENSSSCP00000029843  stdvgsctlvcppnnqevtaedgtqrcekcskpcaqvcyg......................................
ENSSSCP00000018545  stdvgsctlvcppnnqevtaedgtqrcekcskpcaqvcyg......................................
ENSSSCP00000030723  stdvgsctlvcppnnqevtaedgtqrcekcskpcaqvcyg......................................
ENSSSCP00000005017  rdgkncedm.....................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000014445  nghrcfdtr.....................................................................
ENSSSCP00000015165  gtc...........................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  gtc...........................................................................
ENSSSCP00000013809  icdegftptqdqhgceev............................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  cnagfelttdgkncvdh.............................................................
ENSSSCP00000024250  cnagfelttdgkncvdh.............................................................
ENSSSCP00000026721  vdrdfcanipsaessdsegfvihdgecmqecpsgfirngsqsmycipcegpc..........................
ENSSSCP00000001667  pvkc..........................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000022942  syrcschpgftgdgfscedrdecaenvdlc................................................
ENSSSCP00000004554  ..............................................................................
ENSSSCP00000005181  nipsaessdsegfvihdgecmqecpsgfirngsqsmycipcegpc.................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000005017  edeceegkhdc...................................................................
ENSSSCP00000005017  sficecssestldptkticieti.......................................................
ENSSSCP00000005017  rcecfpglavgldgrvcvd...........................................................
ENSSSCP00000024250  ntegsfqcdcplghelspsredcvd.....................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000013792  hcpqgyqllatrlcqdi.............................................................
ENSSSCP00000005017  gsfichcdmgysgkkgktgctdineceigahnc.............................................
ENSSSCP00000001667  kcicksgytgdgkhckdv............................................................
ENSSSCP00000015165  yrcecemgftpasdsrscqdidec......................................................
ENSSSCP00000023772  epgghrclcyngfvatldmrtcvvthq...................................................
ENSSSCP00000024250  yrcecemgftpasdsrscqdidec......................................................
ENSSSCP00000005017  ecdmgfvpspdrkacedidec.........................................................
ENSSSCP00000009507  ..............................................................................
ENSSSCP00000007874  tfggprcrcreghdllpdgrscqa......................................................
ENSSSCP00000005017  ntegsyrcecpsghqlspnisacidinecelsahlc..........................................
ENSSSCP00000002566  gsfscrdceegyrpsalghtcedvdecadpqsrc............................................
ENSSSCP00000014416  dwrcvnfsfcqdlhnkcknsrrqgchqyvihnnkcipecpsgytmnssnlmctpclgpc...................
ENSSSCP00000024250  dmktcidvnecdlnsnic............................................................
ENSSSCP00000024250  ryecncppdfqlnptgvgcvdnrvgnc...................................................
ENSSSCP00000015165  ryecncppdfqlnptgvgcvdnrvgnc...................................................
ENSSSCP00000012319  cpgenekcentegsyrcicaegykqiegicvk..............................................
ENSSSCP00000006447  ..............................................................................
ENSSSCP00000011407  ..............................................................................
ENSSSCP00000001667  inerncqdi.....................................................................
ENSSSCP00000023772  icnlgyevgvagkecqdvdecalnsllc..................................................
ENSSSCP00000005017  asptqdecl.....................................................................
ENSSSCP00000023772  fqcqcppgy.....................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028498  cselrepc......................................................................
ENSSSCP00000001987  ..............................................................................
ENSSSCP00000000276  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000002768  cselrepc......................................................................
ENSSSCP00000025452  vvtdhgscvracssdsyeveedgvrkckkcdgpcgkvcng......................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000001049  didecs........................................................................
ENSSSCP00000030663  kncselrepc....................................................................
ENSSSCP00000023772  mfrcvcdegyeldrrypqctdvnec.....................................................
ENSSSCP00000023563  gsyrcscasgfvlaadgkhce.........................................................
ENSSSCP00000007530  fsgnlcqldidycepnpcqngaqcfnrasdyfckcpedyegkncshlkdhc...........................
ENSSSCP00000014445  yrcgcpqgftphsqwsqcvd..........................................................
ENSSSCP00000021308  ivsflhllfsnxhkkrgmxldrseytslipnlknvvaldtevasnriywsdlsqrkiystqinrapsfssydtiiged
ENSSSCP00000026405  fececpegyrynptlkycedvdecs.....................................................
ENSSSCP00000007154  clheinecnshpclnegicvdglgtyrcicplgytgkncqtlvnlc................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000006106  syrclcppgqtllrdgktctplehn.....................................................
ENSSSCP00000007154  yecqcatgknfslcipllcpse........................................................
ENSSSCP00000004772  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000023772  dgsyechcppghalamgtacedidec....................................................
ENSSSCP00000008961  necda.........................................................................
ENSSSCP00000029826  chnstycfnlvgryecpcrpgwkp......................................................
ENSSSCP00000023563  sytcqrnplicgrgyhasqdgtkcvdvnecetgvhhc.........................................
ENSSSCP00000027947  ..............................................................................
ENSSSCP00000021312  wsgrlcdiqslpc.................................................................
ENSSSCP00000016757  ..............................................................................
ENSSSCP00000006411  ..............................................................................
ENSSSCP00000030721  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000005851  cppgflgtrceinvdecl............................................................
ENSSSCP00000020647  vngraictcppgftggacdqdvdecsigeaganpcehlgrcvntqgsflcqcgrgytgprcetdvnecl.........
ENSSSCP00000000011  apcpvgqtcintegsytcqknvpncgrgyhlneegtrcvdv.....................................
ENSSSCP00000011618  apgflgd.......................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000005753  ..............................................................................
ENSSSCP00000024343  gfsgdgracqdvdecqpsrchpdafcyntpgsfmcqckpgyqgdgfrcvp............................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000025758  crcragfsgrhce.................................................................
ENSSSCP00000007862  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000009174  gcqhicvndgagayhcecytgytlnedkktcsa.............................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000030663  rcscppgragprcqe...............................................................
ENSSSCP00000001551  gytgsrceadhnecl...............................................................
ENSSSCP00000007401  ..............................................................................
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000014445  tegsflcacprgyrleengricrdldecssrqhnc...........................................
ENSSSCP00000006890  heswrcvtaercaslrsvpgrastfgihqgsclaqcppgftrngsgifchkceglcpkec..................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000018024  fsglfceh......................................................................
ENSSSCP00000006356  ..............................................................................
ENSSSCP00000028498  rcscppgragprcqe...............................................................
ENSSSCP00000014657  lvgryecrcrpgwkp...............................................................
ENSSSCP00000007154  vdkneclsdpcqnggtcdnlvngyrctckkgfkghncqvnidec..................................
ENSSSCP00000007579  ecvntpgsfrcecwvgyepggpgegacqd.................................................
ENSSSCP00000005851  ntstvkrgavdisacgvpcpvgefsrsglvpcypcprdy.......................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000021312  cepgwsgpqcsq..................................................................
ENSSSCP00000004525  ..............................................................................
ENSSSCP00000005127  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000012373  iqgsfrclrfdcppnyvrvsetkcertlc.................................................
ENSSSCP00000013809  asrppvced.....................................................................
ENSSSCP00000006106  cpatyrqgsspgtcfrrcsqdc........................................................
ENSSSCP00000007154  ngqyictcpqgykgadctedvdecamansnpcehagkcvntdgafhceclkgyagprcemdinech............
ENSSSCP00000020647  cepgwsgpqcsrqcellspcv.........................................................
ENSSSCP00000007578  tqggfqchclpnyelvdgecvepvdpc...................................................
ENSSSCP00000007530  wmgqncdinindc.................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000022329  ltgfss........................................................................
ENSSSCP00000023132  glhtferdlgekmelevvflargpsglllyngqktdgkgdfvslalhnrllefrydlgrgrrssgskepvalgvwtrv
ENSSSCP00000020647  pc............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021312  gghscvcvngwtgescsqniddca......................................................
ENSSSCP00000017222  tcrsvgtsykclcdpgyhglyceeeynecl................................................
ENSSSCP00000012904  avcpynrrcvntfgsyyckchvgfel....................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000002566  spgshrcilgcqpgfhv.............................................................
ENSSSCP00000000030  hcknqhcg......................................................................
ENSSSCP00000001551  nafycqclpghtgqwceveidpcq......................................................
ENSSSCP00000026016  ..............................................................................
ENSSSCP00000017908  ..............................................................................
ENSSSCP00000027537  ..............................................................................
ENSSSCP00000010270  nknciwqlvaptqyrislqfdffetegndvckydfvevrsgltadsklhgkfcgsekpevitsqynnmrvefksdntv
ENSSSCP00000017355  ..............................................................................
ENSSSCP00000020581  ..............................................................................
ENSSSCP00000002768  acppgwrgstcni.................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000012373  sytcqrnplicgrgyhasqdgtkcvdvnecetgvhhc.........................................
ENSSSCP00000027290  ..............................................................................
ENSSSCP00000020647  hcqcpagftgplcespavpcapspc.....................................................
ENSSSCP00000010782  g.............................................................................
ENSSSCP00000023085  cscarnfmkthntckaegseyqvlyiaddneirslfpshphsayeqafqgdesvridamdvhvkagrvywtnwhtgti
ENSSSCP00000006198  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000009298  ..............................................................................
ENSSSCP00000014405  ..............................................................................
ENSSSCP00000014076  ddhvywtdvstdaisrakwdgtgqevvvdtslespaglaidwvtnklywtdagtdrievantdgsmrtvliwenldrp
ENSSSCP00000000451  dgsnytllkqglnnavaldfdyreqmiywtdvttqgsmirrmhlngsnvqvlhrtglsnpdglavdwvggnlywcdkg
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000021567  sg............................................................................
ENSSSCP00000029769  iscsp.........................................................................
ENSSSCP00000030031  pglrlapngracididectsdkavc.....................................................
ENSSSCP00000003828  ewtpprdsggredlvyniickscgsgrgactrcgdnvqy.......................................
ENSSSCP00000011618  ngqhgfsclcppgytgslce..........................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000009075  kcvclpgfvpsdkpnyctp...........................................................
ENSSSCP00000006520  rcvrceptfintsrscacsepniltgelc.................................................
ENSSSCP00000022247  sp............................................................................
ENSSSCP00000013700  sp............................................................................
ENSSSCP00000028117  phdgfrlhhntlmllqrimeyscfcvfgyvgercqh..........................................
ENSSSCP00000015505  arqghgevgggssapcsrgfflfkqsrhlliltcghgnggcqhscedtaagpecschpqselhvdgrscp........
ENSSSCP00000019577  ..............................................................................
ENSSSCP00000012631  lreveneitktlnvcfstlpgytrstahasrepsavvmslqstfslasnvtlfdladgmqkcvnacrssaevcqllgs
ENSSSCP00000025137  lreveneitktlnvcfstlpgytrstahasrepsavvmslqstfslasnvtlfdladgmqkcvnacrssaevcqllgs
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000003671  vc............................................................................
ENSSSCP00000028153  ..............................................................................
ENSSSCP00000026160  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000020747  ..............................................................................
ENSSSCP00000015505  pghfyttthrcvrcpagtyqpefgknscvscpg.............................................
ENSSSCP00000016321  rstqdhsvcysdcf................................................................
ENSSSCP00000008197  wsaplesggredltyalrcrecrpggscmpcg..............................................
ENSSSCP00000009514  ippadtggrkdvsyyiackkcsshagvcdecgg.............................................
ENSSSCP00000023658  ldwswpldtggrkdvtfniickkcgwnvkqcepcspn.........................................
ENSSSCP00000004152  ipgseratlgyniltqeetqsvydaryyggqcetvyngewrelrydsacerlyygddekyfrkpynflkyhfealads
ENSSSCP00000001540  vavreagredralrreirelrgrlerleqwagqagawvravlpmppeelqpeqvaelwgrgdrieslsdqvllleekl
ENSSSCP00000007291  ct............................................................................
ENSSSCP00000000030  ffssdgfrpcqacp................................................................
ENSSSCP00000030683  cscarnfmkthntckaegseyqvlyiaddneirslfpshphsayeqafqgdesvridamdvhvkagrvywtnwhtgti
ENSSSCP00000003769  pctrppsaphyltavgmgakvelrwtppqdnggreditysvtceqcwpesgecgpce.....................
ENSSSCP00000025638  slpcecpegtc...................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000011522  ..............................................................................
ENSSSCP00000003272  ..............................................................................
ENSSSCP00000000911  nececkkgfrgngidce.............................................................


                                                                                                    
                                                                                                    
d2dspb1               ..............................................................................
ENSSSCP00000006199  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000018516  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000017138  ..............................................................................
ENSSSCP00000017718  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000013927  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000030683  tievsklngayrtvlvssglrepralvvdvqngylywtdwgdhsligrigmdgsgrsvivdtkitwpngltldyvter
ENSSSCP00000005408  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000007665  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000026721  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000004554  ..............................................................................
ENSSSCP00000005181  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000009507  ..............................................................................
ENSSSCP00000007874  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000014416  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000012319  ..............................................................................
ENSSSCP00000006447  ..............................................................................
ENSSSCP00000011407  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000001987  ..............................................................................
ENSSSCP00000000276  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000001049  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021308  lqapdglavdwihsniywtdsilgtvsvadtkgvkrktlfqekgskpraivvdpvhgfmywtdwgtpakikkgglngv
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000004772  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000008961  ..............................................................................
ENSSSCP00000029826  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000027947  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000016757  ..............................................................................
ENSSSCP00000006411  ..............................................................................
ENSSSCP00000030721  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000005753  ..............................................................................
ENSSSCP00000024343  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000025758  ..............................................................................
ENSSSCP00000007862  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000009174  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000007401  ..............................................................................
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000006890  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000006356  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000014657  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000004525  ..............................................................................
ENSSSCP00000005127  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000007578  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000022329  ..............................................................................
ENSSSCP00000023132  slerngrkgamrvgdgprvlgespvphtilnlkeplyiggapdfsrlaraaavssgfdgaiqlvalngrqlltrehvv
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000012904  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000026016  ..............................................................................
ENSSSCP00000017908  ..............................................................................
ENSSSCP00000027537  ..............................................................................
ENSSSCP00000010270  skkgfkahffsdkdecskdnggcqqdcvntfgsyecqcrsgfvlhdnkhdckeagcd.....................
ENSSSCP00000017355  ..............................................................................
ENSSSCP00000020581  ..............................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000027290  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000010782  ..............................................................................
ENSSSCP00000023085  sfrslppaappttsnrhrrqidrgvthlnisglkmprgiaidwvagnvywtdsgrdvievaqmkgenrktlisgmide
ENSSSCP00000006198  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000009298  ..............................................................................
ENSSSCP00000014405  ..............................................................................
ENSSSCP00000014076  rdivvepmggymywtdwgaspkieragmdasgrqviissnltwpnglaidygsqrlywadagmktiefsgldgskrkv
ENSSSCP00000000451  rdtievsklngayrtvlvssglrepralvvdvqngylywtdwgdhsligrigmdgsgrsvivdtkitwpngltldyvt
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000021567  ..............................................................................
ENSSSCP00000029769  ..............................................................................
ENSSSCP00000030031  ..............................................................................
ENSSSCP00000003828  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000009075  ..............................................................................
ENSSSCP00000006520  ..............................................................................
ENSSSCP00000022247  ..............................................................................
ENSSSCP00000013700  ..............................................................................
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000019577  ..............................................................................
ENSSSCP00000012631  qkrifragslckrktpecdketsictdldgvalcqcksgyfqf...................................
ENSSSCP00000025137  qkrifragslckrktpecdketsictdldgvalcqcksgyfqf...................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000003671  ..............................................................................
ENSSSCP00000028153  ..............................................................................
ENSSSCP00000026160  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000020747  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000008197  ..............................................................................
ENSSSCP00000009514  ..............................................................................
ENSSSCP00000023658  ..............................................................................
ENSSSCP00000004152  kfssesyddandllkkvkneksvsagvtvgigptgspftanvglsgsresaflnklskynekkysfiriftkvqtasf
ENSSSCP00000001540  gacscedns.....................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000030683  sfrslppaappttsnrhrrqidrgvthlnisglkmprgiaidwvagnvywtdsgrdvievaqmkgenrktlisgmide
ENSSSCP00000003769  ..............................................................................
ENSSSCP00000025638  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000011522  ..............................................................................
ENSSSCP00000003272  ..............................................................................
ENSSSCP00000000911  ..............................................................................


                                                                                                    
                                                                                                    
d2dspb1               ..............................................................................
ENSSSCP00000006199  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000018516  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000017138  ..............................................................................
ENSSSCP00000017718  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000013927  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000030683  iywadaredyiefasldgsnrhvvlsqdiphifaltlfedyvywtdwetksinrahkttgtnktllistlhrpmdlhv
ENSSSCP00000005408  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000007665  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000026721  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000004554  ..............................................................................
ENSSSCP00000005181  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000009507  ..............................................................................
ENSSSCP00000007874  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000014416  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000012319  ..............................................................................
ENSSSCP00000006447  ..............................................................................
ENSSSCP00000011407  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000001987  ..............................................................................
ENSSSCP00000000276  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000001049  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021308  dvyslvtediqwpngitldlsggrlywvdsklhsissidvnggnrktvleafslaifedkvfwtdvineaifsanrlt
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000004772  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000008961  ..............................................................................
ENSSSCP00000029826  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000027947  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000016757  ..............................................................................
ENSSSCP00000006411  ..............................................................................
ENSSSCP00000030721  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000005753  ..............................................................................
ENSSSCP00000024343  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000025758  ..............................................................................
ENSSSCP00000007862  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000009174  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000007401  ..............................................................................
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000006890  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000006356  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000014657  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000004525  ..............................................................................
ENSSSCP00000005127  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000007578  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000022329  ..............................................................................
ENSSSCP00000023132  qavdvssfadhpctqaaghpclngasclprgasyeclcpggfsglhcek.............................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000012904  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000026016  ..............................................................................
ENSSSCP00000017908  ..............................................................................
ENSSSCP00000027537  ..............................................................................
ENSSSCP00000010270  ..............................................................................
ENSSSCP00000017355  ..............................................................................
ENSSSCP00000020581  ..............................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000027290  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000010782  ..............................................................................
ENSSSCP00000023085  phaivvdplrgtmywsdwgnhpkietaamdgtlretlvqdniqwptglavdyhnerlywadaklsvigsirlngtdpi
ENSSSCP00000006198  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000009298  ..............................................................................
ENSSSCP00000014405  ..............................................................................
ENSSSCP00000014076  ligsqlphpfgltlygdriywtdwqtksiqsadrltgldretlqenlenlmdihvfhrrrppvstpcatenggcshlc
ENSSSCP00000000451  eriywadaredyiefasldgsnrhvappatvlsqdiphifaltlfedyvywtdwetksinrahkttgtnktllistlh
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000021567  ..............................................................................
ENSSSCP00000029769  ..............................................................................
ENSSSCP00000030031  ..............................................................................
ENSSSCP00000003828  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000009075  ..............................................................................
ENSSSCP00000006520  ..............................................................................
ENSSSCP00000022247  ..............................................................................
ENSSSCP00000013700  ..............................................................................
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000019577  ..............................................................................
ENSSSCP00000012631  ..............................................................................
ENSSSCP00000025137  ..............................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000003671  ..............................................................................
ENSSSCP00000028153  ..............................................................................
ENSSSCP00000026160  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000020747  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000008197  ..............................................................................
ENSSSCP00000009514  ..............................................................................
ENSSSCP00000023658  ..............................................................................
ENSSSCP00000004152  kmrrdnimldevmlqslmelpeqynygmyakfiddygthyitsgsmggvyeyilvlnkenmtksgvtsddvtscfggs
ENSSSCP00000001540  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000030683  phaivvdplrgtmywsdwgnhpkietaamdgtlretlvqdniqwptglavdyhnerlywadaklsvigsirlngtdpi
ENSSSCP00000003769  ..............................................................................
ENSSSCP00000025638  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000011522  ..............................................................................
ENSSSCP00000003272  ..............................................................................
ENSSSCP00000000911  ..............................................................................


                                                                                                    
                                                                                                    
d2dspb1               ..............................................................................
ENSSSCP00000006199  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000018516  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000017138  ..............................................................................
ENSSSCP00000017718  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000013927  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000030683  fhalrqpdvpnhpckvnnggcsnlcllspggghkcacptnfylggdgrncvsnctasqfvc.................
ENSSSCP00000005408  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000007665  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000026721  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000004554  ..............................................................................
ENSSSCP00000005181  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000009507  ..............................................................................
ENSSSCP00000007874  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000014416  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000012319  ..............................................................................
ENSSSCP00000006447  ..............................................................................
ENSSSCP00000011407  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000001987  ..............................................................................
ENSSSCP00000000276  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000001049  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021308  gsdihlmaenllspedivlfhnltqprgvnwcertalqnggcqylclpapqinprspkftcacpdgmllakdmrscl.
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000004772  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000008961  ..............................................................................
ENSSSCP00000029826  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000027947  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000016757  ..............................................................................
ENSSSCP00000006411  ..............................................................................
ENSSSCP00000030721  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000005753  ..............................................................................
ENSSSCP00000024343  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000025758  ..............................................................................
ENSSSCP00000007862  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000009174  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000007401  ..............................................................................
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000006890  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000006356  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000014657  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000004525  ..............................................................................
ENSSSCP00000005127  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000007578  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000022329  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000012904  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000026016  ..............................................................................
ENSSSCP00000017908  ..............................................................................
ENSSSCP00000027537  ..............................................................................
ENSSSCP00000010270  ..............................................................................
ENSSSCP00000017355  ..............................................................................
ENSSSCP00000020581  ..............................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000027290  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000010782  ..............................................................................
ENSSSCP00000023085  vaadskrglshpfsidvfedyiygvtyinnrvfkihkfghsplinltgglshasdvvlyhqhkqpevtnpcdrkkcew
ENSSSCP00000006198  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000009298  ..............................................................................
ENSSSCP00000014405  ..............................................................................
ENSSSCP00000014076  lrspspsgfsctcptginlmpdgktcsp..................................................
ENSSSCP00000000451  rpmdlhvfhalrqpdvpnhpckvnnggcsnlcllspggghkcacptnfylggdgrncvsnctasqfvc..........
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000021567  ..............................................................................
ENSSSCP00000029769  ..............................................................................
ENSSSCP00000030031  ..............................................................................
ENSSSCP00000003828  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000009075  ..............................................................................
ENSSSCP00000006520  ..............................................................................
ENSSSCP00000022247  ..............................................................................
ENSSSCP00000013700  ..............................................................................
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000019577  ..............................................................................
ENSSSCP00000012631  ..............................................................................
ENSSSCP00000025137  ..............................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000003671  ..............................................................................
ENSSSCP00000028153  ..............................................................................
ENSSSCP00000026160  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000020747  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000008197  ..............................................................................
ENSSSCP00000009514  ..............................................................................
ENSSSCP00000023658  ..............................................................................
ENSSSCP00000004152  fgidydytdnlqitgslsgkhckklggghredeesnmavediisrvrggssgwgggltqngsiityrawgrslkynpa
ENSSSCP00000001540  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000030683  vaadskrglshpfsidvfedyiygvtyinnrvfkihkfghsplinltgglshasdvvlyhqhkqpevtnpcdrkkcew
ENSSSCP00000003769  ..............................................................................
ENSSSCP00000025638  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000011522  ..............................................................................
ENSSSCP00000003272  ..............................................................................
ENSSSCP00000000911  ..............................................................................


                                                                                                    
                                                                                                    
d2dspb1               ..............................................................................
ENSSSCP00000006199  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000018516  ..............................................................................
ENSSSCP00000030152  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000017138  ..............................................................................
ENSSSCP00000017718  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000013927  ..............................................................................
ENSSSCP00000017120  ..............................................................................
ENSSSCP00000030683  ..............................................................................
ENSSSCP00000005408  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000029508  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000007665  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000029843  ..............................................................................
ENSSSCP00000018545  ..............................................................................
ENSSSCP00000030723  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000026721  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000009595  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000004554  ..............................................................................
ENSSSCP00000005181  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000009507  ..............................................................................
ENSSSCP00000007874  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000014416  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000012319  ..............................................................................
ENSSSCP00000006447  ..............................................................................
ENSSSCP00000011407  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000005017  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000001987  ..............................................................................
ENSSSCP00000000276  ..............................................................................
ENSSSCP00000013792  ..............................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000025452  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000001049  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021308  ..............................................................................
ENSSSCP00000026405  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000004772  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000023772  ..............................................................................
ENSSSCP00000008961  ..............................................................................
ENSSSCP00000029826  ..............................................................................
ENSSSCP00000023563  ..............................................................................
ENSSSCP00000027947  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000016757  ..............................................................................
ENSSSCP00000006411  ..............................................................................
ENSSSCP00000030721  ..............................................................................
ENSSSCP00000022942  ..............................................................................
ENSSSCP00000028139  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000000011  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000005753  ..............................................................................
ENSSSCP00000024343  ..............................................................................
ENSSSCP00000024250  ..............................................................................
ENSSSCP00000015165  ..............................................................................
ENSSSCP00000025758  ..............................................................................
ENSSSCP00000007862  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000009174  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000030663  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000007401  ..............................................................................
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000006890  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000018024  ..............................................................................
ENSSSCP00000006356  ..............................................................................
ENSSSCP00000028498  ..............................................................................
ENSSSCP00000014657  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000005851  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000004525  ..............................................................................
ENSSSCP00000005127  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000013809  ..............................................................................
ENSSSCP00000006106  ..............................................................................
ENSSSCP00000007154  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000007578  ..............................................................................
ENSSSCP00000007530  ..............................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000001667  ..............................................................................
ENSSSCP00000022329  ..............................................................................
ENSSSCP00000023132  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000021312  ..............................................................................
ENSSSCP00000017222  ..............................................................................
ENSSSCP00000012904  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000002566  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000026016  ..............................................................................
ENSSSCP00000017908  ..............................................................................
ENSSSCP00000027537  ..............................................................................
ENSSSCP00000010270  ..............................................................................
ENSSSCP00000017355  ..............................................................................
ENSSSCP00000020581  ..............................................................................
ENSSSCP00000002768  ..............................................................................
ENSSSCP00000007579  ..............................................................................
ENSSSCP00000012373  ..............................................................................
ENSSSCP00000027290  ..............................................................................
ENSSSCP00000020647  ..............................................................................
ENSSSCP00000010782  ..............................................................................
ENSSSCP00000023085  lcllspsgpvctcpngkrldngtcvavpsp................................................
ENSSSCP00000006198  ..............................................................................
ENSSSCP00000002645  ..............................................................................
ENSSSCP00000009298  ..............................................................................
ENSSSCP00000014405  ..............................................................................
ENSSSCP00000014076  ..............................................................................
ENSSSCP00000000451  ..............................................................................
ENSSSCP00000001551  ..............................................................................
ENSSSCP00000021567  ..............................................................................
ENSSSCP00000029769  ..............................................................................
ENSSSCP00000030031  ..............................................................................
ENSSSCP00000003828  ..............................................................................
ENSSSCP00000011618  ..............................................................................
ENSSSCP00000014445  ..............................................................................
ENSSSCP00000009075  ..............................................................................
ENSSSCP00000006520  ..............................................................................
ENSSSCP00000022247  ..............................................................................
ENSSSCP00000013700  ..............................................................................
ENSSSCP00000028117  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000019577  ..............................................................................
ENSSSCP00000012631  ..............................................................................
ENSSSCP00000025137  ..............................................................................
ENSSSCP00000027035  ..............................................................................
ENSSSCP00000003671  ..............................................................................
ENSSSCP00000028153  ..............................................................................
ENSSSCP00000026160  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000020747  ..............................................................................
ENSSSCP00000015505  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000008197  ..............................................................................
ENSSSCP00000009514  ..............................................................................
ENSSSCP00000023658  ..............................................................................
ENSSSCP00000004152  vidfemkpiyeilrhtnlgpleakcqnlrraldqylmefnacrcgpcfnngepilvgtscrcqcpvgyqglaceq...
ENSSSCP00000001540  ..............................................................................
ENSSSCP00000007291  ..............................................................................
ENSSSCP00000000030  ..............................................................................
ENSSSCP00000030683  lcllspsgpvctcpngkrldngtcvavpsptlppdaprpgtcnlqcfnggscflnarrqpkcrcqprytgdkceldqc
ENSSSCP00000003769  ..............................................................................
ENSSSCP00000025638  ..............................................................................
ENSSSCP00000016321  ..............................................................................
ENSSSCP00000011522  ..............................................................................
ENSSSCP00000003272  ..............................................................................
ENSSSCP00000000911  ..............................................................................


                           
                           
d2dspb1               .....
ENSSSCP00000006199  .....
ENSSSCP00000009595  .....
ENSSSCP00000009595  .....
ENSSSCP00000030152  .....
ENSSSCP00000009595  .....
ENSSSCP00000029508  .....
ENSSSCP00000025452  .....
ENSSSCP00000018516  .....
ENSSSCP00000030152  .....
ENSSSCP00000017120  .....
ENSSSCP00000029843  .....
ENSSSCP00000018545  .....
ENSSSCP00000030723  .....
ENSSSCP00000017138  .....
ENSSSCP00000017718  .....
ENSSSCP00000022942  .....
ENSSSCP00000000030  .....
ENSSSCP00000014445  .....
ENSSSCP00000002645  .....
ENSSSCP00000013927  .....
ENSSSCP00000017120  .....
ENSSSCP00000030683  .....
ENSSSCP00000005408  .....
ENSSSCP00000012373  .....
ENSSSCP00000023772  .....
ENSSSCP00000009595  .....
ENSSSCP00000000011  .....
ENSSSCP00000005017  .....
ENSSSCP00000015165  .....
ENSSSCP00000024250  .....
ENSSSCP00000029508  .....
ENSSSCP00000029508  .....
ENSSSCP00000015505  .....
ENSSSCP00000024250  .....
ENSSSCP00000015165  .....
ENSSSCP00000007665  .....
ENSSSCP00000001667  .....
ENSSSCP00000029843  .....
ENSSSCP00000018545  .....
ENSSSCP00000030723  .....
ENSSSCP00000005017  .....
ENSSSCP00000024250  .....
ENSSSCP00000015165  .....
ENSSSCP00000014445  .....
ENSSSCP00000015165  .....
ENSSSCP00000015165  .....
ENSSSCP00000024250  .....
ENSSSCP00000013809  .....
ENSSSCP00000024250  .....
ENSSSCP00000015165  .....
ENSSSCP00000024250  .....
ENSSSCP00000026721  .....
ENSSSCP00000001667  .....
ENSSSCP00000009595  .....
ENSSSCP00000022942  .....
ENSSSCP00000004554  .....
ENSSSCP00000005181  .....
ENSSSCP00000015165  .....
ENSSSCP00000005017  .....
ENSSSCP00000005017  .....
ENSSSCP00000005017  .....
ENSSSCP00000024250  .....
ENSSSCP00000014445  .....
ENSSSCP00000013792  .....
ENSSSCP00000005017  .....
ENSSSCP00000001667  .....
ENSSSCP00000015165  .....
ENSSSCP00000023772  .....
ENSSSCP00000024250  .....
ENSSSCP00000005017  .....
ENSSSCP00000009507  .....
ENSSSCP00000007874  .....
ENSSSCP00000005017  .....
ENSSSCP00000002566  .....
ENSSSCP00000014416  .....
ENSSSCP00000024250  .....
ENSSSCP00000024250  .....
ENSSSCP00000015165  .....
ENSSSCP00000012319  .....
ENSSSCP00000006447  .....
ENSSSCP00000011407  .....
ENSSSCP00000001667  .....
ENSSSCP00000023772  .....
ENSSSCP00000005017  .....
ENSSSCP00000023772  .....
ENSSSCP00000007154  .....
ENSSSCP00000028498  .....
ENSSSCP00000001987  .....
ENSSSCP00000000276  .....
ENSSSCP00000013792  .....
ENSSSCP00000002768  .....
ENSSSCP00000025452  .....
ENSSSCP00000020647  .....
ENSSSCP00000001049  .....
ENSSSCP00000030663  .....
ENSSSCP00000023772  .....
ENSSSCP00000023563  .....
ENSSSCP00000007530  .....
ENSSSCP00000014445  .....
ENSSSCP00000021308  .....
ENSSSCP00000026405  .....
ENSSSCP00000007154  .....
ENSSSCP00000028139  .....
ENSSSCP00000006106  .....
ENSSSCP00000007154  .....
ENSSSCP00000004772  .....
ENSSSCP00000028139  .....
ENSSSCP00000021312  .....
ENSSSCP00000023772  .....
ENSSSCP00000008961  .....
ENSSSCP00000029826  .....
ENSSSCP00000023563  .....
ENSSSCP00000027947  .....
ENSSSCP00000021312  .....
ENSSSCP00000016757  .....
ENSSSCP00000006411  .....
ENSSSCP00000030721  .....
ENSSSCP00000022942  .....
ENSSSCP00000028139  .....
ENSSSCP00000005851  .....
ENSSSCP00000020647  .....
ENSSSCP00000000011  .....
ENSSSCP00000011618  .....
ENSSSCP00000002566  .....
ENSSSCP00000005753  .....
ENSSSCP00000024343  .....
ENSSSCP00000024250  .....
ENSSSCP00000015165  .....
ENSSSCP00000025758  .....
ENSSSCP00000007862  .....
ENSSSCP00000013809  .....
ENSSSCP00000009174  .....
ENSSSCP00000017222  .....
ENSSSCP00000001551  .....
ENSSSCP00000030663  .....
ENSSSCP00000001551  .....
ENSSSCP00000007401  .....
ENSSSCP00000028117  .....
ENSSSCP00000014445  .....
ENSSSCP00000006890  .....
ENSSSCP00000021312  .....
ENSSSCP00000018024  .....
ENSSSCP00000006356  .....
ENSSSCP00000028498  .....
ENSSSCP00000014657  .....
ENSSSCP00000007154  .....
ENSSSCP00000007579  .....
ENSSSCP00000005851  .....
ENSSSCP00000007154  .....
ENSSSCP00000021312  .....
ENSSSCP00000004525  .....
ENSSSCP00000005127  .....
ENSSSCP00000013809  .....
ENSSSCP00000012373  .....
ENSSSCP00000013809  .....
ENSSSCP00000006106  .....
ENSSSCP00000007154  .....
ENSSSCP00000020647  .....
ENSSSCP00000007578  .....
ENSSSCP00000007530  .....
ENSSSCP00000027035  .....
ENSSSCP00000001667  .....
ENSSSCP00000022329  .....
ENSSSCP00000023132  .....
ENSSSCP00000020647  .....
ENSSSCP00000014445  .....
ENSSSCP00000021312  .....
ENSSSCP00000017222  .....
ENSSSCP00000012904  .....
ENSSSCP00000002566  .....
ENSSSCP00000002566  .....
ENSSSCP00000000030  .....
ENSSSCP00000001551  .....
ENSSSCP00000026016  .....
ENSSSCP00000017908  .....
ENSSSCP00000027537  .....
ENSSSCP00000010270  .....
ENSSSCP00000017355  .....
ENSSSCP00000020581  .....
ENSSSCP00000002768  .....
ENSSSCP00000007579  .....
ENSSSCP00000012373  .....
ENSSSCP00000027290  .....
ENSSSCP00000020647  .....
ENSSSCP00000010782  .....
ENSSSCP00000023085  .....
ENSSSCP00000006198  .....
ENSSSCP00000002645  .....
ENSSSCP00000009298  .....
ENSSSCP00000014405  .....
ENSSSCP00000014076  .....
ENSSSCP00000000451  .....
ENSSSCP00000001551  .....
ENSSSCP00000021567  .....
ENSSSCP00000029769  .....
ENSSSCP00000030031  .....
ENSSSCP00000003828  .....
ENSSSCP00000011618  .....
ENSSSCP00000014445  .....
ENSSSCP00000009075  .....
ENSSSCP00000006520  .....
ENSSSCP00000022247  .....
ENSSSCP00000013700  .....
ENSSSCP00000028117  .....
ENSSSCP00000015505  .....
ENSSSCP00000019577  .....
ENSSSCP00000012631  .....
ENSSSCP00000025137  .....
ENSSSCP00000027035  .....
ENSSSCP00000003671  .....
ENSSSCP00000028153  .....
ENSSSCP00000026160  .....
ENSSSCP00000007291  .....
ENSSSCP00000020747  .....
ENSSSCP00000015505  .....
ENSSSCP00000016321  .....
ENSSSCP00000008197  .....
ENSSSCP00000009514  .....
ENSSSCP00000023658  .....
ENSSSCP00000004152  .....
ENSSSCP00000001540  .....
ENSSSCP00000007291  .....
ENSSSCP00000000030  .....
ENSSSCP00000030683  weycr
ENSSSCP00000003769  .....
ENSSSCP00000025638  .....
ENSSSCP00000016321  .....
ENSSSCP00000011522  .....
ENSSSCP00000003272  .....
ENSSSCP00000000911  .....


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053842 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Rhizomucor miehei CAU432
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Chaetomium globosum CBS 148.51
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Candida albicans SC5314
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Glycine max v109 - Soybean
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Synechococcus elongatus PCC 7942
NoYes   Ilumatobacter coccineus
NoYes   Filifactor alocis ATCC 35896
NoYes   Runella slithyformis DSM 19594
NoYes   Treponema succinifaciens DSM 2489
NoYes   Desulfurispirillum indicum S5
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Burkholderia sp. CCGE1002
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Hahella chejuensis KCTC 2396
NoYes   Allochromatium vinosum DSM 180
NoYes   gamma proteobacterium HdN1
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Methanospirillum hungatei JF-1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Coccidioides posadasii str. Silveira
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Synechococcus elongatus PCC 6301
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica OS117
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Methanoregula formicica Methanoregula formicicum SMSP
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]