SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Growth factor receptor domain alignments in Bos taurus 76_3.1

These alignments are sequences aligned to the 0053854 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                            10                                      
                                                             |                                      
d2dtge6               ........dicpgtakgktncpatvingqf----------...-------............................
ENSBTAP00000008785  ............................sv----------...-------............................
ENSBTAP00000036514  .............................k----------...---VCKD............................
ENSBTAP00000053681  .............................h----------...---SCAA............................
ENSBTAP00000053681  ............................hg----------...---VCKA............................
ENSBTAP00000053681  ............................dn----------...--RVCQP............................
ENSBTAP00000036514  ...........................skk----------...----CDV............................
ENSBTAP00000034199  ..............................-CNSSFFMCK...NG-RCIPsgalcdnkddcgdgsdern.........
ENSBTAP00000036514  .............................p----------...-------............................
ENSBTAP00000015445  .............................i----------...-------............................
ENSBTAP00000009285  ..................fvhcepcdekal----------...-------............................
ENSBTAP00000036514  ............................eg----------...---VCKR............................
ENSBTAP00000036514  ..............................----------...----CRR............................
ENSBTAP00000011361  ...........................aih----------...-------............................
ENSBTAP00000053668  .............................v----------...-------............................
ENSBTAP00000047769  ...........................vvr----------...-------............................
ENSBTAP00000036514  .............................g----------...--NKCAI............................
ENSBTAP00000017556  .........................cvaea------LLCN...GQDDCGDgsderg......................
ENSBTAP00000029056  ..............................----------...-------............................
ENSBTAP00000013790  .............................v----------...-------............................
ENSBTAP00000024122  ...........................qcl----------...------Dide.........................
ENSBTAP00000055280  ............................wr----------...-------............................
ENSBTAP00000037465  .............................d----------...-INECLV............................
ENSBTAP00000028738  ..............................-CPVGFSMTEta.VGIRCTDide.........................
ENSBTAP00000035484  .............................d----------...-VNECAE............................
ENSBTAP00000013790  .............................n----------...-GKTCPP............................
ENSBTAP00000022815  .............................l----------...----CAA............................
ENSBTAP00000002944  .............................q--------CN...DRNECQE............................
ENSBTAP00000053681  .............................r----------...-------............................
ENSBTAP00000055091  .............................g----------...---ECQR............................
ENSBTAP00000029257  ...........................ank----------...--ETCEH............................
ENSBTAP00000027416  ............................id----------...---ECQT............................
ENSBTAP00000015445  ............................qg----------...---NCPK............................
ENSBTAP00000005240  ..............................ICGRGYHASQ...DGTKCVDvne.........................
ENSBTAP00000006244  .............................g----------...---ECQR............................
ENSBTAP00000020360  ............................de----------...----CIQ............................
ENSBTAP00000035484  ............................cl----------...DIDECIA............................
ENSBTAP00000035484  ............................cm----------...DVDECAR............................
ENSBTAP00000020360  .............................d----------...-VNECLE............................
ENSBTAP00000035484  ............................fy---------K...DVNECKA............................
ENSBTAP00000006244  ............................vd----------...---ECIQ............................
ENSBTAP00000002944  ............................nv----------...-TDYCQL............................
ENSBTAP00000016040  ............................vd----------...---ECSP............................
ENSBTAP00000055091  ............................vd----------...---ECIQ............................
ENSBTAP00000002944  .............................l----------...--NECNQ............................
ENSBTAP00000012158  ............................qd----------...-VDECVE............................
ENSBTAP00000020360  ............................ga------ILNQ...TIDICKH............................
ENSBTAP00000010680  ..............................----------...-------............................
ENSBTAP00000035484  ..............................-CSSGLGITT...DGRDINE............................
ENSBTAP00000010571  ..............................---PGFTGDY...CETEIDL............................
ENSBTAP00000002944  .........................clqng----------...-------............................
ENSBTAP00000002944  ...........................gkr-------FFK...DINECKM............................
ENSBTAP00000036514  ............................cv----------...-------............................
ENSBTAP00000008880  .........................ceagd----------...-------............................
ENSBTAP00000020360  ............................cv----------...DRNECLE............................
ENSBTAP00000053681  ..............................----------...-------............................
ENSBTAP00000027416  ............................vd----------...---ECAQ............................
ENSBTAP00000012158  ............................id----------...---ECRL............................
ENSBTAP00000029056  ............................sr----------...---ACAP............................
ENSBTAP00000020360  .............................d----------...---ECSQ............................
ENSBTAP00000002944  .........................decke----------...-------............................
ENSBTAP00000023206  ...........................cti----------...-------............................
ENSBTAP00000035484  ............................vg----------...-RNECRE............................
ENSBTAP00000027771  .............................n----------...---SCEA............................
ENSBTAP00000029170  .............................g----------...-------............................
ENSBTAP00000053668  .....................eqcdgrcyg----------...-------............................
ENSBTAP00000053678  ..............................QCPPGFALDS...VGPFCADene.........................
ENSBTAP00000054188  ............................dv----------...--DECIQ............................
ENSBTAP00000020360  ............................cm----------...DIDECER............................
ENSBTAP00000002944  ............................sa--------CI...DINECEL............................
ENSBTAP00000002944  ..............................----GKTGCT...DINECEI............................
ENSBTAP00000009531  ...........................srq----------...---TCAN............................
ENSBTAP00000028604  .........................cvdid----------...------E............................
ENSBTAP00000020360  ............................fy---------K...DINECKA............................
ENSBTAP00000037465  ............................vd----------...---ECSE............................
ENSBTAP00000005002  ............................qa-CAKGCELCS...EVNGCLK............................
ENSBTAP00000018083  ............................np----------...-------............................
ENSBTAP00000022815  .............................n----------...---YCAL............................
ENSBTAP00000026435  ...........................cqh----------...-------............................
ENSBTAP00000028690  ..............................----------...-------............................
ENSBTAP00000011042  .............................g----------...-------............................
ENSBTAP00000029274  ............................vd----------...---ECED............................
ENSBTAP00000020360  .............................k----GTTGCT...DVDECEI............................
ENSBTAP00000049409  .........................edide----------...-------............................
ENSBTAP00000025803  .............acgpcepaacpplpprg----------...-------............................
ENSBTAP00000011877  ............................al----------...-------............................
ENSBTAP00000014377  ..............................QCGLGYFEAErnaSHLVCSA............................
ENSBTAP00000054551  ..............................-CMDGYFRSPtseTHSICSA............................
ENSBTAP00000028615  .....................rregqqcgv----------...-------............................
ENSBTAP00000020360  .............................d----------...---ECAE............................
ENSBTAP00000020360  ..............................----------...-------............................
ENSBTAP00000035484  .............................e-CAENVALCE...NG-----............................
ENSBTAP00000007349  ........................pgxrcg----------...-------............................
ENSBTAP00000001939  ..............................VCLPGYTGLK...CEIDIDE............................
ENSBTAP00000009631  ..............................-CLPGWMGQN...CDININD............................
ENSBTAP00000029274  ............................qe----------...----CQDide.........................
ENSBTAP00000016858  .....neecgdicpgtakgktncpatving----------...-------............................
ENSBTAP00000003826  .............................g----------...-------............................
ENSBTAP00000035484  .............................g-----AMGCS...DVDECQL............................
ENSBTAP00000015268  ...............gcapcrpeecaaprg-CLAGRVRDA...-------............................
ENSBTAP00000016342  .......fkcqsgecisldkvcnsvrdcrd----------...-------............................
ENSBTAP00000035185  .....................knpafvtcv----------...------Qklpdq.......................
ENSBTAP00000053357  ..............................-CTPGWQGPR...CQQDVDE............................
ENSBTAP00000009629  ..............................-CLPGWKGAN...CHINVDD............................
ENSBTAP00000002944  ...........................ceg----------...-------............................
ENSBTAP00000037826  .....................wpcqcprrk----------...-------............................
ENSBTAP00000017746  ..............................QCLQGYTGPR...CEIDVNE............................
ENSBTAP00000054188  ............................dl----------...-------............................
ENSBTAP00000023206  ...........................ipi----------...-------............................
ENSBTAP00000008785  ..............................----------...-------............................
ENSBTAP00000026435  ............................ei----------...--NECTV............................
ENSBTAP00000026435  ..............................-CDSGYHMTP...GG-QCEDvde.........................
ENSBTAP00000055091  .............................p----------...-------............................
ENSBTAP00000046844  ............................cl----------...-------............................
ENSBTAP00000032310  ............................dq----------...----CNPlp..........................
ENSBTAP00000005988  ..............................-CYPNEWACP...KSGKCIPiskvcdgtldcpggedesnitagqqcdv
ENSBTAP00000035484  ............................cr----------...DLDECSS............................
ENSBTAP00000007111  .............................l----------...-------............................
ENSBTAP00000035484  ........................cpaqph----------...-------............................
ENSBTAP00000049409  .............................i----------...--NECTV............................
ENSBTAP00000041521  ...........................gee----------...---NCSV............................
ENSBTAP00000013316  ..............................KCLPGYTGSW...CEIDIDE............................
ENSBTAP00000027771  ......................scavgngg----------...-------............................
ENSBTAP00000055091  .............................e-CLEGDFCFP...HG-----............................
ENSBTAP00000010400  ...........................cte----------...DVDECAM............................
ENSBTAP00000018719  .............ecgpcrpercpepvrcp----------...-------............................
ENSBTAP00000017556  ............................cd----------...---QCSL............................
ENSBTAP00000053678  .............................s----------...-------............................
ENSBTAP00000006244  ............................cl---EGDFCFP...HG-----............................
ENSBTAP00000002689  ............................er----------...-------............................
ENSBTAP00000017746  ..............................ECVAGYHGVN...CSEEVNE............................
ENSBTAP00000017746  ..............................-CPAGWQGQT...CEIDINE............................
ENSBTAP00000053357  ............................ql----------...-------............................
ENSBTAP00000053357  ..............................-CAPGYTGMR...CESQVDE............................
ENSBTAP00000029938  ............................dl----------...--NECGL............................
ENSBTAP00000020360  ...........................cdg----------...-------............................
ENSBTAP00000003973  ..................carttfsghtdy----------...-------............................
ENSBTAP00000010400  ..............................ICNPGYMGAI...CSDQIDE............................
ENSBTAP00000042093  ..............................RCPGGFSGFN...CEKKTDS............................
ENSBTAP00000017746  ..............................-CLKGTTGPN...CEINLDD............................
ENSBTAP00000012977  ...................tachcpleapk-CAPGVGLVR...DACGCCKv...........................
ENSBTAP00000053357  .............................a-------CDQ...DVDECSI............................
ENSBTAP00000007931  ....................tpcacpwppp----------...-------............................
ENSBTAP00000043345  .............................s----------...----CSE............................
ENSBTAP00000004564  ...................prcpaaceptr----------...-------............................
ENSBTAP00000027836  .............................k----------...----CAL............................
ENSBTAP00000049409  ..............................-CTEGFRGWN...GQ--CLDvde.........................
ENSBTAP00000009629  ..............................-CPPGWKGST...CTVAKNSs...........................
ENSBTAP00000010400  ..........aycdvpsvscevaashrgvp----------...-------............................
ENSBTAP00000017746  .............................t----GQYCTE...DVDECQL............................
ENSBTAP00000008880  ............................td----------...---ECRL............................
ENSBTAP00000008880  .............................f----------...-------............................
ENSBTAP00000017563  ...........................dhp----------...-------............................
ENSBTAP00000000946  ....................wpcecpaapp----------...-------............................
ENSBTAP00000053678  .........................trrti----------...-------............................
ENSBTAP00000035484  ..............................----------...-------............................
ENSBTAP00000029274  .............................r----------...-------............................
ENSBTAP00000010400  ..............................-CKKGFKGYN...CQVNIDE............................
ENSBTAP00000001939  ......................fcrpgsvl----------...-------............................
ENSBTAP00000013680  ..............................ECPPNFTGSN...CEKKVDR............................
ENSBTAP00000005240  ...........................cea----------...-------............................
ENSBTAP00000021383  ..............................-CDPGYHGLY...CEEEYDE............................
ENSBTAP00000005240  ...........................cqd----------...-------............................
ENSBTAP00000034199  ..........................gcri--------TP...SEYTCED............................
ENSBTAP00000053357  .............................d----------...-------............................
ENSBTAP00000009531  ........................cetglh----------...------D............................
ENSBTAP00000037465  .............................g----------...-------............................
ENSBTAP00000046844  .........................eenld----------...------D............................
ENSBTAP00000007111  .............................w----------...-------............................
ENSBTAP00000028604  ...........................dsy----------...-------............................
ENSBTAP00000020360  .............................p----------...----CQP............................
ENSBTAP00000005529  ............................ya----------...-------............................
ENSBTAP00000009631  ..............................-CPGGWEGTT...CNIARNSs...........................
ENSBTAP00000006244  ...........................hla----------...-------............................
ENSBTAP00000010390  ..............................---PGHFTCT...DINECLS............................
ENSBTAP00000042993  ............................ys--------CT...EHDECVT............................
ENSBTAP00000008357  ....................pcqcpagpap----------...-------............................
ENSBTAP00000054188  ............................se----------...----CQR............................
ENSBTAP00000024122  .............................l----------...-------............................
ENSBTAP00000029084  .............................c---------R...DVDECQH............................
ENSBTAP00000018790  ..............................QCPAGFRGPT...CETAESP............................
ENSBTAP00000010400  ..............................KCPAGFDGVH...CENNIDE............................
ENSBTAP00000016040  ............................gg----------...-------............................
ENSBTAP00000010390  ..............................---PGHFTCT...DINECLS............................
ENSBTAP00000051405  .......................gacvdvd----------...-------............................
ENSBTAP00000004588  .............................c---------R...DVDECQH............................
ENSBTAP00000054781  .....................rcpprppvx----------...-------............................
ENSBTAP00000017746  ............................ce----------...--NNTPD............................
ENSBTAP00000056590  ..........................cere----------...----TDK............................
ENSBTAP00000020360  ........................pcemcp----------...-------............................
ENSBTAP00000018790  .........................eretd----------...------K............................
ENSBTAP00000051405  ........................cvspkf----------...---GCDF............................
ENSBTAP00000021383  ..............................VCLAGYTGEL...CQSKIDY............................
ENSBTAP00000055091  ..............................----------...-------............................
ENSBTAP00000017556  .......................hcreqrg----------...------Q............................
ENSBTAP00000052487  .........................cgver----------...-------............................
ENSBTAP00000053786  .............................g----------...----CGP............................
ENSBTAP00000002944  ..............................----------...-------............................
ENSBTAP00000023842  ..............................-CLSGHMLLP...NA-SCSNsrt.........................
ENSBTAP00000010400  .............................t----GQFCTE...DVDECLL............................
ENSBTAP00000035484  ..............................-CCSYNIGQA...WNRPCEA............................
ENSBTAP00000046844  ..............................TCPSGFTGDR...CQAQIRDp...........................
ENSBTAP00000025815  .........................qcfrg----------...---RCHP............................
ENSBTAP00000027416  .......................scamgqd----------...-------............................
ENSBTAP00000025033  ..............................RCPPGFTGDY...CETEVDL............................
ENSBTAP00000027132  ............................cr----------...QVDECQH............................
ENSBTAP00000053357  ..............................-CPPGWVGER...CQ-LEDP............................
ENSBTAP00000017556  ............................tn----------...---PCSV............................
ENSBTAP00000049409  ..........................eecg----------...-------............................
ENSBTAP00000012158  .......................crpgqhr----------...-------............................
ENSBTAP00000053357  ..............................----------...-------............................
ENSBTAP00000026435  ..........................eecg----------...-------............................
ENSBTAP00000007756  ............................tn----------...-------............................
ENSBTAP00000041372  .............................t----------...-------............................
ENSBTAP00000033786  ..............................RCEPGFTGVN...CESEVDH............................
ENSBTAP00000053179  ............................pc----------...-----QP............................
ENSBTAP00000046844  .............................s----------...-------............................
ENSBTAP00000027416  .....................wnvsecggl-CQPGEYSAD...GFTPCQP............................
ENSBTAP00000029274  ............................hh----------...-------............................
ENSBTAP00000036514  .........................ctpkf----------...-------............................
ENSBTAP00000004913  ........................kfggti-------CSG...NVWDQAS............................
ENSBTAP00000039211  ............................dv----------...--DECNL............................
ENSBTAP00000021495  ....................qfngrkcvda----------...-------............................
ENSBTAP00000005988  .............................n----------...-------............................
ENSBTAP00000039366  .............................k----------...-------............................
ENSBTAP00000033786  .............................s----------...-------............................
ENSBTAP00000020455  .............................r----------...-------............................
ENSBTAP00000001080  ............................ig----------...-------............................
ENSBTAP00000005817  lcsgrrvcstyrttyrvawrevrrevrqth----------...-------............................
ENSBTAP00000037070  ............................tg----------...-------............................
ENSBTAP00000015261  ...........................dtg----------...-------............................
ENSBTAP00000005240  ..............................-CAAGQQWAI...DSDECLD............................
ENSBTAP00000001511  ..............tpglctslpdpvkgte----------...-------............................
ENSBTAP00000014664  ....................ytcsgtdeav----------...--FECDE............................
ENSBTAP00000008955  ..............................----------...-------............................
ENSBTAP00000026780  ..............................-CPSGTFKANq..GDEACTH............................
ENSBTAP00000037611  ..........................pigk----------...-------............................
ENSBTAP00000011078  .........................iqsfl----------...------Y............................
ENSBTAP00000039368  ............................ig----------...-------............................
ENSBTAP00000008354  ...........................rch-CEPGYEEGSs..DVEECLA............................
ENSBTAP00000001939  .....................csylceagk----------...---DCCD............................


                             20                            30                                      4
                              |                             |                                       
d2dtge6               ..-....--..........--Ve......RC.W-.T.HSHCQ..........................K.V..CPT.I
ENSBTAP00000008785  ..C....HP..........ECGdk.....GC.DG.P.GADQClncvhfslgsvktsrkcv........S.A..CPL.G
ENSBTAP00000036514  ..C....QK..........SCR.......TC.--.S.SSGAC..........................T.T..CQE.G
ENSBTAP00000053681  ..C....HE..........SCA.......AC.WG.P.TEKHClacrdplhvlreggce..........S.S..CGN.R
ENSBTAP00000053681  ..C....HT..........SCL.......TC.VG.P.AHSHCtqcrkpedglqfeplsganitsgeclS.R..CRA.Q
ENSBTAP00000053681  ..C....NM..........HCG.......RC.--.D.SQASCtscrdpskvllfgdcqh.........E.S..CAP.Q
ENSBTAP00000036514  ..C....RQpldnfs....G-Agad....GC.IN.C.TGGYFmeerrcv...................Q.S..CSI.S
ENSBTAP00000034199  ..C....HIneclskkvs.GCSq......DC.QD.L.PVSYK..........................C.K..CWP.G
ENSBTAP00000036514  ..C....DP..........ECSev.....GC.DG.P.GPDHCndclhyyyklknntricv........S.S..CPP.G
ENSBTAP00000015445  ..C....HP..........LCSse.....GC.WG.P.GPKYC..........................M.S..CQN.F
ENSBTAP00000009285  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000036514  ..C....PE..........MCQ.......DC.--.I.HEKTCkecmpefflhkdach...........Q.S..CPS.H
ENSBTAP00000036514  ..C....HR..........SCK.......AC.QG.P.QPTDClscdpfffllrskgqch.........R.T..CPE.H
ENSBTAP00000011361  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000053668  ..C....NH..........LCSnd.....GC.WG.P.GPDQC..........................L.S..CRR.F
ENSBTAP00000047769  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000036514  ..C....HN..........STSt......IY.KR.T.PGTYLlaqtcv....................P.S..CPQ.G
ENSBTAP00000017556  ..C....HIneclshkls.GCSq......DC.ED.L.KIGFK..........................C.R..CRP.G
ENSBTAP00000029056  ..C....YP..........LCAqg.....HC.WG.P.GPTQC..........................V.N..CSQ.F
ENSBTAP00000013790  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000024122  ..Cr...YG..........YCQq......LC.AN.V.PGSYS..........................C.T..CNP.G
ENSBTAP00000055280  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000037465  ..N....NG..........GCDh......FC.RN.T.VGSFE..........................C.G..CRK.G
ENSBTAP00000028738  ..Cl...SS..........SCEg......HC.VN.T.EGGFV..........................C.E..CGP.G
ENSBTAP00000035484  ..T....PG..........VCTng.....LC.VN.T.DGSFR..........................C.E..CPF.G
ENSBTAP00000013790  ..C....HE..........ACKg......RC.WG.P.GPEDCqtltk.....................T.I..CAP.Q
ENSBTAP00000022815  ..D....DH..........GCEq......LC.VN.L.LGSFV..........................C.Q..CYS.G
ENSBTAP00000002944  ..I....PN..........ICShg.....QC.ID.T.VGSFY..........................C.L..CHT.G
ENSBTAP00000053681  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000055091  ..N....PQ..........VCGrg.....RC.IP.R.PSGYT..........................C.A..CDS.G
ENSBTAP00000029257  ..N....HE..........RCSrha....FC.TD.Y.ATGFC..........................C.H..CQS.R
ENSBTAP00000027416  ..R....NG..........GCDh......FC.RN.T.VGSFD..........................C.S..CKK.G
ENSBTAP00000015445  ..C....DP..........ACLnr.....SC.WG.A.GEENCqkltk.....................I.I..CAQ.Q
ENSBTAP00000005240  ..C....ETgvh.......RCGegq....VC.HN.L.PGSYR..........................C.D..CKP.G
ENSBTAP00000006244  ..N....PQ..........VCGrg.....RC.IP.R.PSGYT..........................C.A..CDS.G
ENSBTAP00000020360  ..N....GV..........LCKng.....RC.VN.T.DGSFQ..........................C.I..CNA.G
ENSBTAP00000035484  ..S....SG..........LCHhg.....RC.VN.T.EGSFQ..........................C.V..CNA.G
ENSBTAP00000035484  ..D....PL..........LCRgg.....TC.TN.T.DGSYE..........................C.Q..CPP.G
ENSBTAP00000020360  ..S....PG..........ICSng.....QC.IN.T.DGSFR..........................C.E..CPM.G
ENSBTAP00000035484  ..F....PG..........LCAhg.....TC.RN.T.VGSFR..........................C.S..CAG.G
ENSBTAP00000006244  ..S....PG..........LCGrg.....VC.EN.L.PGSFR..........................C.V..CPA.G
ENSBTAP00000002944  ..F....RY..........LCQng.....RC.IP.T.PGSYR..........................C.E..CNK.G
ENSBTAP00000016040  ..P....SE..........PCGpgh....LC.VN.S.PGSFR..........................C.E..CKA.G
ENSBTAP00000055091  ..S....PG..........LCGrg.....VC.EN.L.PGSFR..........................C.V..CPA.G
ENSBTAP00000002944  ..A....PK..........PCNf......IC.KN.T.EGSYQ..........................C.S..CPK.G
ENSBTAP00000012158  ..G....TD..........NCHida....IC.QN.T.PRSYK..........................C.I..CKS.G
ENSBTAP00000020360  ..H....AN..........LCLng.....RC.IP.T.VSSYR..........................C.E..CNM.G
ENSBTAP00000010680  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000035484  ..Cald.PD..........VCAng.....MC.EN.L.RGSYR..........................C.I..CNL.G
ENSBTAP00000010571  ..Cy...SS..........PCGahg....RC.RS.R.EGGYT..........................C.E..CQE.D
ENSBTAP00000002944  ..-....-R..........ICNng.....RC.IN.T.DGSFH..........................C.V..CNA.G
ENSBTAP00000002944  ..I....PN..........LCThg.....KC.RN.T.IGSFK..........................C.R..CDS.G
ENSBTAP00000036514  ..-....--..........---.......--.--.-.-----..........................L.N..CSL.G
ENSBTAP00000008880  ..-....--..........VCDng.....IC.AN.T.PGSFQ..........................C.Q..CLS.G
ENSBTAP00000020360  ..I....PN..........VCShg.....LC.VD.L.QGSYQ..........................C.I..CHN.G
ENSBTAP00000053681  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000027416  ..G....LD..........DCHina....LC.EN.T.PTSYK..........................C.S..CRP.G
ENSBTAP00000012158  ..N....NG..........GCDh......IC.RN.T.VGSFE..........................C.S..CKK.G
ENSBTAP00000029056  ..C....SP..........ACKap.....NC.WG.E.SSQDCqsltr.....................T.V..CAS.G
ENSBTAP00000020360  ..S....PK..........PCNf......IC.KN.T.EGSYQ..........................C.S..CPR.G
ENSBTAP00000002944  ..-....PD..........VCKhg.....QC.IN.T.DGSYR..........................C.E..CPF.G
ENSBTAP00000023206  ..-....PP..........YCHq......RC.VN.T.PGSFY..........................C.Q..CNP.G
ENSBTAP00000035484  ..I....PN..........ACShg.....DC.MD.T.VDSYM..........................C.L..CHR.G
ENSBTAP00000027771  ..D....NG..........GCSh......GC.SH.S.SAGPV..........................C.T..CPH.G
ENSBTAP00000029170  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000053668  ..-....--..........---.......--.--.-.-----..........................-.-..---.P
ENSBTAP00000053678  ..Caa..GN..........PCSh......SC.HN.A.MGTYY..........................C.S..CPK.G
ENSBTAP00000054188  ..S....PG..........LCGrg.....VC.EN.L.PGSFR..........................C.V..CPA.G
ENSBTAP00000020360  ..N....PL..........LCRgg.....TC.VN.T.EGSFQ..........................C.D..CPL.G
ENSBTAP00000002944  ..S....AH..........LCPhg.....RC.VN.L.IGKYQ..........................C.A..CNP.G
ENSBTAP00000002944  ..G....AH..........NCDrha....VC.TN.T.AGSFK..........................C.S..CSP.G
ENSBTAP00000009531  ..N....RH..........QCSvha....EC.RD.F.ATGFC..........................C.R..CVA.G
ENSBTAP00000028604  ..Cr...YR..........YCQh......RC.VN.L.PGSFR..........................C.Q..CEP.G
ENSBTAP00000020360  ..F....PG..........MCTyg.....KC.RN.T.IGSFK..........................C.R..CNS.G
ENSBTAP00000037465  ..G....TD..........DCHida....IC.QN.T.PKSYK..........................C.L..CKP.G
ENSBTAP00000005002  ..C....SP..........KLFiller..ND.IR.Q.VGVCL..........................P.S..CPP.G
ENSBTAP00000018083  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000022815  ..N....KP..........GCEh......EC.IN.T.EEGYY..........................C.R..CRR.G
ENSBTAP00000026435  ..-....HH..........LCSng.....QC.RN.T.EGSFR..........................C.V..CDH.G
ENSBTAP00000028690  ..-....--..........---.......--.--.-.-----..........................-.-..CPS.A
ENSBTAP00000011042  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000029274  ..P....QS..........SCLgg.....EC.KN.T.AGSYQ..........................C.L..CPP.G
ENSBTAP00000020360  ..G....AH..........NCDmha....SC.LN.V.PGSFK..........................C.S..CRE.G
ENSBTAP00000049409  ..Cqh..HH..........LCSng.....QC.RN.T.EGSFR..........................C.V..CDH.G
ENSBTAP00000025803  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000011877  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000014377  ..C....FG..........PCA.......RC.SG.P.EESHC..........................L.Q..CKK.G
ENSBTAP00000054551  ..C....DE..........ACK.......TC.VG.P.TNRDC..........................G.Q..CEV.G
ENSBTAP00000028615  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000020360  ..N....IN..........LCEng.....QC.LN.V.PGAYR..........................C.E..CEM.G
ENSBTAP00000020360  ..-....--..........-CAf......RC.MN.T.FGSYE..........................C.T..CPI.G
ENSBTAP00000035484  ..-....--..........---.......QC.LN.V.PGGYR..........................C.E..CEM.G
ENSBTAP00000007349  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000001939  ..C....SSl.........PCHnng....IC.KD.R.VGEFI..........................C.E..CPS.G
ENSBTAP00000009631  ..C....VG..........QCQnda....SC.RD.L.VNGYR..........................C.I..CPP.G
ENSBTAP00000029274  ..Ceq..PG..........VCSrg.....RC.TN.T.EGSYH..........................C.E..CDQ.G
ENSBTAP00000016858  ..-....--..........--Qfve....RC.W-.T.HSHCQ..........................K.V..CPT.I
ENSBTAP00000003826  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000035484  ..G....GH..........SCDsha....SC.LN.T.PGSFS..........................C.S..CQP.G
ENSBTAP00000015268  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000016342  ..-....--..........---.......--.--.W.SDEPL..........................K.D..C--.-
ENSBTAP00000035185  ..Cs...PD..........PCNkkgth..VC.QD.L.MGNFY..........................C.Q..CRD.G
ENSBTAP00000053357  ..Cas..PS..........PCGphg....TC.TN.L.AGSFS..........................C.T..CHE.G
ENSBTAP00000009629  ..C....RG..........QCQhgg....TC.KD.L.VNGYQ..........................C.V..CPR.G
ENSBTAP00000002944  ..-....NH..........RCQh......GC.QN.I.IGGYR..........................C.S..CPQ.G
ENSBTAP00000037826  ..-....--..........---.......--.--.-.-----..........................P.-..---.-
ENSBTAP00000017746  ..Cv...SN..........PCQnda....TC.LD.Q.IGEFQ..........................C.I..CMP.G
ENSBTAP00000054188  ..-....--..........-CQsg.....IC.TN.T.DGSFE..........................C.I..CPP.G
ENSBTAP00000023206  ..-....--..........---.......--.--.-.NPSHR..........................I.Q..CAT.G
ENSBTAP00000008785  ..-....--..........---.......--.--.-.-----..........................-.-..CEP.G
ENSBTAP00000026435  ..N....PD..........ICGag.....HC.IN.L.PVRYT..........................C.I..CYD.G
ENSBTAP00000026435  ..Clt..PS..........TCPde.....QC.VN.S.PGSYQ..........................C.Vp.CTE.G
ENSBTAP00000055091  ..-....--..........PCAyg.....RC.EN.T.EGGFQ..........................C.V..CPT.G
ENSBTAP00000046844  ..-....SQ..........PCHrgg....TC.LD.L.LATFQ..........................C.L..CPP.G
ENSBTAP00000032310  ..C....NE..........DGFm......TC.KD.G.QATFT..........................C.I..CKS.G
ENSBTAP00000005988  nlC....PSl.........GCEy......QC.HR.S.PGGGM..........................C.Y..CPS.G
ENSBTAP00000035484  ..R....QH..........NCQf......FC.VN.T.IGAFT..........................C.R..CPP.G
ENSBTAP00000007111  ..-....--..........-CQedq....RC.VN.L.LGSYH..........................C.LpdCRP.G
ENSBTAP00000035484  ..-....--..........---.......--.--.-.-----..........................-.P..CRR.G
ENSBTAP00000049409  ..N....PD..........ICGag.....HC.IN.L.PVRYT..........................C.I..CYD.G
ENSBTAP00000041521  ..N....NG..........GCAq......KC.QM.V.RGAIQ..........................C.T..CHT.G
ENSBTAP00000013316  ..Cl...PS..........PCHngg....TC.HN.L.VGGFS..........................C.S..CPD.G
ENSBTAP00000027771  ..C....QH..........NCV.......QL.--.T.VTQHR..........................C.Q..CRP.E
ENSBTAP00000055091  ..-....--..........---.......EC.LN.T.DGSFA..........................C.T..CAP.G
ENSBTAP00000010400  ..An...SN..........PCEhag....KC.VN.T.DGAFH..........................C.E..CLK.G
ENSBTAP00000018719  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000017556  ..N....NG..........GCSh......NCsVA.P.GEGIV..........................C.S..CPL.G
ENSBTAP00000053678  ..-....--..........PCHh......RC.FN.A.IGSFH..........................C.G..CEP.G
ENSBTAP00000006244  ..-....--..........---.......EC.LN.T.DGSFA..........................C.T..CAP.G
ENSBTAP00000002689  ..C....PS..........SCPa......TC.P-.-.--PKP..........................P.T..CAP.G
ENSBTAP00000017746  ..Cl...SQ..........PCRngg....TC.ID.L.TNTYK..........................C.S..CPR.G
ENSBTAP00000017746  ..Cv...KS..........PCRaga....SC.QN.T.NGSYR..........................C.H..CQA.G
ENSBTAP00000053357  ..-....--..........-CQagg....QC.VD.K.DSSHY..........................C.V..CPE.G
ENSBTAP00000053357  ..Cr...SQ..........PCRhgg....KC.LD.L.VDKYL..........................C.R..CPP.G
ENSBTAP00000029938  ..K....PR..........PCKh......RC.MN.T.FGSYK..........................C.Y..CLS.G
ENSBTAP00000020360  ..-....NH..........RCQh......GC.QN.I.LGGYR..........................C.G..CPQ.G
ENSBTAP00000003973  ..-....--..........---.......RC.W-.-.TSSHCqkv.......................C.P..CPR.G
ENSBTAP00000010400  ..Cy...SS..........PCLneg....RC.ID.L.VNGYQ..........................C.N..CQP.G
ENSBTAP00000042093  ..Cs...SS..........PCSnga....QC.VD.L.GDAYA..........................C.R..CQA.G
ENSBTAP00000017746  ..Ca...SN..........PCDsg.....TC.LD.K.IDGYE..........................C.A..CEP.G
ENSBTAP00000012977  ..CakqlNE..........DCS.......KT.QP.C.DHTKG..........................L.E..CNF.G
ENSBTAP00000053357  ..G....AN..........PCEhlg....RC.VN.T.QGSFL..........................C.Q..CGR.G
ENSBTAP00000007931  ..-....--..........---.......--.--.-.-----..........................-.R..CPP.G
ENSBTAP00000043345  ..C....HS..........NA-.......TC.TV.D.GAATT..........................C.A..CQE.G
ENSBTAP00000004564  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000027836  ..N....TH..........GCEh......ICvND.R.TGSYH..........................C.E..CYE.G
ENSBTAP00000049409  ..Cle..PK..........ICTng.....TC.SN.L.EGSYM..........................C.S..CHK.G
ENSBTAP00000009629  ..Cl...PN..........PCVngg....TC.VG.S.GDSFS..........................C.I..CRD.G
ENSBTAP00000010400  ..V....DR..........LCQhsg....VC.IS.A.GNSHH..........................C.Q..CPL.G
ENSBTAP00000017746  ..M....PN..........ACQngg....TC.HN.T.HGGYN..........................C.V..CVN.G
ENSBTAP00000008880  ..N....QN..........ICGhg.....EC.VP.G.PSDYS..........................C.H..CNP.G
ENSBTAP00000008880  ..-....--..........---.......-C.IN.F.PGHYK..........................C.N..CYP.G
ENSBTAP00000017563  ..Cl...PS..........PCLgga....PC.QAlE.AGRFH..........................C.Q..CPP.G
ENSBTAP00000000946  ..-....--..........---.......--.--.-.-----..........................-.R..CPL.G
ENSBTAP00000053678  ..-....--..........---.......--.--.-.----R..........................K.T..CPE.G
ENSBTAP00000035484  ..-....--..........---.......-C.QN.E.LGGYR..........................C.S..CPQ.G
ENSBTAP00000029274  ..-....--..........-CLgg.....QC.VN.T.DGSFN..........................C.V..CET.G
ENSBTAP00000010400  ..Ca...SN..........PCLnqg....TC.LD.D.VSGYT..........................C.H..CVL.P
ENSBTAP00000001939  ..-....--..........---.......--.--.-.RGRMC..........................V.N..CPL.G
ENSBTAP00000013680  ..Ct...SN..........PCAngg....QC.LN.R.GPNRV..........................C.R..CRP.G
ENSBTAP00000005240  ..-....-Q..........RCSq......EC.AN.I.YGSYQ..........................C.Y..CRQ.G
ENSBTAP00000021383  ..Cv...SA..........PCLnaa....TC.RD.L.VNGYE..........................C.V..CLA.E
ENSBTAP00000005240  ..-....NG..........PCKq......VC.RV.V.GDTAM..........................C.S..CFP.G
ENSBTAP00000034199  ..N....VN..........PCGdda....YC.NQ.I.KTSVF..........................C.R..CKP.G
ENSBTAP00000053357  ..Cs...PS..........SCFngg....TC.VD.G.VNSFT..........................C.L..CRP.G
ENSBTAP00000009531  ..C....DI..........PQRa......RC.IYmG.GSSYT..........................C.S..CLP.G
ENSBTAP00000037465  ..-....--..........---.......--.--.-.---QC..........................V.P..CPP.G
ENSBTAP00000046844  ..Cv...AA..........TCApgs....TC.ID.R.VGSFS..........................C.L..CPP.G
ENSBTAP00000007111  ..-....--..........---.......--.--.-.-----..........................-.-..CPP.G
ENSBTAP00000028604  ..-....--..........---.......--.--.-.-----..........................T.E..CTD.G
ENSBTAP00000020360  ..C....PA..........K--.......--.--.N.SAEFH..........................G.L..CSS.G
ENSBTAP00000005529  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000009631  ..Cl...PS..........PCHngg....TC.VV.N.GESFT..........................C.V..CKE.G
ENSBTAP00000006244  ..-....--..........-CPgq.....EC.VN.S.PGSFQ..........................C.Ra.CPA.G
ENSBTAP00000010390  ..Hg...VC..........--Pehs....EC.TN.S.LGSYR..........................C.S..CKV.G
ENSBTAP00000042993  ..N....QH..........NCDena....LC.FN.T.VGGHN..........................C.V..CKP.G
ENSBTAP00000008357  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000054188  ..N....PQ..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000024122  ..-....--..........---.......-C.LP.T.PGNAQ..........................Q.Q..CTN.G
ENSBTAP00000029084  ..R....PR..........VCKgrs....VC.IN.T.EGSYT..........................C.Q..CPP.G
ENSBTAP00000018790  ..Cd...DR..........ECQngg....WC.RA.E.GGAAA..........................C.V..CPA.G
ENSBTAP00000010400  ..Ct...ES..........SCFngg....TC.ID.G.INSFS..........................C.L..CPV.G
ENSBTAP00000016040  ..-....--..........PCKq......QC.RD.T.GEEVV..........................C.S..CFV.G
ENSBTAP00000010390  ..Hg...VC..........--Pehs....EC.TN.S.LGSYR..........................C.S..CKV.G
ENSBTAP00000051405  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000004588  ..R....PR..........VCKgls....VC.IN.T.EGSYT..........................C.Q..CPP.G
ENSBTAP00000054781  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000017746  ..Ct...ES..........SCFngg....TC.VD.G.INSFT..........................C.L..CPP.G
ENSBTAP00000056590  ..Cq...AQ..........PCRngg....TC.RD.L.PGASV..........................C.Q..CPP.G
ENSBTAP00000020360  ..-....--..........---.......--.--.-.--AQP..........................Q.P..CRR.G
ENSBTAP00000018790  ..Cq...AQ..........PCRngg....TC.RD.L.PGASV..........................C.Q..CPP.G
ENSBTAP00000051405  ..N....NG..........GCQq......DCfEG.G.DGSFR..........................C.G..CRP.G
ENSBTAP00000021383  ..Ci...LD..........PCRnga....TC.TS.N.LSGFT..........................C.Q..CLE.G
ENSBTAP00000055091  ..-....--..........---.......--.--.-.-----..........................-.-..CDP.G
ENSBTAP00000017556  ..Cs...HL..........GCQh......HC.VP.T.LNGPT..........................C.Y..CNN.S
ENSBTAP00000052487  ..-....-G..........GCQh......EC.KG.S.AGASN..........................C.L..CPA.D
ENSBTAP00000053786  ..D....NG..........GCEh......EC.IEaA.DGRVS..........................C.R..CSE.G
ENSBTAP00000002944  ..-....--..........---.......-C.VN.T.YGSYE..........................C.K..CPA.G
ENSBTAP00000023842  ..Ca...MT..........NCQy......SC.KD.T.EEGPC..........................C.L..CPSpG
ENSBTAP00000010400  ..Q....PN..........ACQngg....TC.TN.R.NGGYG..........................C.V..CVN.G
ENSBTAP00000035484  ..C....PT..........PASldyqi..LC.GN.Q.V----..........................-.-..--P.G
ENSBTAP00000046844  ..C....SS..........FCSkmg....RChLQ.D.SGRPR..........................C.S..CMP.G
ENSBTAP00000025815  ..V....DG..........TCA.......CE.PG.Y.RGKYCr.........................E.P..CPA.G
ENSBTAP00000027416  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000025033  ..Cy...SR..........PCGphg....HC.RS.R.EGGYT..........................C.L..CRD.G
ENSBTAP00000027132  ..R....PR..........VCKgls....IC.IN.T.EDSYT..........................C.Q..CPP.G
ENSBTAP00000053357  ..C....HSg.........PCAgrgvcqsSV.VA.G.TARFT..........................C.R..CPR.G
ENSBTAP00000017556  ..N....NG..........DCSq......LC.LP.T.SETTRs.........................C.M..CTA.G
ENSBTAP00000049409  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000012158  ..-....--..........---.......--.--.-.SGAKC..........................V.S..CPQ.G
ENSBTAP00000053357  ..-....--..........PCQhgg....IC.ID.L.VAHYL..........................C.S..CPP.G
ENSBTAP00000026435  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000007756  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000041372  ..-....--..........-CHeha....TC.LK.R.ETTSI..........................C.I..CKY.G
ENSBTAP00000033786  ..Cq...HH..........QCAnga....TC.VS.D.ANGYS..........................C.R..CPG.N
ENSBTAP00000053179  ..C....HC..........---.......DP.VG.S.LNEVCvkdekharrglapgs...........C.H..CKP.G
ENSBTAP00000046844  ..Ca...DS..........PCRnma....TC.QD.S.PQGPR..........................C.L..CPP.G
ENSBTAP00000027416  ..C....ARgtfqpeagrtSCF.......PC.GG.G.LPTKHpgatsfqdcetr..............V.Q..CSP.G
ENSBTAP00000029274  ..-....--..........---.......--.--.-.-----..........................-.-..CQQ.E
ENSBTAP00000036514  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000004913  ..C....HS..........---.......--.--.-.-PTAClsq.......................A.Q..CGQ.D
ENSBTAP00000039211  ..W....PA..........PCSelv....RC.FN.T.PGSFY..........................CgA..CPT.G
ENSBTAP00000021495  ..-....VG..........DRQ.......QC.VP.-.-TEACedpe......................E.G..CGN.D
ENSBTAP00000005988  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000039366  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000033786  ..-....--..........---.......--.--.-.--GYV..........................C.I..CPP.G
ENSBTAP00000020455  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000001080  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000005817  ..-....--..........---.......--.--.-.-----..........................A.V..CCQ.G
ENSBTAP00000037070  ..-....--..........---.......--.--.-.-----..........................C.S..CNA.G
ENSBTAP00000015261  ..-....--..........SCE.......AC.KP.GwNGTQCh.........................Q.P..CPP.G
ENSBTAP00000005240  ..I....PE..........SGAegd....AC.RT.A.QKQCCvsylke....................K.S..CMA.G
ENSBTAP00000001511  ..C....SF..........---.......--.--.-.-----..........................-.S..CKA.G
ENSBTAP00000014664  ..Cc...SL..........QCL.......RC.EE.E.LHRQErlrnherirlkaghvpycdp......C.K..GPS.G
ENSBTAP00000008955  ..-....--..........---.......--.--.-.----C..........................Q.A..CQP.G
ENSBTAP00000026780  ..C....PI..........NSR.......TT.--.S.EGATN..........................C.V..CRN.G
ENSBTAP00000037611  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000011078  ..C....NE..........NGL.......LG.SF.S.EETHS..........................C.T..CPN.D
ENSBTAP00000039368  ..-....--..........---.......--.--.-.-----..........................-.-..---.-
ENSBTAP00000008354  ..C....PSgsyrsdvdapQCL.......RC.--.P.QHSTAeaegate...................C.A..CES.E
ENSBTAP00000001939  ..Q....MA..........SC-.......KC.GT.H.TGQFE..........................C.I..CEK.G


                      0                                      50                                     
                      |                                       |                                     
d2dtge6               CKSH..G.C..................T.........AEGL.....................................
ENSBTAP00000008785  YFGD..T.A..................A.........RRCR.....................................
ENSBTAP00000036514  LRVN..N.HggcvphtecaareywdkeA.........QACE.....................................
ENSBTAP00000053681  FYNK..-.-..................Q.........GTCS.....................................
ENSBTAP00000053681  FYLE..-.I..................T.........GLCE.....................................
ENSBTAP00000053681  YYLD..F.S..................T.........KTCK.....................................
ENSBTAP00000036514  YYFD..H.S..................Sengy.....KSCK.....................................
ENSBTAP00000034199  FQLK..D.D..................G.........KTCV.....................................
ENSBTAP00000036514  HYHA..-.D..................K.........KRCR.....................................
ENSBTAP00000015445  SRGK..E.Cvgkcnilegeprefve..N.........SECV.....................................
ENSBTAP00000009285  ----..-.-..................-.........----.....................................
ENSBTAP00000036514  FYAD..-.-..................G.........RHCV.....................................
ENSBTAP00000036514  YYME..P.S..................T.........QTCE.....................................
ENSBTAP00000011361  ----..-.-..................-.........--CP.....................................
ENSBTAP00000053668  SRGR..T.Ciescnlydgefrefen..G.........SICV.....................................
ENSBTAP00000047769  ----..-.-..................-.........--CE.....................................
ENSBTAP00000036514  TWPS..V.R..................S.........GSCE.....................................
ENSBTAP00000017556  FRLK..D.D..................G.........RTCA.....................................
ENSBTAP00000029056  LRGQ..E.Cveecrvlqglpreyvk..D.........RYCL.....................................
ENSBTAP00000013790  ----..-.-..................-.........----.....................................
ENSBTAP00000024122  FTLN..E.D..................G.........RSCQ.....................................
ENSBTAP00000055280  ----..-.-..................-.........--CA.....................................
ENSBTAP00000037465  YKLL..T.D..................E.........RTCQ.....................................
ENSBTAP00000028738  MQLS..A.D..................R.........HSCQ.....................................
ENSBTAP00000035484  YSLD..F.T..................G.........VSCV.....................................
ENSBTAP00000013790  CNGH..C.F..................G.........PNPN.....................................
ENSBTAP00000022815  YALA..V.D..................G.........KRCE.....................................
ENSBTAP00000002944  FKTN..A.D..................Q.........TMCL.....................................
ENSBTAP00000053681  ----..-.-..................-.........----.....................................
ENSBTAP00000055091  FRLS..P.Q..................G.........THCI.....................................
ENSBTAP00000029257  FYGN..-.-..................G.........KQCLpegaphrvngkvsghllvghtpvhftdvdlhayvvgn
ENSBTAP00000027416  FKLL..T.D..................E.........KSCQ.....................................
ENSBTAP00000015445  CSGR..C.R..................G.........RSPS.....................................
ENSBTAP00000005240  FQRD..A.F..................G.........RTCI.....................................
ENSBTAP00000006244  FRLS..P.Q..................G.........THCI.....................................
ENSBTAP00000020360  FELT..T.D..................G.........KNCV.....................................
ENSBTAP00000035484  FELS..T.D..................S.........KNCV.....................................
ENSBTAP00000035484  HALA..A.E..................G.........TACE.....................................
ENSBTAP00000020360  YNLD..Y.T..................G.........VRCV.....................................
ENSBTAP00000035484  FALD..T.Q..................E.........RNCT.....................................
ENSBTAP00000006244  FRGS..A.C..................E.........EDVD.....................................
ENSBTAP00000002944  FQLD..-.L..................R.........GECI.....................................
ENSBTAP00000016040  YYFD..G.I..................S.........RTCV.....................................
ENSBTAP00000055091  FRGS..A.C..................E.........EDVD.....................................
ENSBTAP00000002944  YILQ..E.D..................G.........RSCK.....................................
ENSBTAP00000012158  YTGD..-.-..................G.........KHCK.....................................
ENSBTAP00000020360  YKQD..-.A..................N.........GDCI.....................................
ENSBTAP00000010680  ----..-.-..................-.........----.....................................
ENSBTAP00000035484  YEAV..A.D..................G.........RECT.....................................
ENSBTAP00000010571  FTGE..H.C..................E.........VNAR.....................................
ENSBTAP00000002944  FHVT..R.D..................G.........KNCE.....................................
ENSBTAP00000002944  FALD..S.E..................E.........RNCT.....................................
ENSBTAP00000036514  KFEF..-.-..................R.........NQCH.....................................
ENSBTAP00000008880  YHLS..R.D..................R.........SRCE.....................................
ENSBTAP00000020360  FKAS..Q.D..................Q.........TMCM.....................................
ENSBTAP00000053681  ----..-.-..................-.........----.....................................
ENSBTAP00000027416  YQGE..-.-..................G.........RQCE.....................................
ENSBTAP00000012158  YKLL..I.N..................E.........RNCQ.....................................
ENSBTAP00000029056  CARC..K.G..................P.........QPTD.....................................
ENSBTAP00000020360  YVLQ..E.D..................G.........KTCK.....................................
ENSBTAP00000002944  YILQ..-.-..................G.........NECV.....................................
ENSBTAP00000023206  FQLA..A.N..................N.........YTCV.....................................
ENSBTAP00000035484  FRAS..A.D..................Q.........TLCM.....................................
ENSBTAP00000027771  YELD..E.D..................Q.........RTCI.....................................
ENSBTAP00000029170  ----..-.-..................-.........----.....................................
ENSBTAP00000053668  ----..-.-..................-.........YVSD.....................................
ENSBTAP00000053678  LTIA..A.D..................G.........RTCQ.....................................
ENSBTAP00000054188  FRGS..A.C..................E.........EDVD.....................................
ENSBTAP00000020360  HELS..P.S..................R.........EDCV.....................................
ENSBTAP00000002944  YHST..P.D..................R.........LFCV.....................................
ENSBTAP00000002944  WIGD..-.-..................G.........IKCT.....................................
ENSBTAP00000009531  YTGN..-.-..................G.........RQCVaegspqrvngkvkgrifvgdsqvpivfentdlhsyvv
ENSBTAP00000028604  FQLG..P.N..................N.........RSCV.....................................
ENSBTAP00000020360  FALD..M.E..................E.........RNCT.....................................
ENSBTAP00000037465  YKGE..-.-..................G.........RQCE.....................................
ENSBTAP00000005002  YFDArnP.D..................M.........NKCI.....................................
ENSBTAP00000018083  ----..-.-..................-.........----.....................................
ENSBTAP00000022815  YTLD..P.N..................G.........KTCS.....................................
ENSBTAP00000026435  YRAS..A.L..................G.........DHCE.....................................
ENSBTAP00000028690  CGKR..A.C..................T.........ETHE.....................................
ENSBTAP00000011042  ----..-.-..................-.........----.....................................
ENSBTAP00000029274  FQLA..-.N..................G.........TVCE.....................................
ENSBTAP00000020360  WVGN..-.-..................G.........IKCI.....................................
ENSBTAP00000049409  YRAS..A.L..................G.........DHCE.....................................
ENSBTAP00000025803  ----..-.-..................-.........----.....................................
ENSBTAP00000011877  ----..-.-..................-.........-VCL.....................................
ENSBTAP00000014377  WALH..-.-..................H.........LKCV.....................................
ENSBTAP00000054551  WVRQ..-.-..................D.........DACV.....................................
ENSBTAP00000028615  ----..-.-..................-.........----.....................................
ENSBTAP00000020360  FTPA..S.D..................S.........RSCQ.....................................
ENSBTAP00000020360  YALR..E.D..................Q.........KMCK.....................................
ENSBTAP00000035484  FSPT..K.D..................Q.........HACQ.....................................
ENSBTAP00000007349  ----..-.-..................-.........----.....................................
ENSBTAP00000001939  YTGQ..L.C..................E.........DNVN.....................................
ENSBTAP00000009631  YAGD..H.C..................E.........TDID.....................................
ENSBTAP00000029274  YIMV..-.R..................K.........GHCQ.....................................
ENSBTAP00000016858  CKSH..G.C..................T.........SEGL.....................................
ENSBTAP00000003826  ----..-.-..................-.........----.....................................
ENSBTAP00000035484  WVGD..-.-..................G.........FKCR.....................................
ENSBTAP00000015268  ----..-.-..................-.........----.....................................
ENSBTAP00000016342  ----..-.G..................T.........NECL.....................................
ENSBTAP00000035185  WAGR..L.C..................D.........RDVN.....................................
ENSBTAP00000053357  YSGP..S.C..................D.........QDID.....................................
ENSBTAP00000009629  FGGR..H.C..................E.........HQLD.....................................
ENSBTAP00000002944  YLQH..Y.Q..................W.........NQCV.....................................
ENSBTAP00000037826  ----..-.-..................-.........----.....................................
ENSBTAP00000017746  YEGL..H.C..................E.........VNTD.....................................
ENSBTAP00000054188  HRAG..P.D..................L.........ASCL.....................................
ENSBTAP00000023206  YEQS..-.E..................H.........NVCQ.....................................
ENSBTAP00000008785  TYFD..S.E..................L.........IQCG.....................................
ENSBTAP00000026435  YKFN..E.Q..................Q.........RKCV.....................................
ENSBTAP00000026435  FRGW..-.-..................N.........GQCL.....................................
ENSBTAP00000055091  FQPN..A.A..................G.........SECE.....................................
ENSBTAP00000046844  LEGQ..L.C..................E.........VEID.....................................
ENSBTAP00000032310  WQGE..K.C..................E.........SDIN.....................................
ENSBTAP00000005988  FIVN..Q.N..................Rt........NNCV.....................................
ENSBTAP00000035484  FTQR..-.-..................H.........QACF.....................................
ENSBTAP00000007111  FRVA..A.D..................G.........ASCE.....................................
ENSBTAP00000035484  FIPN..I.N..................T.........GACQ.....................................
ENSBTAP00000049409  YKFN..E.Q..................Q.........RKCV.....................................
ENSBTAP00000041521  YRLT..E.D..................G.........RTCQ.....................................
ENSBTAP00000013316  FTGR..A.C..................E.........RDIN.....................................
ENSBTAP00000027771  FQLQ..E.D..................G.........RRCV.....................................
ENSBTAP00000055091  YRPG..P.R..................G.........ASCL.....................................
ENSBTAP00000010400  YAGP..R.C..................E.........MDIN.....................................
ENSBTAP00000018719  ----..-.-..................-.........----.....................................
ENSBTAP00000017556  MELG..P.D..................N.........HTCQ.....................................
ENSBTAP00000053678  YQLK..-.-..................G.........RKCV.....................................
ENSBTAP00000006244  YRPG..P.R..................G.........ASCL.....................................
ENSBTAP00000002689  VRAV..L.D..................D.........CSCC.....................................
ENSBTAP00000017746  TQGV..H.C..................E.........INVD.....................................
ENSBTAP00000017746  YTGR..N.C..................E.........TDID.....................................
ENSBTAP00000053357  HTGS..H.C..................E.........QEMD.....................................
ENSBTAP00000053357  TTGV..N.C..................E.........VNTD.....................................
ENSBTAP00000029938  YMLL..-.P..................D.........GSCS.....................................
ENSBTAP00000020360  YIQH..Y.Q..................W.........NQCV.....................................
ENSBTAP00000003973  LA--..-.C..................T.........VRGE.....................................
ENSBTAP00000010400  TSGV..N.C..................E.........INFD.....................................
ENSBTAP00000042093  FSGR..H.C..................D.........NNVD.....................................
ENSBTAP00000017746  YTGS..M.C..................N.........INID.....................................
ENSBTAP00000012977  ANST..A.L..................K.........GICR.....................................
ENSBTAP00000053357  YTGP..R.C..................E.........TDVN.....................................
ENSBTAP00000007931  VPLV..L.D..................G.........CNCC.....................................
ENSBTAP00000043345  FTGD..-.-..................G.........LECV.....................................
ENSBTAP00000004564  ----..-.-..................-.........----.....................................
ENSBTAP00000027836  YTLN..E.D..................R.........KTCS.....................................
ENSBTAP00000049409  YSPT..P.D..................H.........KHCE.....................................
ENSBTAP00000009629  WEGR..T.C..................T.........HNTN.....................................
ENSBTAP00000010400  YTGS..Y.C..................E.........DQLD.....................................
ENSBTAP00000017746  WTGE..D.C..................S.........ENID.....................................
ENSBTAP00000008880  YRSH..P.Q..................H.........RYCV.....................................
ENSBTAP00000008880  YRLK..A.S..................Rp........PVCE.....................................
ENSBTAP00000017563  RFGP..T.C..................A.........DEKD.....................................
ENSBTAP00000000946  VSLI..T.D..................G.........CECC.....................................
ENSBTAP00000053678  SEAS..-.-..................L.........DTCV.....................................
ENSBTAP00000035484  FTPH..S.Q..................W.........SQCV.....................................
ENSBTAP00000029274  FQPS..P.E..................S.........GECV.....................................
ENSBTAP00000010400  YTGK..N.C..................Q.........TVLA.....................................
ENSBTAP00000001939  TYYS..L.E..................H.........SVCE.....................................
ENSBTAP00000013680  FTGA..H.C..................E.........INIS.....................................
ENSBTAP00000005240  YQLA..E.D..................G.........HTCT.....................................
ENSBTAP00000021383  YKGI..H.C..................E.........SYKD.....................................
ENSBTAP00000005240  YAIM..A.D..................G.........VSCE.....................................
ENSBTAP00000034199  FQRN..M.K..................N.........RQCE.....................................
ENSBTAP00000053357  YTGT..H.C..................Q.........HEAD.....................................
ENSBTAP00000009531  FSGD..-.-..................G.........RACQ.....................................
ENSBTAP00000037465  TYQD..R.V..................Gq........LSCT.....................................
ENSBTAP00000046844  RTGL..L.C..................H.........MEDM.....................................
ENSBTAP00000007111  FIRQ..-.-..................N.........GVCT.....................................
ENSBTAP00000028604  YEWD..P.D..................S.........QHCR.....................................
ENSBTAP00000020360  VGIT..V.D..................G.........RDIN.....................................
ENSBTAP00000005529  ----..-.-..................-.........---V.....................................
ENSBTAP00000009631  WEGP..I.C..................T.........QNTN.....................................
ENSBTAP00000006244  HHLH..-.-..................H.........GRCT.....................................
ENSBTAP00000010390  FTSG..-.-..................N.........STCE.....................................
ENSBTAP00000042993  YTGN..-.-..................G.........TTCK.....................................
ENSBTAP00000008357  ----..-.-..................-.........----.....................................
ENSBTAP00000054188  ----..-.-..................-.........----.....................................
ENSBTAP00000024122  FDLD..R.S..................S.........GQCL.....................................
ENSBTAP00000029084  LEFS..P.E..................Dp........RHCT.....................................
ENSBTAP00000018790  YTGA..A.C..................E.........TDVD.....................................
ENSBTAP00000010400  FTGS..F.C..................L.........HEIN.....................................
ENSBTAP00000016040  YQLL..P.D..................G.........VSCE.....................................
ENSBTAP00000010390  FTSG..-.-..................N.........STCE.....................................
ENSBTAP00000051405  ----..-.-..................-.........-ECA.....................................
ENSBTAP00000004588  LEFS..P.E..................Dp........RHCT.....................................
ENSBTAP00000054781  ----..-.-..................-.........----.....................................
ENSBTAP00000017746  FTGS..Y.C..................Q.........HDVN.....................................
ENSBTAP00000056590  FTGV..H.C..................E.........TEVD.....................................
ENSBTAP00000020360  FIPN..I.R..................T.........GACQ.....................................
ENSBTAP00000018790  FTGV..H.C..................E.........TEVD.....................................
ENSBTAP00000051405  FRLL..D.D..................L.........VSCA.....................................
ENSBTAP00000021383  YLGS..T.C..................E.........EKVD.....................................
ENSBTAP00000055091  YHAG..-.P..................E.........GTCD.....................................
ENSBTAP00000017556  FQLQ..A.D..................G.........KTCK.....................................
ENSBTAP00000052487  AALQ..A.D..................G.........RSCG.....................................
ENSBTAP00000053786  FRLA..A.D..................G.........RSCE.....................................
ENSBTAP00000002944  YVLR..E.D..................R.........RMCK.....................................
ENSBTAP00000023842  LCLA..P.N..................G.........RACL.....................................
ENSBTAP00000010400  WSGD..D.C..................S.........ENID.....................................
ENSBTAP00000035484  FVID..I.H..................T.........GKPL.....................................
ENSBTAP00000046844  WTGE..H.C..................Q.........LRDF.....................................
ENSBTAP00000025815  FYGL..G.C..................R.........RRCG.....................................
ENSBTAP00000027416  ----..-.-..................-.........----.....................................
ENSBTAP00000025033  YTGE..H.C..................E.........VSAR.....................................
ENSBTAP00000027132  LEFT..PeD..................Q.........RHCT.....................................
ENSBTAP00000053357  FRGP..-.D..................C.........SLPD.....................................
ENSBTAP00000017556  YSLR..S.G..................Q.........QACEgvgsfllysvhegirgipldpndksdalvpvsgtsla
ENSBTAP00000049409  ----..-.-..................-.........----.....................................
ENSBTAP00000012158  TYYH..G.Q..................T.........EQCV.....................................
ENSBTAP00000053357  TLGV..L.C..................E.........INED.....................................
ENSBTAP00000026435  ----..-.-..................-.........----.....................................
ENSBTAP00000007756  ----..-.-..................-.........-PCA.....................................
ENSBTAP00000041372  FVGN..-.G..................R.........THCI.....................................
ENSBTAP00000033786  FTGR..F.C..................R.........YLRL.....................................
ENSBTAP00000053179  FRGV..S.C..................DrcargyigyPDCK.....................................
ENSBTAP00000046844  YTGG..S.C..................Q.........TLMD.....................................
ENSBTAP00000027416  HFYN..T.T..................T.........HRCI.....................................
ENSBTAP00000029274  HQAG..F.E..................G.........LQAE.....................................
ENSBTAP00000036514  ----..-.-..................-.........----.....................................
ENSBTAP00000004913  FQCK..-.E..................T.........GRCL.....................................
ENSBTAP00000039211  WQGN..-.-..................G.........YICE.....................................
ENSBTAP00000021495  FQCG..-.-..................T.........GRCI.....................................
ENSBTAP00000005988  ----..-.-..................-.........----.....................................
ENSBTAP00000039366  ----..-.-..................-.........----.....................................
ENSBTAP00000033786  LTGV..H.C..................E.........EDVD.....................................
ENSBTAP00000020455  ----..-.-..................-.........----.....................................
ENSBTAP00000001080  ----..-.-..................-.........----.....................................
ENSBTAP00000005817  WKKR..H.P..................Ga........LTCD.....................................
ENSBTAP00000037070  FEAA..E.G..................N.........TKCR.....................................
ENSBTAP00000015261  TFGE..N.C..................S.........QQCP.....................................
ENSBTAP00000005240  VLGA..K.E..................G.........EACG.....................................
ENSBTAP00000001511  EFLD..M.K..................D.........QSCKpcaegryslgtgirfdewdelphgfaslstnmeieds
ENSBTAP00000014664  HSPG..V.K..................Q.........RAVV.....................................
ENSBTAP00000008955  FYKA..S.D..................Gn........MKCA.....................................
ENSBTAP00000026780  YYRA..D.Ldpv...............D.........MPCTtipsapqavissvnetslmlewtpprdsggredl...
ENSBTAP00000037611  ----..-.-..................-.........----.....................................
ENSBTAP00000011078  QVVC..T.A..................F.........LPCT.....................................
ENSBTAP00000039368  ----..-.-..................-.........----.....................................
ENSBTAP00000008354  HYRA..P.G..................E.........GPHA.....................................
ENSBTAP00000001939  YYGK..G.L..................Q.........YECT.....................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000009285  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000011361  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000047769  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000055280  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000028738  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000029257  dgraytaishipqpaaqallpltpigglfgwlfalekpgwengfsltgatfihdvevtfypgeervritqtaegldpe
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000010680  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000029170  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000009531  mnhgrsytaistipetvgysllplapiggiigwmfaveqdgfkngfsitggeftrqaevtfvghrdkliikqqfsgid
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000005002  ..............................................................................
ENSBTAP00000018083  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000025803  ..............................................................................
ENSBTAP00000011877  ..............................................................................
ENSBTAP00000014377  ..............................................................................
ENSBTAP00000054551  ..............................................................................
ENSBTAP00000028615  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007349  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000003826  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000015268  ..............................................................................
ENSBTAP00000016342  ..............................................................................
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000037826  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000041521  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000018719  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002689  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000042093  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000012977  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000007931  ..............................................................................
ENSBTAP00000043345  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000027836  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000000946  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000013680  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000005529  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000008357  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000029084  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000004588  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000056590  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000052487  ..............................................................................
ENSBTAP00000053786  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000025815  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000027132  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000017556  vgidfhaendtiywvdmglstisrakrdqtwredvvtngigrvegiavdwiagniywtdqgfdvievarlngsfryvv
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000007756  ..............................................................................
ENSBTAP00000041372  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000004913  ..............................................................................
ENSBTAP00000039211  ..............................................................................
ENSBTAP00000021495  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000039366  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000020455  ..............................................................................
ENSBTAP00000001080  ..............................................................................
ENSBTAP00000005817  ..............................................................................
ENSBTAP00000037070  ..............................................................................
ENSBTAP00000015261  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000001511  tlestenctsskwvplgdyiasntdectatlmyavnlkqsgtvnfeyyypdssiifeffvqndqcqpnaddsrwmktt
ENSBTAP00000014664  ..............................................................................
ENSBTAP00000008955  ..............................................................................
ENSBTAP00000026780  ..............................................................................
ENSBTAP00000037611  ..............................................................................
ENSBTAP00000011078  ..............................................................................
ENSBTAP00000039368  ..............................................................................
ENSBTAP00000008354  ..............................................................................
ENSBTAP00000001939  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000009285  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000011361  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000047769  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000055280  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000028738  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000029257  nylsiktniqgqvpyipanfsahvapykelyhyadsavtststrtyslmsgainqtqtyrihqnityqvcrhaprhwa
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000010680  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000029170  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000009531  ehghltidtelegrvpqiafgssvhiepytelyhysrqvitsfstreytvteperhgtapshahtyrwrqtitfrecl
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000005002  ..............................................................................
ENSBTAP00000018083  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000025803  ..............................................................................
ENSBTAP00000011877  ..............................................................................
ENSBTAP00000014377  ..............................................................................
ENSBTAP00000054551  ..............................................................................
ENSBTAP00000028615  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007349  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000003826  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000015268  ..............................................................................
ENSBTAP00000016342  ..............................................................................
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000037826  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000041521  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000018719  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002689  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000042093  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000012977  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000007931  ..............................................................................
ENSBTAP00000043345  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000027836  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000000946  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000013680  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000005529  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000008357  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000029084  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000004588  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000056590  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000052487  ..............................................................................
ENSBTAP00000053786  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000025815  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000027132  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000017556  isqgldkpraitvhpekgylfwtewgqypriersrldgservvlvnvsiswpngisvdyqdgklywcdartdkierid
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000007756  ..............................................................................
ENSBTAP00000041372  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000004913  ..............................................................................
ENSBTAP00000039211  ..............................................................................
ENSBTAP00000021495  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000039366  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000020455  ..............................................................................
ENSBTAP00000001080  ..............................................................................
ENSBTAP00000005817  ..............................................................................
ENSBTAP00000037070  ..............................................................................
ENSBTAP00000015261  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000001511  ekgwefhsvelnrgnnvlywrttafsvwskvskpvlvrniaitgva................................
ENSBTAP00000014664  ..............................................................................
ENSBTAP00000008955  ..............................................................................
ENSBTAP00000026780  ..............................................................................
ENSBTAP00000037611  ..............................................................................
ENSBTAP00000011078  ..............................................................................
ENSBTAP00000039368  ..............................................................................
ENSBTAP00000008354  ..............................................................................
ENSBTAP00000001939  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               .............................................................................C
ENSBTAP00000008785  .............................................................................R
ENSBTAP00000036514  .............................................................................A
ENSBTAP00000053681  .............................................................................A
ENSBTAP00000053681  .............................................................................A
ENSBTAP00000053681  .............................................................................E
ENSBTAP00000036514  .............................................................................K
ENSBTAP00000034199  .............................................................................D
ENSBTAP00000036514  .............................................................................K
ENSBTAP00000015445  .............................................................................Q
ENSBTAP00000009285  .............................................................................-
ENSBTAP00000036514  .............................................................................S
ENSBTAP00000036514  .............................................................................R
ENSBTAP00000011361  .............................................................................P
ENSBTAP00000053668  .............................................................................E
ENSBTAP00000047769  .............................................................................P
ENSBTAP00000036514  .............................................................................N
ENSBTAP00000017556  .............................................................................D
ENSBTAP00000029056  .............................................................................P
ENSBTAP00000013790  .............................................................................-
ENSBTAP00000024122  .............................................................................D
ENSBTAP00000055280  .............................................................................P
ENSBTAP00000037465  .............................................................................D
ENSBTAP00000028738  .............................................................................D
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000013790  .............................................................................Q
ENSBTAP00000022815  .............................................................................P
ENSBTAP00000002944  .............................................................................D
ENSBTAP00000053681  .............................................................................-
ENSBTAP00000055091  .............................................................................D
ENSBTAP00000029257  .................................vpvtqqlnvdrvfalysdeekvlrfavtnqigpvegdseptpvnP
ENSBTAP00000027416  .............................................................................D
ENSBTAP00000015445  .............................................................................D
ENSBTAP00000005240  .............................................................................D
ENSBTAP00000006244  .............................................................................D
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000006244  .............................................................................E
ENSBTAP00000002944  .............................................................................D
ENSBTAP00000016040  .............................................................................D
ENSBTAP00000055091  .............................................................................E
ENSBTAP00000002944  .............................................................................D
ENSBTAP00000012158  .............................................................................D
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000010680  .............................................................................-
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000010571  .............................................................................S
ENSBTAP00000002944  .............................................................................D
ENSBTAP00000002944  .............................................................................D
ENSBTAP00000036514  .............................................................................P
ENSBTAP00000008880  .............................................................................D
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000053681  .............................................................................-
ENSBTAP00000027416  .............................................................................D
ENSBTAP00000012158  .............................................................................D
ENSBTAP00000029056  .............................................................................C
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000002944  .............................................................................D
ENSBTAP00000023206  .............................................................................D
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000027771  .............................................................................D
ENSBTAP00000029170  .............................................................................-
ENSBTAP00000053668  .............................................................................C
ENSBTAP00000053678  .............................................................................D
ENSBTAP00000054188  .............................................................................E
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000002944  .............................................................................D
ENSBTAP00000002944  .............................................................................D
ENSBTAP00000009531  ..........................hddsrpalpstqqlsvdsvfvlynqeerilryalsnsigpvrdgspdalqnP
ENSBTAP00000028604  .............................................................................D
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000037465  .............................................................................D
ENSBTAP00000005002  .............................................................................K
ENSBTAP00000018083  .............................................................................-
ENSBTAP00000022815  .............................................................................R
ENSBTAP00000026435  .............................................................................D
ENSBTAP00000028690  .............................................................................C
ENSBTAP00000011042  .............................................................................-
ENSBTAP00000029274  .............................................................................D
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000049409  .............................................................................D
ENSBTAP00000025803  .............................................................................-
ENSBTAP00000011877  .............................................................................P
ENSBTAP00000014377  .............................................................................D
ENSBTAP00000054551  .............................................................................D
ENSBTAP00000028615  .............................................................................-
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000007349  .............................................................................-
ENSBTAP00000001939  .............................................................................E
ENSBTAP00000009631  .............................................................................E
ENSBTAP00000029274  .............................................................................D
ENSBTAP00000016858  .............................................................................C
ENSBTAP00000003826  .............................................................................-
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000015268  .............................................................................-
ENSBTAP00000016342  .............................................................................D
ENSBTAP00000035185  .............................................................................E
ENSBTAP00000053357  .............................................................................D
ENSBTAP00000009629  .............................................................................E
ENSBTAP00000002944  .............................................................................D
ENSBTAP00000037826  .............................................................................-
ENSBTAP00000017746  .............................................................................E
ENSBTAP00000054188  .............................................................................D
ENSBTAP00000023206  .............................................................................D
ENSBTAP00000008785  .............................................................................E
ENSBTAP00000026435  .............................................................................D
ENSBTAP00000026435  .............................................................................D
ENSBTAP00000055091  .............................................................................D
ENSBTAP00000046844  .............................................................................E
ENSBTAP00000032310  .............................................................................E
ENSBTAP00000005988  .............................................................................D
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000007111  .............................................................................D
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000049409  .............................................................................D
ENSBTAP00000041521  .............................................................................D
ENSBTAP00000013316  .............................................................................E
ENSBTAP00000027771  .............................................................................R
ENSBTAP00000055091  .............................................................................D
ENSBTAP00000010400  .............................................................................E
ENSBTAP00000018719  .............................................................................-
ENSBTAP00000017556  .............................................................................I
ENSBTAP00000053678  .............................................................................D
ENSBTAP00000006244  .............................................................................D
ENSBTAP00000002689  .............................................................................-
ENSBTAP00000017746  .............................................................................D
ENSBTAP00000017746  .............................................................................D
ENSBTAP00000053357  .............................................................................P
ENSBTAP00000053357  .............................................................................D
ENSBTAP00000029938  .............................................................................S
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000003973  .............................................................................C
ENSBTAP00000010400  .............................................................................D
ENSBTAP00000042093  .............................................................................D
ENSBTAP00000017746  .............................................................................E
ENSBTAP00000012977  .............................................................................-
ENSBTAP00000053357  .............................................................................E
ENSBTAP00000007931  .............................................................................R
ENSBTAP00000043345  .............................................................................D
ENSBTAP00000004564  .............................................................................-
ENSBTAP00000027836  .............................................................................A
ENSBTAP00000049409  .............................................................................D
ENSBTAP00000009629  .............................................................................D
ENSBTAP00000010400  .............................................................................E
ENSBTAP00000017746  .............................................................................D
ENSBTAP00000008880  .............................................................................D
ENSBTAP00000008880  .............................................................................D
ENSBTAP00000017563  .............................................................................P
ENSBTAP00000000946  .............................................................................K
ENSBTAP00000053678  .............................................................................D
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000029274  .............................................................................D
ENSBTAP00000010400  .............................................................................P
ENSBTAP00000001939  .............................................................................-
ENSBTAP00000013680  .............................................................................D
ENSBTAP00000005240  .............................................................................D
ENSBTAP00000021383  .............................................................................P
ENSBTAP00000005240  .............................................................................D
ENSBTAP00000034199  .............................................................................D
ENSBTAP00000053357  .............................................................................P
ENSBTAP00000009531  .............................................................................D
ENSBTAP00000037465  .............................................................................P
ENSBTAP00000046844  .............................................................................C
ENSBTAP00000007111  .............................................................................D
ENSBTAP00000028604  .............................................................................D
ENSBTAP00000020360  .............................................................................E
ENSBTAP00000005529  .............................................................................D
ENSBTAP00000009631  .............................................................................D
ENSBTAP00000006244  .............................................................................D
ENSBTAP00000010390  .............................................................................D
ENSBTAP00000042993  .............................................................................A
ENSBTAP00000008357  .............................................................................-
ENSBTAP00000054188  .............................................................................-
ENSBTAP00000024122  .............................................................................D
ENSBTAP00000029084  .............................................................................D
ENSBTAP00000018790  .............................................................................E
ENSBTAP00000010400  .............................................................................E
ENSBTAP00000016040  .............................................................................D
ENSBTAP00000010390  .............................................................................D
ENSBTAP00000051405  .............................................................................P
ENSBTAP00000004588  .............................................................................D
ENSBTAP00000054781  .............................................................................-
ENSBTAP00000017746  .............................................................................E
ENSBTAP00000056590  .............................................................................A
ENSBTAP00000020360  .............................................................................D
ENSBTAP00000018790  .............................................................................A
ENSBTAP00000051405  .............................................................................S
ENSBTAP00000021383  .............................................................................P
ENSBTAP00000055091  .............................................................................D
ENSBTAP00000017556  .............................................................................D
ENSBTAP00000052487  .............................................................................L
ENSBTAP00000053786  .............................................................................D
ENSBTAP00000002944  .............................................................................D
ENSBTAP00000023842  .............................................................................D
ENSBTAP00000010400  .............................................................................D
ENSBTAP00000035484  .............................................................................D
ENSBTAP00000046844  .............................................................................C
ENSBTAP00000025815  .............................................................................Q
ENSBTAP00000027416  .............................................................................-
ENSBTAP00000025033  .............................................................................S
ENSBTAP00000027132  .............................................................................D
ENSBTAP00000053357  .............................................................................P
ENSBTAP00000017556  letgedrevvlssnnmdmfsvsvfeefiywsdrthangsikrgskdnatdsvplrtgigvqlkdikvfnrdrqkgtnV
ENSBTAP00000049409  .............................................................................-
ENSBTAP00000012158  .............................................................................P
ENSBTAP00000053357  .............................................................................D
ENSBTAP00000026435  .............................................................................-
ENSBTAP00000007756  .............................................................................D
ENSBTAP00000041372  .............................................................................D
ENSBTAP00000033786  .............................................................................P
ENSBTAP00000053179  .............................................................................P
ENSBTAP00000046844  .............................................................................L
ENSBTAP00000027416  .............................................................................R
ENSBTAP00000029274  .............................................................................E
ENSBTAP00000036514  .............................................................................-
ENSBTAP00000004913  .............................................................................K
ENSBTAP00000039211  .............................................................................D
ENSBTAP00000021495  .............................................................................K
ENSBTAP00000005988  .............................................................................P
ENSBTAP00000039366  .............................................................................-
ENSBTAP00000033786  .............................................................................E
ENSBTAP00000020455  .............................................................................-
ENSBTAP00000001080  .............................................................................-
ENSBTAP00000005817  .............................................................................E
ENSBTAP00000037070  .............................................................................A
ENSBTAP00000015261  .............................................................................H
ENSBTAP00000005240  .............................................................................D
ENSBTAP00000001511  .............................................................................Y
ENSBTAP00000014664  .............................................................................-
ENSBTAP00000008955  .............................................................................K
ENSBTAP00000026780  .............................................................................V
ENSBTAP00000037611  .............................................................................-
ENSBTAP00000011078  .............................................................................V
ENSBTAP00000039368  .............................................................................-
ENSBTAP00000008354  .............................................................................A
ENSBTAP00000001939  .............................................................................A


                                                               60             70                    
                                                                |              |                    
d2dtge6               .....CHS.......................ECL......GNCS..QPD...DPTKCV.AC.......RNFYL...D.
ENSBTAP00000008785  .....CHK.......................GCE......-TCS..GRG...-STQCL.TCrr.....GFYHHqe.V.
ENSBTAP00000036514  .....CHA.......................KCL......-HCT..GPS...-EFQCQ.TClr.....DSLLL...N.
ENSBTAP00000053681  .....CDQ.......................SCK......-SCG..PS-...-SPRCL.TCve.....KTVLH...D.
ENSBTAP00000053681  .....CHP.......................SCS......-ACA..GMS...-PHNCT.ACwp.....SHMLL...D.
ENSBTAP00000053681  .....CDW.......................SCN......-VCS..GPL...-RTDCL.QCmd.....GYVLQ...D.
ENSBTAP00000036514  .....CDA.......................SCL......-TCN..GPG...-IKNCT.SCps.....GYLLD...L.
ENSBTAP00000034199  .....IDEcslgf..................PCS......QQCI..NTY...GTYKC-.--.......-----...-.
ENSBTAP00000036514  .....CAP.......................NCD......-SCF..GSH...-GDQCL.SCky.....GYFLNee.T.
ENSBTAP00000015445  .....CHP.......................ECLpqamn.VTCT..GRG...-PGNCV.KC.......AHYID...G.
ENSBTAP00000009285  .....---.......................---......----..---...------.--.......-----...-.
ENSBTAP00000036514  .....CHE.......................DCL......-ECS..GPW...-ADDCD.LCaea....SLVLY...D.
ENSBTAP00000036514  .....CHP.......................TCD......-KCK..GKG...-ALNCL.SCvw.....SYHLA...G.
ENSBTAP00000011361  .....CSEekla...................RCRpp....VGCE..ELV...REPGC-.--.......-----...-.
ENSBTAP00000053668  .....CDP.......................QCEkmedgiLTCH..GPG...-PDNCT.KC.......SHFKD...G.
ENSBTAP00000047769  .....CDA.......................RAV......AQCA..PPP...PSPPC-.--.......-----...-.
ENSBTAP00000036514  .....CTE.......................DCA......-SCS..E--...-VNLCQ.KCqtrpdr.PLFLH...Q.
ENSBTAP00000017556  .....MDEcsttf..................PCS......QRCI..NTH...GSYKC-.--.......-----...-.
ENSBTAP00000029056  .....CHP.......................ECHpqngs.VTCF..GSE...-ADQCV.AC.......AHYKD...P.
ENSBTAP00000013790  .....CDP.......................LCS......GGCW..GPG...-PGQCL.SC.......RNYSR...G.
ENSBTAP00000024122  .....VNEcaten..................PCV......QTCV..NTY...GSFIC-.--.......-----...-.
ENSBTAP00000055280  .....CSAerma...................LCPpvp...ASCP..ELT...RSAGCG.--.......-----...-.
ENSBTAP00000037465  .....IDEcsfer..................TCD......HTCI..NSP...GSFQC-.--.......-----...-.
ENSBTAP00000028738  .....TDEclgt...................PCQ......QRCK..NSI...GSYRC-.--.......-----...-.
ENSBTAP00000035484  .....TDEcsigh..................PCGg.....GTCT..NVI...GGFEC-.--.......-----...-.
ENSBTAP00000013790  ....cCHD.......................ECA......GGCS..GPQ...-NTDCF.AC.......RLFND...S.
ENSBTAP00000022815  .....VDYcasenh.................GCE......HECV..NAD...GSYLC-.--.......-----...-.
ENSBTAP00000002944  .....INEcerd...................ACGn.....GTCR..NTI...GSFNC-.--.......-----...-.
ENSBTAP00000053681  .....CHP.......................DCL......-TCS..QS-...-PDHCD.LCqd.....PTKLLr..N.
ENSBTAP00000055091  .....VDEcrrvpt.................PCAp.....GRCE..NTP...GSFRC-.--.......-----...-.
ENSBTAP00000029257  .....CYDgsh....................TCAtt....A---..---...------.RCh......PATGV...D.
ENSBTAP00000027416  .....VDEcsldr..................TCD......HSCI..NHP...GTFTC-.--.......-----...-.
ENSBTAP00000015445  ....cCHN.......................QCA......AGCT..GPR...-ESDCL.VC.......RRFRD...E.
ENSBTAP00000005240  .....VNEcwtsptr................LCQ......HTCE..NTL...GSYRC-.--.......-----...-.
ENSBTAP00000006244  .....VDEcrrvpt.................PCAp.....GRCE..NTP...GSFRC-.--.......-----...-.
ENSBTAP00000020360  .....HDEctttn..................MCLn.....GMCI..NED...GSFKC-.--.......-----...-.
ENSBTAP00000035484  .....HNEcattt..................MCAn.....GVCL..NED...GSFTC-.--.......-----...-.
ENSBTAP00000035484  .....VDEcslsdg.................LCPh.....GQCV..NVI...GAFQC-.--.......-----...-.
ENSBTAP00000020360  .....TDEcsign..................PCGn.....GTCT..NVI...GSFEC-.--.......-----...-.
ENSBTAP00000035484  .....IDEcrispd.................LCGq.....GTCV..NTP...GSFEC-.--.......-----...-.
ENSBTAP00000006244  .....CAQepp....................PCGp.....GRCD..NTV...GSFHC-.--.......-----...-.
ENSBTAP00000002944  .....VDEcekn...................PCAg.....GECI..NTQ...GSYTC-.--.......-----...-.
ENSBTAP00000016040  .....INEcrrypgr................LCG......HKCE..NTP...GSYYC-.--.......-----...-.
ENSBTAP00000055091  .....CAQepp....................PCGp.....GRCD..NTV...GSFHC-.--.......-----...-.
ENSBTAP00000002944  .....LDEcatkqh.................NCQ......FLCV..NTI...GSFTC-.--.......-----...-.
ENSBTAP00000012158  .....VDEceredna................GCV......HDCV..NIP...GNYRC-.--.......-----...-.
ENSBTAP00000020360  .....VDEctsn...................PCTn.....GDCV..NTP...GSYYC-.--.......-----...-.
ENSBTAP00000010680  .....CQG.......................GCA......-TCS..D--...-YNGCL.SCkp.....KLFFVl..Er
ENSBTAP00000035484  .....VDEcalnsl.................LCDn.....GRCR..NSP...GSYSC-.--.......-----...-.
ENSBTAP00000010571  ...grCAHg......................VCKng....GTCV..NLLi..GGFHC-.--.......-----...-.
ENSBTAP00000002944  .....MDEcsirn..................MCLn.....GMCI..NED...GSFKC-.--.......-----...-.
ENSBTAP00000002944  .....IDEcrispd.................LCGr.....GQCV..NTP...GDFEC-.--.......-----...-.
ENSBTAP00000036514  .....CHF.......................TCQ......-ECQ..GDE...-PSNCT.SCgvdkhgqERFLY...W.
ENSBTAP00000008880  .....INEcdfpa..................ACIg.....GDCI..NTN...GSYRC-.--.......-----...-.
ENSBTAP00000020360  .....VDEcerh...................PCGn.....GTCK..NTV...GSYNC-.--.......-----...-.
ENSBTAP00000053681  .....CHP.......................LCH......-HCA..ANLrd.TGSVCL.QCqna....RNLLL...G.
ENSBTAP00000027416  .....IDEcenelng................GCV......HDCL..NIP...GNYRC-.--.......-----...-.
ENSBTAP00000012158  .....IDEcsfdr..................TCD......HICV..NTP...GSFQC-.--.......-----...-.
ENSBTAP00000029056  .....CHE.......................QCA......AGCT..GPK...-HSDCL.AC.......LHFNH...S.
ENSBTAP00000020360  .....LDEcqtkqh.................NCQ......FLCV..NTL...GGFTC-.--.......-----...-.
ENSBTAP00000002944  .....TDEcsvgn..................PCGn.....GTCK..NVI...GGFEC-.--.......-----...-.
ENSBTAP00000023206  .....INEcdasn..................QCA......QQCY..NIL...GSFIC-.--.......-----...-.
ENSBTAP00000035484  .....VDEcdrq...................PCGn.....GTCK..NIV...GSYNC-.--.......-----...-.
ENSBTAP00000027771  .....VDDcaasp..................CCQ......QVCT..NSP...GGYEC-.--.......-----...-.
ENSBTAP00000029170  .....---.......................-CV......-ICS..E--...-ENGCS.TCqq.....RLFLFi..Sr
ENSBTAP00000053668  .....CHR.......................ECA......GGCS..GPK...-DTDCF.AC.......MNFND...S.
ENSBTAP00000053678  .....IDEcalggy.................TCHag....QDCD..NTI...GSYRC-.--.......-----...-.
ENSBTAP00000054188  .....CAQepp....................PCGp.....GRCD..NTV...GSFHC-.--.......-----...-.
ENSBTAP00000020360  .....INEcslsdn.................LCRn.....GKCV..NMI...GTYQC-.--.......-----...-.
ENSBTAP00000002944  .....IDEcsimng.................GCE......TFCT..NSE...GSYEC-.--.......-----...-.
ENSBTAP00000002944  .....LDEcsngth.................MCSqh....ADCK..NTM...GSYRC-.--.......-----...-.
ENSBTAP00000009531  .....CYIgsh....................GCDsn....AACRp.GPG...TQFTC-.--.......-----...-.
ENSBTAP00000028604  .....VNEcdmga..................PCE......QRCF..NSY...GTFLC-.--.......-----...-.
ENSBTAP00000020360  .....IDEcrispd.................LCGs.....GICV..NTP...GSFEC-.--.......-----...-.
ENSBTAP00000037465  .....IDEcendhyng...............GCV......HECI..NIP...GNYRC-.--.......-----...-.
ENSBTAP00000005002  .....CKIe......................HCE......-ACF..S--...-HNFCT.KCqe.....SLYLH...K.
ENSBTAP00000018083  .....---.......................ICK......-GCL..SCS...KDNGCS.RCqqkl...F--FFlrrEg
ENSBTAP00000022815  ..vdhCAEqdh....................GCE......QLCL..NTE...DSFVC-.--.......-----...-.
ENSBTAP00000026435  .....INEcledks.................VCQg.....GDCI..NTK...GSYEC-.--.......-----...-.
ENSBTAP00000028690  .....CHP.......................ECL......GSCS..APD...NATACV.AC.......RHYYY...A.
ENSBTAP00000011042  .....CPE.......................RCDp.....ARCA..PPP...G-----.--.......-----...-.
ENSBTAP00000029274  .....VDEcvgee..................YCApr....GECL..NSH...GSFFC-.--.......-----...-.
ENSBTAP00000020360  .....LDEcsngth.................QCSin....AQCV..NTP...GSYRC-.--.......-----...-.
ENSBTAP00000049409  .....INEcledks.................VCQg.....GDCI..NTK...GSYEC-.--.......-----...-.
ENSBTAP00000025803  .....---.......................---......----..---...------.--.......-----...-.
ENSBTAP00000011877  .....CDEs......................KCEep....KSCP..GSI...VQGFC-.GC.......CYMCArqrN.
ENSBTAP00000014377  .....IDEcgtera.................SCGad....QFCV..NTE...GSYECR.DCakacl..GCMGAg..P.
ENSBTAP00000054551  .....VDEcaaepp.................PCEdt....QYCE..NVN...GSFVCE.ECdptcm..GCTGKg..P.
ENSBTAP00000028615  .....---.......................---......----..---...------.--.......-----...-.
ENSBTAP00000020360  .....IDEcsfqn..................ICVf.....GTCN..NLP...GMFHC-.--.......-----...-.
ENSBTAP00000020360  .....LDEcaeglh.................DCEsrg...MMCK..NLI...GTFMC-.--.......-----...-.
ENSBTAP00000035484  .....VDEcvlrn..................ICVf.....GSCE..NLP...GMFRC-.--.......-----...-.
ENSBTAP00000007349  .....---.......................---......----..---...------.--.......-----...-.
ENSBTAP00000001939  .....CISs......................PCLnk....GTCV..DGL...AGYHC-.--.......-----...-.
ENSBTAP00000009631  .....CASn......................PCLng....GHCQ..NEI...NRFQC-.--.......-----...-.
ENSBTAP00000029274  .....INEcrhpg..................TCPd.....GKCV..NSP...GSYTCL.--.......-----...-.
ENSBTAP00000016858  .....CHS.......................ECL......GNCS..EPD...DPTKCV.AC.......RNFYL...D.
ENSBTAP00000003826  .....---.......................---......--CK..TLT...SSQACV.VCee.....GFSLH...Q.
ENSBTAP00000035484  .....LDEcaskeh.................GCSpr....ADCL..NAP...GSYRC-.--.......-----...-.
ENSBTAP00000015268  .....---.......................---......----..---...------.--.......-----...-.
ENSBTAP00000016342  .....NKG.......................GCS......HICN..DLK...IGYEC-.--.......-----...-.
ENSBTAP00000035185  .....CSQeng....................GCS......QICY..NQP...GSFQC-.--.......-----...-.
ENSBTAP00000053357  .....CDPn......................PCLng....GSCQ..DGV...GSFSC-.--.......-----...-.
ENSBTAP00000009629  .....CASs......................PCHg.....GLCE..DLV...DGFRC-.--.......-----...-.
ENSBTAP00000002944  .....ENEclsah..................ICGg.....ASCH..NTL...GSYKC-.--.......-----...-.
ENSBTAP00000037826  .....---.......................---......----..---...------.--.......-----...-.
ENSBTAP00000017746  .....CASs......................PCLqn....GRCL..DKI...NEFVC-.--.......-----...-.
ENSBTAP00000054188  .....IDEcqeygpa................ICGa.....QRCE..NTP...GSYRC-.--.......-----...-.
ENSBTAP00000023206  .....IDEctagth.................NCRad....QVCI..NLR...GSFAC-.--.......-----...-.
ENSBTAP00000008785  .....CHH.......................TCR......-TCV..GPS...-REECI.HCap.....GFHFQ...D.
ENSBTAP00000026435  .....IDEcaqdqh.................LCSq.....GRCE..NTE...GSFLC-.--.......-----...-.
ENSBTAP00000026435  .....VDEclepk..................ICTn.....GTCS..NLE...GSYMC-.--.......-----...-.
ENSBTAP00000055091  .....VDEcenhl..................ACPg.....QECV..NSP...GSFQCR.ACpa.....GHHLH...H.
ENSBTAP00000046844  .....CASa......................PCLnq....ADCH..DLL...NGFQC-.--.......-----...-.
ENSBTAP00000032310  .....CKDpvning.................GCS......QICE..NTP...GSYHC-.--.......-----...-.
ENSBTAP00000005988  ..fddCQIwg.....................VCD......QLCE..DRI...GHHRC-.--.......-----...-.
ENSBTAP00000035484  .....NDEclaqpg.................PCGtr....GRCH..NAP...GSFSC-.--.......-----...-.
ENSBTAP00000007111  .....VDEcleqtd.................ECHyn....QTCE..NIP...GGHRC-.--.......-----...-.
ENSBTAP00000035484  .....VDEcqavpg.................LCQg.....GSCV..NTV...GSFEC-.--.......-----...-.
ENSBTAP00000049409  .....IDEcaqdqh.................LCSq.....GRCE..NTE...GSFLC-.--.......-----...-.
ENSBTAP00000041521  .....VNEcaeeg..................YCS......QGCT..NSE...GAFQC-.--.......-----...-.
ENSBTAP00000013316  .....CLPs......................PCKng....AICQ..NFP...GGFNC-.--.......-----...-.
ENSBTAP00000027771  .....RNPcadrng.................GCM......HRCR..ALR...GLAHC-.--.......-----...-.
ENSBTAP00000055091  .....VDEcseed..................LCQs.....GICT..NTD...GSFEC-.--.......-----...-.
ENSBTAP00000010400  .....CHSd......................PCKnd....ATCL..DKI...GGFTC-.--.......-----...-.
ENSBTAP00000018719  .....--Vpgivardec..............GCC......ALCL..GAE...-GASC-.--.......-----...G.
ENSBTAP00000017556  ..qsyCAKhl.....................KCS......QKCD..QNK...FSVKC-.--.......-----...-.
ENSBTAP00000053678  .....INEcrqn...................VCRpd....QHCK..NTR...GGYKCIdLCpn.....GMTKAe..N.
ENSBTAP00000006244  .....VDEcseed..................LCQs.....GICT..NTD...GSFEC-.--.......-----...-.
ENSBTAP00000002689  .....---.......................--L......-VCA..RQR...-GESC-.--.......-----...-.
ENSBTAP00000017746  .....CNPpidpvsrgp..............KCFnn....GTCV..DQV...GGYSC-.--.......-----...-.
ENSBTAP00000017746  .....CRPn......................PCHng....GSCT..DGI...NTAFC-.--.......-----...-.
ENSBTAP00000053357  .....CLAq......................PCQhg....GTCR..GYT...GGYVC-.--.......-----...-.
ENSBTAP00000053357  .....CASn......................PCTf.....GVCR..DGI...NRYDC-.--.......-----...-.
ENSBTAP00000029938  ..altCSMa......................NCQ......YGCD..VVK...GQIRC-.--.......-----...-.
ENSBTAP00000020360  ..eneCSNpn.....................ACGs.....ASCY..NTL...GSYKC-.--.......-----...-.
ENSBTAP00000003973  .....CHA.......................ECL......GGCS..RPE...DPRACV.AC.......RHLYF...Q.
ENSBTAP00000010400  .....CASn......................PCVh.....GVCM..DGV...NRYSC-.--.......-----...-.
ENSBTAP00000042093  .....CASs......................PCAhg....GTCR..DGV...NEYSC-.--.......-----...-.
ENSBTAP00000017746  .....CADs......................PCHng....GTCE..DGI...NGFTC-.--.......-----...-.
ENSBTAP00000012977  .....---.......................---......----..---...------.--.......-----...-.
ENSBTAP00000053357  .....CLSg......................PCRnq....ATCL..DRI...GQFTC-.--.......-----...-.
ENSBTAP00000007931  ....vCARrlge...................PCDhl....HVCD..PSQ...-GLVCQ.--.......-----...-.
ENSBTAP00000043345  .....LDEcavlgah................NCSat....KSCV..NTL...GSYTC-.--.......-----...-.
ENSBTAP00000004564  .....---.......................---......----..---...------.--.......-----...-.
ENSBTAP00000027836  .....QDQcalgth.................GCQ......HICV..NDRa..GSHHC-.--.......-----...-.
ENSBTAP00000049409  .....IDEcqqgt..................MCMn.....GQCK..NTD...GSFRC-.--.......-----...-.
ENSBTAP00000009629  .....CNPl......................PCYng....GVCV..DGV...NWFRC-.--.......-----...-.
ENSBTAP00000010400  .....CSSn......................PCQhg....ATCR..DFI...GGYRC-.--.......-----...-.
ENSBTAP00000017746  .....CASa......................SCFqg....ATCH..DRV...ASFYC-.ECphgrt..GLLCHl..N.
ENSBTAP00000008880  .....VNEceae...................PCGagr...GICM..NTG...GSYNC-.--.......-----...-.
ENSBTAP00000008880  .....IDEcrdps..................TCPd.....SKCE..NKP...GSFKCI.--.......-----...-.
ENSBTAP00000017563  .....CQPn......................PCHga....APCRv.LPQ...GEAKC-.--.......-----...-.
ENSBTAP00000000946  ....mCAQqlgd...................NCTea....AVCD..---...------.--.......-----...-.
ENSBTAP00000053678  .....INEcentd..................TCQ......HECK..NTF...GSYQC-.--.......-----...-.
ENSBTAP00000035484  .....ENEcvlsps.................ACGs.....ASCH..NTL...GGFRC-.--.......-----...-.
ENSBTAP00000029274  .....IDEcedlgep................ICGa.....WRCE..NSP...GSYRC-.--.......-----...-.
ENSBTAP00000010400  .....CSPn......................PCEna....GVCK..EAPnf.ESYSC-.--.......-----...-.
ENSBTAP00000001939  .....---.......................SCLm.....GSYQ..DEE...GQLECK.PCptgtyt.EYL-HsrsS.
ENSBTAP00000013680  .....CARs......................PCVhg....GTCH..DLE...NGFVC-.--.......-----...-.
ENSBTAP00000005240  .....IDEcaqgasi................LCT......FRCI..NVP...GSYQC-.--.......-----...-.
ENSBTAP00000021383  .....CANv......................SCLng....GTCD..SEG...LNGTC-.--.......-----...-.
ENSBTAP00000005240  .....INEcvtdlh.................TCSrr....EHCV..NTV...GSFHCY.--.......-----...-.
ENSBTAP00000034199  .....LNEclvfg..................TCS......HQCI..NTE...GSYKC-.VChq.....NFQER...N.
ENSBTAP00000053357  .....CLSr......................PCMhg....GVCT..AAH...PGFHC-.--.......-----...-.
ENSBTAP00000009531  .....VDEcqps...................RCHpd....AFCY..NTP...GSFTC-.RCks.....GYQGD...G.
ENSBTAP00000037465  .....CPSsdglglagarnvs..........E--......----..---...------.--.......-----...-.
ENSBTAP00000046844  .....LSQ.......................PCHee....AQCS..TNPls.GSTLC-.--.......-----...-.
ENSBTAP00000007111  .....LDEcrvrn..................LCQ......HACR..NTE...GSYQC-.--.......-----...-.
ENSBTAP00000028604  .....VNEcltipe.................ACKge....MKCI..NHY...GGYLC-.--.......-----...-.
ENSBTAP00000020360  .....CALdpd....................ICAn.....GICE..NLR...GSYRC-.--.......-----...-.
ENSBTAP00000005529  .....CPE.......................RCDs.....SQCK..S--...-SSRC-.--.......-----...-.
ENSBTAP00000009631  .....CSPh......................PCYns....GTCV..DGE...NWYRC-.--.......-----...-.
ENSBTAP00000006244  .....VDEcssga..................SCGph....GHCT..NTE...GSFHC-.--.......-----...-.
ENSBTAP00000010390  .....VDEcanpr..................SCPeh....STCH..NSL...GSYSC-.--.......-----...-.
ENSBTAP00000042993  ....fCQD.......................GCRng....GACI..A--...-ANVC-.--.......-----...-.
ENSBTAP00000008357  .....---.......................---......----..---...------.--.......-----...-.
ENSBTAP00000054188  .....---.......................VCGr.....GRCI..PRP...SGYTC-.--.......-----...-.
ENSBTAP00000024122  .....VDEcrtipe.................ACRgd....MMCV..NQN...GGYLC-.--.......-----...-.
ENSBTAP00000029084  .....VNEctsgkk.................PCHss....THCL..NSV...GSYEC-.--.......-----...-.
ENSBTAP00000018790  .....CSSd......................PCLng....GSCV..DLV...GNFTC-.LCae.....PFEGP...-.
ENSBTAP00000010400  .....CNSh......................PCLne....GVCV..DGL...GTYRC-.--.......-----...-.
ENSBTAP00000016040  .....VNEcitggq.................SCRlg....ETCV..NTA...GSFRC-.--.......-----...-.
ENSBTAP00000010390  .....VDEcanpr..................SCPeh....STCH..NSL...GSYSC-.--.......-----...-.
ENSBTAP00000051405  .....GHS.......................PCA......QSCT..NTE...GSFYC-.--.......-----...-.
ENSBTAP00000004588  .....VNEctsgkk.................PCHss....THCL..NSM...GSYEC-.--.......-----...-.
ENSBTAP00000054781  .....---.......................---......----..---...------.--.......-----...-.
ENSBTAP00000017746  .....CDSr......................PCLhg....GTCH..DSY...GTYTC-.--.......-----...-.
ENSBTAP00000056590  .....CDSs......................PCQhg....GRCE..NGG...GAYLC-.--.......-----...-.
ENSBTAP00000020360  .....VDEcqaipg.................ICQg.....GNCI..NTV...GSFEC-.--.......-----...-.
ENSBTAP00000018790  .....CDSs......................PCQhg....GRCE..NGG...GAYLC-.--.......-----...-.
ENSBTAP00000051405  ..rnpCSSn......................PCGge....ATCFpgSLG...TDFTC-.--.......-----...-.
ENSBTAP00000021383  .....CASa......................PCQnn....GTCY..ADG...LHFGC-.--.......-----...-.
ENSBTAP00000055091  .....IDEcqeygpa................ICGa.....QRCE..NTP...GSYRC-.--.......-----...-.
ENSBTAP00000017556  .....FDEcsvyg..................TCS......QLCT..NTD...GSFTC-.--.......-----...-.
ENSBTAP00000052487  paehpCHQ.......................LCE......HFCHl.HGL...GNYTC-.--.......-----...-.
ENSBTAP00000053786  ....pCAHa......................PCE......QQCEp.GGP...QGYSC-.--.......-----...-.
ENSBTAP00000002944  ..edeCEEgkh....................DCAekq...MECK..NLI...GTYLC-.--.......-----...-.
ENSBTAP00000023842  .....IDEcvsdk..................LCPyn....RRCV..NTF...GSYYC-.--.......-----...-.
ENSBTAP00000010400  .....CAFa......................SCTpg....STCI..DRV...ASFSC-.--.......-----...-.
ENSBTAP00000035484  .....IDEcgeipa.................ICAs.....GVCI..NQI...GSFRC-.--.......-----...-.
ENSBTAP00000046844  .....SAN.......................PCVng....GVCL..ATY...PQIQC-.--.......-----...-.
ENSBTAP00000025815  .....CKGqq.....................PCT......---V..---...AEGRCL.TC.......EPGWN...G.
ENSBTAP00000027416  .....---.......................---......----..--H...GGNQCV.SCra.....GTYYDga.Q.
ENSBTAP00000025033  ...grCTPg......................VCKng....GTCV..NLLv..GGFKC-.--.......-----...-.
ENSBTAP00000027132  .....VNEcisgrn.................PCHss....AHCL..NSV...DSFEC-.--.......-----...-.
ENSBTAP00000053357  .....CLSs......................PCAhg....ARCSv.GSD...GRYLC-.--.......-----...-.
ENSBTAP00000017556  .....CAVdng....................GCQ......QLCL..YRGn..GQRAC-.ACah.....GMLAE...D.
ENSBTAP00000049409  .....--Iln.....................GCEn.....GRCV..RVQ...EGYTC-.--.......-----...-.
ENSBTAP00000012158  .....CPA.......................G--......-TFQ..ERE...GQLSCD.LCpgsdah.GPLGA...T.
ENSBTAP00000053357  .....CGPgpaldlgp...............RCLhn....GTCV..DLV...GGFRC-.--.......-----...-.
ENSBTAP00000026435  .....--Iln.....................GCEn.....GRCV..RVQ...EGYTC-.--.......-----...-.
ENSBTAP00000007756  .....RNG.......................GCS......HLCF..FTP...RATKC-.--.......-----...-.
ENSBTAP00000041372  ..kdeCQYgasv...................VCGnh....TSCH..NIP...GGFYC-.ICle.....GYRAT...N.
ENSBTAP00000033786  ..stvCGNekanl..................TCYng....GNCT..AFQ...GEMKC-.--.......-----...-.
ENSBTAP00000053179  .....CNCsgagstned..............PCFgp....CNCK..ENV...E-----.--.......-----...G.
ENSBTAP00000046844  .....CAQk......................PCPqn....SHCL..QTG...PSFQC-.--.......-----...-.
ENSBTAP00000027416  .....CPA.......................G--......-TYQ..PEF...GKNHCV.SCpg.....NTTTDf..D.
ENSBTAP00000029274  .....CGIln.....................GCEn.....GRCV..RVR...EGYTC-.--.......-----...-.
ENSBTAP00000036514  .....---.......................---......HNCF..SSD...-YSQCL.SCcf.....FFFFL...S.
ENSBTAP00000004913  .....RHL.......................VCNgd....KDCL..DGS...DEDDCE.--.......DVRIL...E.
ENSBTAP00000039211  .....INEceinng.................GCSvapl..VECI..NTH...GSYHCH.--.......-----...-.
ENSBTAP00000021495  .....NRL.......................LCNed....NDCG..DYS...DEDNC-.--.......-----...-.
ENSBTAP00000005988  .....CSYt......................RCS......HLCLl.SSK...SLYSC-.--.......-----...-.
ENSBTAP00000039366  .....---.......................---......----..---...----C-.MCka.....GYEEK...N.
ENSBTAP00000033786  .....CLSs......................PCRng....GTCE..NSP...EGYTC-.--.......-----...-.
ENSBTAP00000020455  .....---.......................---......----..---...----C-.--.......-----...-.
ENSBTAP00000001080  .....---.......................---......----..---...---QC-.--.......-----...-.
ENSBTAP00000005817  ...aiCAK.......................PCQng....GVCV..R--...-PDQC-.--.......-----...-.
ENSBTAP00000037070  .....CAQgtfkplsgegscq..........PCPa.....NSHS..NAI...GSSIC-.--.......-----...-.
ENSBTAP00000015261  .....CRLge.....................ACQ......----..--P...DTGHCQ.RC.......EPGWR...G.
ENSBTAP00000005240  .....EDSd......................TCG......----..VSL...YKQCC-.DCcgl....GLRVRae.G.
ENSBTAP00000001511  .....T-Secf....................PCKp.....GTYA..DQQ...GSSSCK.LCpa.....NFYSNkg.E.
ENSBTAP00000014664  .....---.......................RCQ......-TCK..---...-INLCL.ECq......KRTHS...G.
ENSBTAP00000008955  .....CPP.......................HSS......-THE..D--...GSVNC-.--.......-----...-.
ENSBTAP00000026780  .....YNI.......................ICK......-SCG..S--...GRGACT.RC.......-----...-.
ENSBTAP00000037611  .....---.......................---......----..---...----C-.VCsa.....GYEER...R.
ENSBTAP00000011078  .....GDAa......................ACL......-SCA..PDN...-RTRCG.TCnt.....GYMLS...Q.
ENSBTAP00000039368  .....---.......................---......----..---...---KC-.ICka.....GFQQK...G.
ENSBTAP00000008354  .....CTRppsiprnlsfsvsgtqlslrwepPADl.....GERE..DVT...YNVECS.QCq......GAALD...G.
ENSBTAP00000001939  .....CPSgtykpegspggistcl.......PCPd.....ENHT..SPPgstSPEDC-.VCke.....GYQAS...G.


                              80                                                              90    
                               |                                                               |    
d2dtge6               ......G..RCVE..................................................TCP....PPYYHF..
ENSBTAP00000008785  ......N..SCVT..................................................LCP....AGFYAD..
ENSBTAP00000036514  ......T..TCMQ..................................................DCP....EGYYAD..
ENSBTAP00000053681  ......G..KCIS..................................................ECP....GGYYAD..
ENSBTAP00000053681  ......G..ECLS..................................................QCP....DGYFNQ..
ENSBTAP00000053681  ......G..ACVE..................................................QCS....ASFYRD..
ENSBTAP00000036514  ......G..MCQMga................................................ICK....DGEYVD..
ENSBTAP00000034199  ......-..----..................................................LCT....DGYEIQ..
ENSBTAP00000036514  ......N..SCVT..................................................HCP....DGSYQD..
ENSBTAP00000015445  ......P..HCVK..................................................TCP....AGVAGE..
ENSBTAP00000009285  ......-..----..................................................---....------..
ENSBTAP00000036514  ......G..QCLD..................................................ECP....EGTYLE..
ENSBTAP00000036514  ......G..LCTS..................................................DCL....VGEYRV..
ENSBTAP00000011361  ......-..----..................................................---....------..
ENSBTAP00000053668  ......P..NCVE..................................................KCP....DGLQGA..
ENSBTAP00000047769  ......-..----..................................................--A....ELVREP..
ENSBTAP00000036514  ......G..RCST..................................................RCP....EGFYAD..
ENSBTAP00000017556  ......-..----..................................................LCV....EGYAPR..
ENSBTAP00000029056  ......P..FCVA..................................................RCP....SGVKPD..
ENSBTAP00000013790  ......G..VCVT..................................................HCN....---FLN..
ENSBTAP00000024122  ......-..----..................................................RCD....PGYELE..
ENSBTAP00000055280  ......-..----..................................................---....------..
ENSBTAP00000037465  ......-..----..................................................LCH....RGYTLY..
ENSBTAP00000028738  ......-..----..................................................SCR....TGFHLH..
ENSBTAP00000035484  ......-..----..................................................ACA....DGFEPG..
ENSBTAP00000013790  ......G..ACVR..................................................QCP....QPLVYN..
ENSBTAP00000022815  ......-..----..................................................RCP....KGFALN..
ENSBTAP00000002944  ......-..----..................................................RCN....HGFILS..
ENSBTAP00000053681  ......G..QCVH..................................................SCG....LGFYQA..
ENSBTAP00000055091  ......-..----..................................................VCG....PGFRAG..
ENSBTAP00000029257  ......Y..TCE-..................................................-CA....SGYQGD..
ENSBTAP00000027416  ......-..----..................................................ACS....EGYTLY..
ENSBTAP00000015445  ......A..TCKD..................................................TCP....PLMLYD..
ENSBTAP00000005240  ......-..----..................................................SCA....SGFLLA..
ENSBTAP00000006244  ......-..----..................................................VCG....PGFRAG..
ENSBTAP00000020360  ......-..----..................................................ICK....PGFILA..
ENSBTAP00000035484  ......-..----..................................................LCK....PGFLLA..
ENSBTAP00000035484  ......-..----..................................................SCY....AGFQST..
ENSBTAP00000020360  ......-..----..................................................NCN....EGFEPG..
ENSBTAP00000035484  ......-..----..................................................ECL....RGYESG..
ENSBTAP00000006244  ......-..----..................................................ACP....AGFRSR..
ENSBTAP00000002944  ......-..----..................................................QCR....PGYQST..
ENSBTAP00000016040  ......-..----..................................................SCT....LGFRLS..
ENSBTAP00000055091  ......-..----..................................................ACP....AGFRSR..
ENSBTAP00000002944  ......-..----..................................................KCP....PGFTQH..
ENSBTAP00000012158  ......-..----..................................................TCY....DGFHLA..
ENSBTAP00000020360  ......-..----..................................................KCH....AGFQRT..
ENSBTAP00000010680  igmkqiG..VCLS..................................................SCP....SGYYGT..
ENSBTAP00000035484  ......-..----..................................................SCP....QGFSFR..
ENSBTAP00000010571  ......-..----..................................................VCP....PGAFER..
ENSBTAP00000002944  ......-..----..................................................ICK....PGFQLA..
ENSBTAP00000002944  ......-..----..................................................KCD....EGYESG..
ENSBTAP00000036514  ......G..ECRE..................................................SCP....PGYYPE..
ENSBTAP00000008880  ......-..----..................................................LCP....QGHRLV..
ENSBTAP00000020360  ......-..----..................................................LCY....PGFALT..
ENSBTAP00000053681  ......D..RCVP..................................................DCP....SGYFVE..
ENSBTAP00000027416  ......-..----..................................................TCF....DGFMLA..
ENSBTAP00000012158  ......-..----..................................................LCR....HGYLLY..
ENSBTAP00000029056  ......G..ICEL..................................................HCP....ALVTYN..
ENSBTAP00000020360  ......-..----..................................................KCP....PGFTQH..
ENSBTAP00000002944  ......-..----..................................................TCE....EGFEPG..
ENSBTAP00000023206  ......-..----..................................................QCN....QGYELS..
ENSBTAP00000035484  ......-..----..................................................LCF....PGFVAA..
ENSBTAP00000027771  ......-..----..................................................SCY....AGYRLS..
ENSBTAP00000029170  egirqyG..KCVH..................................................DCP....PGYFGV..
ENSBTAP00000053668  ......G..ACVT..................................................QCP....QTFVYN..
ENSBTAP00000053678  ......-..--VV..................................................HCG....IGFRRT..
ENSBTAP00000054188  ......-..----..................................................ACP....AGFRSR..
ENSBTAP00000020360  ......-..----..................................................SCN....PGYQAT..
ENSBTAP00000002944  ......-..----..................................................SCQ....PGFALM..
ENSBTAP00000002944  ......-..----..................................................LCK....EGYTGD..
ENSBTAP00000009531  ......-..----..................................................ECS....IGFRGD..
ENSBTAP00000028604  ......-..----..................................................RCH....QGYELH..
ENSBTAP00000020360  ......-..----..................................................ECF....EGYESG..
ENSBTAP00000037465  ......-..----..................................................TCF....DGFMLA..
ENSBTAP00000005002  ......G..RCYP..................................................ACP....EGSAPA..
ENSBTAP00000018083  ..mrqyG..ECLH..................................................SCP....SGYYGH..
ENSBTAP00000022815  ......-..----..................................................QCS....EGFLIN..
ENSBTAP00000026435  ......-..----..................................................TCP....DGFQLN..
ENSBTAP00000028690  ......G..VCVP..................................................SCP....PNTYRF..
ENSBTAP00000011042  ......-..----..................................................SCE....GGRVRD..
ENSBTAP00000029274  ......-..----..................................................LCA....DGFVSA..
ENSBTAP00000020360  ......-..----..................................................ACS....EGFTGD..
ENSBTAP00000049409  ......-..----..................................................TCP....DGFQLN..
ENSBTAP00000025803  ......-..----..................................................-CQ....LGETRD..
ENSBTAP00000011877  ......E..SCGGayglhg............................................A--....------..
ENSBTAP00000014377  ......G..RCK-..................................................KCS....PGYQQV..
ENSBTAP00000054551  ......T..QCR-..................................................ECI....AGYSKE..
ENSBTAP00000028615  ......-..----..................................................---....------..
ENSBTAP00000020360  ......-..----..................................................ICD....DGYELD..
ENSBTAP00000020360  ......-..----..................................................ICP....PGMARR..
ENSBTAP00000035484  ......-..----..................................................ICD....EGYELD..
ENSBTAP00000007349  ......-..----..................................................---....------..
ENSBTAP00000001939  ......-..----..................................................TCV....KGYMGL..
ENSBTAP00000009631  ......-..----..................................................LCP....TGFSGN..
ENSBTAP00000029274  ......-..----..................................................PCE....EGYRGQ..
ENSBTAP00000016858  ......G..RCVE..................................................TCP....PPYYHF..
ENSBTAP00000003826  ......K..NCVQ..................................................HCP....PGFAPQ..
ENSBTAP00000035484  ......-..----..................................................ACR....LGFSGD..
ENSBTAP00000015268  ......-..----..................................................---....------..
ENSBTAP00000016342  ......-..----..................................................LCP....EGFQLV..
ENSBTAP00000035185  ......-..----..................................................ACH....GGYMLS..
ENSBTAP00000053357  ......-..----..................................................SCL....PGFAGP..
ENSBTAP00000009629  ......-..----..................................................HCP....QGFSGP..
ENSBTAP00000002944  ......-..----..................................................MCP....AGFQYE..
ENSBTAP00000037826  ......-..----..................................................SCP....PGVSLV..
ENSBTAP00000017746  ......-..----..................................................ECP....TGFTGH..
ENSBTAP00000054188  ......-..--TP..................................................ACD....PGYQPT..
ENSBTAP00000023206  ......-..----..................................................QCP....PGYQKR..
ENSBTAP00000008785  ......W..RCVP..................................................ACG....EGFYAE..
ENSBTAP00000026435  ......-..----..................................................ICP....AGFMAS..
ENSBTAP00000026435  ......-..----..................................................SCH....KGYSPT..
ENSBTAP00000055091  ......G..RCTDvdecssgascgphghctntegsfhc.........................SCE....PGYRAP..
ENSBTAP00000046844  ......-..----..................................................ICQ....PGFTGP..
ENSBTAP00000032310  ......-..----..................................................SCK....NGFVML..
ENSBTAP00000005988  ......-..----..................................................NCV....EGYVLE..
ENSBTAP00000035484  ......-..----..................................................ECY....QGFTLD..
ENSBTAP00000007111  ......-..----..................................................GCP....RGYQVQ..
ENSBTAP00000035484  ......-..----..................................................RCP....TGHRLS..
ENSBTAP00000049409  ......-..----..................................................ICP....AGFMAS..
ENSBTAP00000041521  ......-..----..................................................WCE....AGYELR..
ENSBTAP00000013316  ......-..----..................................................VCK....TGYTGK..
ENSBTAP00000027771  ......-..----..................................................ECR....AGYQLA..
ENSBTAP00000055091  ......-..----..................................................ICP....PGHRAG..
ENSBTAP00000010400  ......-..----..................................................LCM....PGFKGV..
ENSBTAP00000018719  ......G..RAGA..................................................RCG....PGLVCA..
ENSBTAP00000017556  ......-..----..................................................SCY....EGWVLE..
ENSBTAP00000053678  ......G..TCIDvdeckdgthqcrynqicentrgsyrc........................VCP....RGYRSQ..
ENSBTAP00000006244  ......-..----..................................................ICP....PGHRAG..
ENSBTAP00000002689  ......-..----..................................................---....------..
ENSBTAP00000017746  ......-..----..................................................SCP....PGFVGE..
ENSBTAP00000017746  ......-..----..................................................DCL....PGFQGA..
ENSBTAP00000053357  ......-..----..................................................ECP....AGYTGD..
ENSBTAP00000053357  ......-..----..................................................VCQ....PGFTGP..
ENSBTAP00000029938  ......-..----..................................................KCPs...PGLQLA..
ENSBTAP00000020360  ......-..----..................................................ACP....SGFSFD..
ENSBTAP00000003973  ......G..ACHR..................................................ACP....PGTYQH..
ENSBTAP00000010400  ......-..----..................................................VCS....PGFTGQ..
ENSBTAP00000042093  ......-..----..................................................TCP....PGYTGR..
ENSBTAP00000017746  ......-..----..................................................RCP....EGYHDP..
ENSBTAP00000012977  ......-..----..................................................---....------..
ENSBTAP00000053357  ......-..----..................................................ICM....AGFTGT..
ENSBTAP00000007931  ......-..----..................................................---....------..
ENSBTAP00000043345  ......-..----..................................................VCP....EGFLLS..
ENSBTAP00000004564  ......-..-CPPlp................................................RCS....VGTAPV..
ENSBTAP00000027836  ......-..----..................................................ECY....EGYTLN..
ENSBTAP00000049409  ......-..----..................................................TCG....QGYQLS..
ENSBTAP00000009629  ......-..----..................................................ECA....PGFAGP..
ENSBTAP00000010400  ......-..----..................................................ECV....PGYQGV..
ENSBTAP00000017746  ......D..ACISnpcnegsncdtnpvngkaic..............................TCP....SGYTGP..
ENSBTAP00000008880  ......-..----..................................................HCN....RGYRLH..
ENSBTAP00000008880  ......-..----..................................................ACL....PGYRSQ..
ENSBTAP00000017563  ......-..----..................................................ECP....HGREGS..
ENSBTAP00000000946  ......-..----..................................................---....------..
ENSBTAP00000053678  ......-..----..................................................ICP....PGYQLM..
ENSBTAP00000035484  ......-..----..................................................VCP....SGFDFD..
ENSBTAP00000029274  ......-..--VL..................................................GCQ....PGFHMA..
ENSBTAP00000010400  ......-..----..................................................LCA....PGWQGQ..
ENSBTAP00000001939  ......S..ECKA..................................................QCK....QGTYSS..
ENSBTAP00000013680  ......-..----..................................................TCP....AGFSGR..
ENSBTAP00000005240  ......-..----..................................................TCPe...RGYTMT..
ENSBTAP00000021383  ......-..----..................................................VCT....PGFTGE..
ENSBTAP00000005240  ......-..KAL-..................................................TCE....PGYRLE..
ENSBTAP00000034199  ......N..TCIAkgsedqvlyiandtdilgf...............................IYP....FNYSGD..
ENSBTAP00000053357  ......-..----..................................................ACP....DGFTGA..
ENSBTAP00000009531  ......F..HCVPgvvektrcqherehilgtadssrprppglfvp..................ECD....EHGQYV..
ENSBTAP00000037465  ......-..-CGG..................................................QCS....PGSFST..
ENSBTAP00000046844  ......-..----..................................................VCQ....PGYTGP..
ENSBTAP00000007111  ......-..----..................................................LCP....AGYRLL..
ENSBTAP00000028604  ......-..--LPrsaavindlhgegppppvppaehph.........................PCL....PGYEPD..
ENSBTAP00000020360  ......-..----..................................................NCN....SGYEPD..
ENSBTAP00000005529  ......-..----..................................................---....------..
ENSBTAP00000009631  ......-..----..................................................ECA....PGFAGP..
ENSBTAP00000006244  ......-..----..................................................SCE....PGYRAP..
ENSBTAP00000010390  ......-..----..................................................VCN....PGFQSR..
ENSBTAP00000042993  ......-..----..................................................ACP....QGFTGH..
ENSBTAP00000008357  ......-..----..................................................RCP....AGVSLV..
ENSBTAP00000054188  ......-..----..................................................ACD....SGFRLS..
ENSBTAP00000024122  ......-..--IPrtnpvyrgpysnpysnpysasypaaapplsapnyptisrpl.........ICR....FGYQMD..
ENSBTAP00000029084  ......-..----..................................................RCR....PGWKPIag
ENSBTAP00000018790  ......-..----..................................................RCE....TGHHPV..
ENSBTAP00000010400  ......-..----..................................................ICP....LGYTGK..
ENSBTAP00000016040  ......-..QRDS..................................................SCG....TGYELT..
ENSBTAP00000010390  ......-..----..................................................VCN....PGFQSR..
ENSBTAP00000051405  ......-..----..................................................SCE....EGYELA..
ENSBTAP00000004588  ......-..----..................................................RCR....SGWKPIgp
ENSBTAP00000054781  ......-..----..................................................-CP....GGYVPD..
ENSBTAP00000017746  ......-..----..................................................TCP....QGYTGL..
ENSBTAP00000056590  ......-..----..................................................VCP....EGFFGY..
ENSBTAP00000020360  ......-..----..................................................KCP....AGHKQS..
ENSBTAP00000018790  ......-..----..................................................VCP....EGFFGY..
ENSBTAP00000051405  ......-..----..................................................HCP....PGYQLD..
ENSBTAP00000021383  ......-..----..................................................SCS....AGFTGP..
ENSBTAP00000055091  ......-..--TP..................................................ACD....PGYQPT..
ENSBTAP00000017556  ......-..----..................................................GCV....EGYLLQ..
ENSBTAP00000052487  ......-..----..................................................ICE....AGYQLA..
ENSBTAP00000053786  ......-..----..................................................HCR....LGFRPA..
ENSBTAP00000002944  ......-..----..................................................ICG....PGYQRR..
ENSBTAP00000023842  ......-..----..................................................KCH....VGFKLK..
ENSBTAP00000010400  ......-..----..................................................MCP....EGKAGL..
ENSBTAP00000035484  ......-..----..................................................ECP....AGFSYN..
ENSBTAP00000046844  ......-..----..................................................RCP....PGFEGH..
ENSBTAP00000025815  ......T..KCDQ..................................................PCA....AGFYGE..
ENSBTAP00000027416  ......E..RCI-..................................................LCP....NGTFQN..
ENSBTAP00000025033  ......-..----..................................................NCP....SGDFEK..
ENSBTAP00000027132  ......-..----..................................................CCH....TGRLRQ..
ENSBTAP00000053357  ......-..----..................................................SCP....PGYQGR..
ENSBTAP00000017556  ......Ga.SCR-..................................................-EY....AGYLLY..
ENSBTAP00000049409  ......-..----..................................................DCF....DGYHLD..
ENSBTAP00000012158  ......NvtTCAG..................................................QCS....PGQHSA..
ENSBTAP00000053357  ......-..----..................................................TCP....PGYTGL..
ENSBTAP00000026435  ......-..----..................................................DCF....DGYHLD..
ENSBTAP00000007756  ......-..----..................................................GCP....IGLELL..
ENSBTAP00000041372  ......N..NKT-..................................................---....--FIPN..
ENSBTAP00000033786  ......-..----..................................................ACG....PGFTGE..
ENSBTAP00000053179  ......G..DCS-..................................................RCK....FGFFNL..
ENSBTAP00000046844  ......-..----..................................................LCL....QGWTGP..
ENSBTAP00000027416  ......-..----..................................................---....------..
ENSBTAP00000029274  ......-..----..................................................DCF....EGFQLD..
ENSBTAP00000036514  ......K..YCVL..................................................SCK....IFFFTH..
ENSBTAP00000004913  ......N..DCSQydpipgsekaalgyniltqeeaqhvydaryyggqcetvyngewrelqydpACE....RLYYGD..
ENSBTAP00000039211  ......-..----..................................................SCP....PGYQGD..
ENSBTAP00000021495  ......-..--EQdprp..............................................P--....------..
ENSBTAP00000005988  ......-..----..................................................ACP....SGWSLA..
ENSBTAP00000039366  ......G..TCQ-..................................................VCR....PGFFKA..
ENSBTAP00000033786  ......-..----..................................................HCPfdphSGVFFG..
ENSBTAP00000020455  ......-..----..................................................TCK....PGYEPE..
ENSBTAP00000001080  ......-..----..................................................LCQ....AGYEKV..
ENSBTAP00000005817  ......-..----..................................................ECA....RGWGGK..
ENSBTAP00000037070  ......-..----..................................................QCR....IGYFRA..
ENSBTAP00000015261  ......P..RCED..................................................PCL....IGTFGE..
ENSBTAP00000005240  ......Q..SCES..................................................NPN....LGYPCN..
ENSBTAP00000001511  ......T..SCH-..................................................QCD....PDKYSE..
ENSBTAP00000014664  ......G..N---..................................................---....------..
ENSBTAP00000008955  ......-..----..................................................RCE....NNYFRA..
ENSBTAP00000026780  ......-..----..................................................---....------..
ENSBTAP00000037611  ......D..ACV-..................................................ACE....LGFYKS..
ENSBTAP00000011078  ......G..FCK-..................................................---....------..
ENSBTAP00000039368  ......D..TCE-..................................................PCG....RGFYKS..
ENSBTAP00000008354  ......G..PCQ-..................................................PCG....A-----..
ENSBTAP00000001939  ......Q..TCKVvhcpalkppengyfirntcnnhfnaacgv.....................RCH....PGFDLV..


                                                                                                    
                                                                                                    
d2dtge6               .....QDWR........C............................................................
ENSBTAP00000008785  .....ESQ-........-............................................................
ENSBTAP00000036514  .....EDS-........-............................................................
ENSBTAP00000053681  .....AT--........-............................................................
ENSBTAP00000053681  .....E---........-............................................................
ENSBTAP00000053681  .....L---........-............................................................
ENSBTAP00000036514  .....EH--........-............................................................
ENSBTAP00000034199  .....PANPng......Ckslsdeepfliladhheirkistdgsnytllkqglnnvigidfdyreefiywidssrpng
ENSBTAP00000036514  .....TKK-........-............................................................
ENSBTAP00000015445  .....NGTLi.......W............................................................
ENSBTAP00000009285  .....----........-............................................................
ENSBTAP00000036514  .....KET-........-............................................................
ENSBTAP00000036514  .....GEG-........-............................................................
ENSBTAP00000011361  .....----........-............................................................
ENSBTAP00000053668  .....NSFIfky.....A............................................................
ENSBTAP00000047769  .....G---........C............................................................
ENSBTAP00000036514  .....N---........-............................................................
ENSBTAP00000017556  .....GGDPhs......Ckavtdeepflifanryylrklnldgsnytllkqglnnavaldfdyreqmiywtdvttqgs
ENSBTAP00000029056  .....LSFM........P............................................................
ENSBTAP00000013790  .....GEPRe.......F............................................................
ENSBTAP00000024122  .....DDGVh.......C............................................................
ENSBTAP00000055280  .....----........-............................................................
ENSBTAP00000037465  .....GTTH........C............................................................
ENSBTAP00000028738  .....GNRHs.......C............................................................
ENSBTAP00000035484  .....PMMT........C............................................................
ENSBTAP00000013790  .....KLTF........Q............................................................
ENSBTAP00000022815  .....PDKKt.......C............................................................
ENSBTAP00000002944  .....HNND........C............................................................
ENSBTAP00000053681  .....G---........-............................................................
ENSBTAP00000055091  .....PRGTe.......C............................................................
ENSBTAP00000029257  .....G--Rn.......C............................................................
ENSBTAP00000027416  .....GFTH........C............................................................
ENSBTAP00000015445  .....PTTY........E............................................................
ENSBTAP00000005240  .....ADGKh.......C............................................................
ENSBTAP00000006244  .....PRGTe.......C............................................................
ENSBTAP00000020360  .....PNGRy.......C............................................................
ENSBTAP00000035484  .....PGGRh.......C............................................................
ENSBTAP00000035484  .....PDRQg.......C............................................................
ENSBTAP00000020360  .....PMMN........C............................................................
ENSBTAP00000035484  .....FMLMkn......C............................................................
ENSBTAP00000006244  .....GPGAp.......C............................................................
ENSBTAP00000002944  .....LTRTe.......C............................................................
ENSBTAP00000016040  .....SDGRs.......C............................................................
ENSBTAP00000055091  .....GPGAp.......C............................................................
ENSBTAP00000002944  .....HT-A........C............................................................
ENSBTAP00000012158  .....HDGHn.......C............................................................
ENSBTAP00000020360  .....PTKQa.......C............................................................
ENSBTAP00000010680  .....R---........Y............................................................
ENSBTAP00000035484  .....PDTEt.......C............................................................
ENSBTAP00000010571  .....P--Y........Cevttrsfppqsfvtfrglrqrfhftvalafatqernalllyngrfnekhdfialeivdeq
ENSBTAP00000002944  .....SDGRy.......C............................................................
ENSBTAP00000002944  .....FMMMkn......C............................................................
ENSBTAP00000036514  .....EG--........-............................................................
ENSBTAP00000008880  .....GGRK........C............................................................
ENSBTAP00000020360  .....HNND........C............................................................
ENSBTAP00000053681  .....R---........-............................................................
ENSBTAP00000027416  .....HDGHn.......C............................................................
ENSBTAP00000012158  .....GVTH........C............................................................
ENSBTAP00000029056  .....TDT-........-............................................................
ENSBTAP00000020360  .....HT-A........C............................................................
ENSBTAP00000002944  .....PMMT........C............................................................
ENSBTAP00000023206  .....SDRLn.......C............................................................
ENSBTAP00000035484  .....HNGD........C............................................................
ENSBTAP00000027771  .....ADGCg.......C............................................................
ENSBTAP00000029170  .....RGQ-........-............................................................
ENSBTAP00000053668  .....PTTF........Q............................................................
ENSBTAP00000053678  .....SDGLs.......C............................................................
ENSBTAP00000054188  .....GPGAp.......C............................................................
ENSBTAP00000020360  .....PDRQg.......C............................................................
ENSBTAP00000002944  .....PDQRs.......C............................................................
ENSBTAP00000002944  .....GF-T........C............................................................
ENSBTAP00000009531  .....GR-T........C............................................................
ENSBTAP00000028604  .....RDGFs.......C............................................................
ENSBTAP00000020360  .....FMMMkn......C............................................................
ENSBTAP00000037465  .....HDGHn.......C............................................................
ENSBTAP00000005002  .....DGT-........-............................................................
ENSBTAP00000018083  .....R---........A............................................................
ENSBTAP00000022815  .....DDLKt.......C............................................................
ENSBTAP00000026435  .....DNKG........C............................................................
ENSBTAP00000028690  .....EGWR........C............................................................
ENSBTAP00000011042  .....AC--........-............................................................
ENSBTAP00000029274  .....DGGTs.......C............................................................
ENSBTAP00000020360  .....GF-T........C............................................................
ENSBTAP00000049409  .....DNKG........C............................................................
ENSBTAP00000025803  .....ACGC........C............................................................
ENSBTAP00000011877  .....----........-............................................................
ENSBTAP00000014377  .....GS-K........C............................................................
ENSBTAP00000054551  .....SG-Q........C............................................................
ENSBTAP00000028615  .....----........-............................................................
ENSBTAP00000020360  .....RTGGn.......C............................................................
ENSBTAP00000020360  .....PDGEg.......C............................................................
ENSBTAP00000035484  .....RGGGn.......C............................................................
ENSBTAP00000007349  .....----........-............................................................
ENSBTAP00000001939  .....H--C........E............................................................
ENSBTAP00000009631  .....L--C........Q............................................................
ENSBTAP00000029274  .....GG-S........C............................................................
ENSBTAP00000016858  .....QDWR........C............................................................
ENSBTAP00000003826  .....VLDT........H............................................................
ENSBTAP00000035484  .....GF-S........C............................................................
ENSBTAP00000015268  .....----........-............................................................
ENSBTAP00000016342  .....GKHR........C............................................................
ENSBTAP00000035185  .....PDSRt.......C............................................................
ENSBTAP00000053357  .....R--C........A............................................................
ENSBTAP00000009629  .....L--C........E............................................................
ENSBTAP00000002944  .....QFSGg.......C............................................................
ENSBTAP00000037826  .....RDGCg.......C............................................................
ENSBTAP00000017746  .....L--C........Q............................................................
ENSBTAP00000054188  .....PGGG........C............................................................
ENSBTAP00000023206  .....GE-Q........C............................................................
ENSBTAP00000008785  .....D-MP........G............................................................
ENSBTAP00000026435  .....EEGTn.......C............................................................
ENSBTAP00000026435  .....PDHKh.......C............................................................
ENSBTAP00000055091  .....VGRPgp......C............................................................
ENSBTAP00000046844  .....R--C........E............................................................
ENSBTAP00000032310  .....SNKKd.......C............................................................
ENSBTAP00000005988  .....RQKH........Cranssfgeafvifsngrnllkgsirgnnfqilaesqnrglavgvdfhyrlrrvfwtdivq
ENSBTAP00000035484  .....SSGHg.......C............................................................
ENSBTAP00000007111  .....DPGLp.......C............................................................
ENSBTAP00000035484  .....ENSAk.......C............................................................
ENSBTAP00000049409  .....EEGTn.......C............................................................
ENSBTAP00000041521  .....PDRRs.......Ckalgpepvllfanridirqvlphrseytlllnnlenaialdfhhrrelvfwsdvtldril
ENSBTAP00000013316  .....M--C........E............................................................
ENSBTAP00000027771  .....VDRKa.......C............................................................
ENSBTAP00000055091  .....PDLAs.......C............................................................
ENSBTAP00000010400  .....H--C........E............................................................
ENSBTAP00000018719  .....S---........-............................................................
ENSBTAP00000017556  .....PDGEs.......Crsldpfkpfiifsnrheirridlhkgdysvlvpglrntialdfhlsqsalyrdvvedkiy
ENSBTAP00000053678  .....GLGRp.......C............................................................
ENSBTAP00000006244  .....PDLAs.......C............................................................
ENSBTAP00000002689  .....----........-............................................................
ENSBTAP00000017746  .....R--C........E............................................................
ENSBTAP00000017746  .....F--C........E............................................................
ENSBTAP00000053357  .....N--C........E............................................................
ENSBTAP00000053357  .....L--C........N............................................................
ENSBTAP00000029938  .....PDGRt.......C............................................................
ENSBTAP00000020360  .....QFSSa.......C............................................................
ENSBTAP00000003973  .....ESWR........C............................................................
ENSBTAP00000010400  .....R--C........N............................................................
ENSBTAP00000042093  .....N---........-............................................................
ENSBTAP00000017746  .....T--C........L............................................................
ENSBTAP00000012977  .....----........-............................................................
ENSBTAP00000053357  .....Y--C........E............................................................
ENSBTAP00000007931  .....----........-............................................................
ENSBTAP00000043345  .....SELG........C............................................................
ENSBTAP00000004564  .....LDRC........-............................................................
ENSBTAP00000027836  .....EDKKt.......C............................................................
ENSBTAP00000049409  .....AAKDq.......C............................................................
ENSBTAP00000009629  .....D--C........R............................................................
ENSBTAP00000010400  .....N--C........E............................................................
ENSBTAP00000017746  .....A--C........S............................................................
ENSBTAP00000008880  .....VGAGgrs.....C............................................................
ENSBTAP00000008880  .....GGGA........C............................................................
ENSBTAP00000017563  .....LCQT........Vsepednqpfladfssfsylelkglhtferdlgekmalevvflarspsglllyngqktdgk
ENSBTAP00000000946  .....----........-............................................................
ENSBTAP00000053678  .....LNGKt.......C............................................................
ENSBTAP00000035484  .....QAVRg.......C............................................................
ENSBTAP00000029274  .....PTGD........C............................................................
ENSBTAP00000010400  .....R--C........T............................................................
ENSBTAP00000001939  .....NGL-........-............................................................
ENSBTAP00000013680  .....RCEV........R............................................................
ENSBTAP00000005240  .....ANGRs.......C............................................................
ENSBTAP00000021383  .....E--C........D............................................................
ENSBTAP00000005240  .....DG-E........C............................................................
ENSBTAP00000034199  .....HQQI........Shiehnsritgmdvyyqrdmiiwstqfnpggifykripgrekrqansglicpefrrprdia
ENSBTAP00000053357  .....Q--C........Q............................................................
ENSBTAP00000009531  .....PTQC........Hsstgycwcvdrdgrevqgtrtrsgmrppclstvappvhygppvpttviplppgthllfaq
ENSBTAP00000037465  .....DGF-........-............................................................
ENSBTAP00000046844  .....T--C........H............................................................
ENSBTAP00000007111  .....PSGKn.......C............................................................
ENSBTAP00000028604  .....EQER........C............................................................
ENSBTAP00000020360  .....ASGRn.......C............................................................
ENSBTAP00000005529  .....KRTV........L............................................................
ENSBTAP00000009631  .....D--C........R............................................................
ENSBTAP00000006244  .....VGRPgp......C............................................................
ENSBTAP00000010390  .....SGKKsfqgpgemC............................................................
ENSBTAP00000042993  .....S--C........E............................................................
ENSBTAP00000008357  .....LDGCg.......C............................................................
ENSBTAP00000054188  .....PQGTh.......C............................................................
ENSBTAP00000024122  .....ESNQ........C............................................................
ENSBTAP00000029084  spngpNNTV........C............................................................
ENSBTAP00000018790  .....S---........-............................................................
ENSBTAP00000010400  .....N--C........Q............................................................
ENSBTAP00000016040  .....EDND........C............................................................
ENSBTAP00000010390  .....SGRKsfqgpgemC............................................................
ENSBTAP00000051405  .....EEDGtq......C............................................................
ENSBTAP00000004588  .pngpHNTV........C............................................................
ENSBTAP00000054781  .....LC--........-............................................................
ENSBTAP00000017746  .....N--C........Q............................................................
ENSBTAP00000056590  .....H--C........E............................................................
ENSBTAP00000020360  .....ETTQk.......C............................................................
ENSBTAP00000018790  .....H--C........E............................................................
ENSBTAP00000051405  .....STQRd.......C............................................................
ENSBTAP00000021383  .....A--C........A............................................................
ENSBTAP00000055091  .....PGGG........C............................................................
ENSBTAP00000017556  .....PDNRs.......Ckaknepvdrppvlliansqnilatylsgaqvstitptstrqttamdfsyanetvcwvhvg
ENSBTAP00000052487  .....ADQHr.......C............................................................
ENSBTAP00000053786  .....EDEPhr......C............................................................
ENSBTAP00000002944  .....PDGEg.......C............................................................
ENSBTAP00000023842  .....YISGqyd.....C............................................................
ENSBTAP00000010400  .....L---........C............................................................
ENSBTAP00000035484  .....SLLLv.......C............................................................
ENSBTAP00000046844  .....A--C........E............................................................
ENSBTAP00000025815  .....GCG-........-............................................................
ENSBTAP00000027416  .....EEGQ........-............................................................
ENSBTAP00000025033  .....PF--........Cqvttrsfparsfitfrglrqrfhftlalsfatkerdglllyngrfnekhdfvaleviqeq
ENSBTAP00000027132  .....SLTPsfl.....S............................................................
ENSBTAP00000053357  .....S--C........R............................................................
ENSBTAP00000017556  .....SERT........Ilksvhlsdernlnapvqpfedpehmknvialafdyragtspgtpnriffsdihfgniqqi
ENSBTAP00000049409  .....MAKMt.......C............................................................
ENSBTAP00000012158  .....DGF-........-............................................................
ENSBTAP00000053357  .....R--C........E............................................................
ENSBTAP00000026435  .....MAKMt.......C............................................................
ENSBTAP00000007756  .....SDMKt.......Civpeaflvftsraaihrisldtnnndvaipltgvkeasaldfdvsnnhiywtdvslktis
ENSBTAP00000041372  .....DGTF........C............................................................
ENSBTAP00000033786  .....R--C........D............................................................
ENSBTAP00000053179  .....Q---........-............................................................
ENSBTAP00000046844  .....L--C........N............................................................
ENSBTAP00000027416  .....----........-............................................................
ENSBTAP00000029274  .....TAHMa.......C............................................................
ENSBTAP00000036514  .....DVVKg.......Fsscglmcrhlkgaansacslesstfllqpqpcflrvrspveslsinskgsle........
ENSBTAP00000004913  .....DDKY........Frkpynflkyhfeaqadtkisseiyndandlltkvkndksvssgltigvgirgvpvtvtag
ENSBTAP00000039211  .....GR-V........C............................................................
ENSBTAP00000021495  .....----........Crnrvveeselartagfginilgmdplstpfdnqyynglcdrvwdgntltyyrrpwnvasl
ENSBTAP00000005988  .....RDSVt.......Cvrddqaflivvrnsiifgislnpdvktfdgmvpisgirngydvavdyseqfiywlenpge
ENSBTAP00000039366  .....SPH-........-............................................................
ENSBTAP00000033786  .....G---........-............................................................
ENSBTAP00000020455  .....NS--........-............................................................
ENSBTAP00000001080  .....E---........-............................................................
ENSBTAP00000005817  .....H--C........H............................................................
ENSBTAP00000037070  .....STD-........-............................................................
ENSBTAP00000015261  .....GCG-........-............................................................
ENSBTAP00000005240  .....HVMLs.......Ccegedplivpevrrppepeavprrvseaelasrealslgtetelpnslpg..........
ENSBTAP00000001511  .....KGSSt.......C............................................................
ENSBTAP00000014664  .....--KR........Rhpitvyhvtkvqelleeegmdeetkrkkmtekvvsfllvdeneeiqvtneedfirkldck
ENSBTAP00000008955  .....DKDPpsma....Ctrppsaprnvisninetsvildwswpldtggrkdv.........................
ENSBTAP00000026780  .....----........-............................................................
ENSBTAP00000037611  .....APG-........-............................................................
ENSBTAP00000011078  .....----........-............................................................
ENSBTAP00000039368  .....SS--........-............................................................
ENSBTAP00000008354  .....----........-............................................................
ENSBTAP00000001939  .....GSSIfl......C............................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000034199  srinrmclngsdikvvhntavpnalavdwigknlywsdtekriievsklnglyptilvskrlkfprdlsldpragyly
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000009285  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000011361  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000047769  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000017556  mirrmhlngsnvqvlhrtglsnpdglavdwvggnlywcdkgrdtievsklngayrtvlvssglrepralvvdvqngyl
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000055280  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000028738  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000029257  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000010680  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000010571  vqltfsagettttvapqvpggvsdgrwhavqlqyynkpnigrlglphgpsgekvavvtvddcdtavavrfgsfvgnys
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000029170  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000005002  ..............................................................................
ENSBTAP00000018083  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000025803  ..............................................................................
ENSBTAP00000011877  ..............................................................................
ENSBTAP00000014377  ..............................................................................
ENSBTAP00000054551  ..............................................................................
ENSBTAP00000028615  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007349  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000003826  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000015268  ..............................................................................
ENSBTAP00000016342  ..............................................................................
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000037826  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000005988  kkvfsvdisgsrirevlgvsiedpenlavdwvnnklyivetrvncidvvdldgshritliseylghprgiavdptvgy
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000041521  ranlngsnveevvstglespgglavdwvhdklywtdsgtsrievanldgahrkvllwqnlekpraialhpmegtiywt
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000018719  ..............................................................................
ENSBTAP00000017556  rgkllsssaltsfevviqyglatpeglavdwiagniywvesnldqievakldgtlrttllagdiehpraialdprdgi
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002689  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000042093  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000012977  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000007931  ..............................................................................
ENSBTAP00000043345  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000027836  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000017563  gdfvslalhngllefrydlgkgaavirskepvalgawtrvslerngrkgamrvgdgprvlgespvphtvlnlkeplfv
ENSBTAP00000000946  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000013680  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000034199  vdwvagniywtdhsrmhwfsyytthwtslrysinvgqlsgpnctrlltnmagepyaiavnpkrgmmywtvvgdhshie
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009531  tgkierlplegstmtkseaktllhapgkviiglafdcvdkmvywtdisqpsigraslhggepativrqdlgspegial
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000005529  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000008357  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000029084  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000004588  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000056590  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000017556  dsaaqtqlkcarmpglkgfvdeytinislslhhveqmaidwltgnfyfvddiddrifvcnrngdtcvtlldlelynpk
ENSBTAP00000052487  ..............................................................................
ENSBTAP00000053786  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000025815  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000025033  vqltfsagestttvspfvpggvsdgqwhtvqlkyynkpllgqtglpqgpseqkvavvtvdgcdtgvalrfgamlgnys
ENSBTAP00000027132  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000017556  nddgsgrttivenvgsveglayhrgwdtlywtsyttstitrhtvdqtrpgaferetvitmsgddhprafvldecqnlm
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000007756  rafmngssvehviefgldypegmavdwmgknlywadtgtnrievarldgqfrqvlvwrdldnprslaldptkgyiywt
ENSBTAP00000041372  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000004913  vsmskdaaflkklskyhekkysfmriftkvqtahfkmrrenivldegmlqslmelperyhygmyakfindygthyits
ENSBTAP00000039211  ..............................................................................
ENSBTAP00000021495  tydtkadknfrtenheesiqilrtiieekklnfnaglsvkytpveaieknkcvdlehsdkgstsspsklaaeakfrft
ENSBTAP00000005988  ihrvktdgtnrtvfaplsslgasaslaldwlsrnlyftdhvtrsikvmtlqgdvsyrktliandgtslgvglpvgiti
ENSBTAP00000039366  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000020455  ..............................................................................
ENSBTAP00000001080  ..............................................................................
ENSBTAP00000005817  ..............................................................................
ENSBTAP00000037070  ..............................................................................
ENSBTAP00000015261  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000001511  ..............................................................................
ENSBTAP00000014664  pdqhlkvvsifgntgdgkshtlnhtffygrevfktspaqesctvgvwaaydpvhkvavidtegllgatvnlsqrtrll
ENSBTAP00000008955  ..............................................................................
ENSBTAP00000026780  ..............................................................................
ENSBTAP00000037611  ..............................................................................
ENSBTAP00000011078  ..............................................................................
ENSBTAP00000039368  ..............................................................................
ENSBTAP00000008354  ..............................................................................
ENSBTAP00000001939  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000034199  widcceyphigrvgmdgtnqsvvietkisrpmaltidyvnhrlywadenhiefsnmdgshrhkvpnqdipgvialtlf
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000009285  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000011361  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000047769  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000017556  ywtdwgdhsligrigmdgssrsvivdtkitwpngltldyvteriywadaredyiefasldgsnrhvvlsqdiphifal
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000055280  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000028738  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000029257  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000010680  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000010571  caaqgtqsgskksldltgplllggvpnlpedfpvrnrqfvgcmrnlsidgrhvdmasfi...................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000029170  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000005002  ..............................................................................
ENSBTAP00000018083  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000025803  ..............................................................................
ENSBTAP00000011877  ..............................................................................
ENSBTAP00000014377  ..............................................................................
ENSBTAP00000054551  ..............................................................................
ENSBTAP00000028615  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007349  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000003826  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000015268  ..............................................................................
ENSBTAP00000016342  ..............................................................................
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000037826  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000005988  lffsdwqnvfgvprieraymdgsnrkdlvttklgwpggitldlvskrvywvdsrfdyietvtydglkrmtvihggadi
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000041521  dwgntprieassmdgsgrriiadthlfwpngltidyagrrmywvdakhhvieranldgshrkavisqglphpfaitvf
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000018719  ..............................................................................
ENSBTAP00000017556  lfwtdwdaslprieaasmsgagrrtihretgsggwpngltvdylekrilwidarsdaiysarydgsghmevlrghefl
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002689  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000042093  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000012977  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000007931  ..............................................................................
ENSBTAP00000043345  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000027836  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000017563  ggapdfsklaraaavssgfdgaiqlvslngrqlltrenvv......................................
ENSBTAP00000000946  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000013680  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000034199  eaamdgtlrrilvqknlqrptglavdhfseriywadlelsvigsvlydgsdsvvsvtskqgllhphridvfedyiyga
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009531  dhlgrnifwtdsqldrievakldgtqrrvlfetdlvnprgivtdsvrgnlywtdwnrdnpkietsymdgtnrrilvqd
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000005529  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000008357  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000029084  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000004588  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000056590  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000017556  gialdpamgkvfftdygqipkvercdmdgqnrtklvdskivfphgitldlvsrlvywadayldyievvdyegkgrqti
ENSBTAP00000052487  ..............................................................................
ENSBTAP00000053786  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000025815  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000025033  caaqgtqggskksldltgplllggvpdlpesfpvrtrqfvgcirnlqvdsrhvdmadf....................
ENSBTAP00000027132  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000017556  fwtnwneqhpsimraalsganvltliekdirtpnglaidhraeklyfsdatldkierceydgshryvilksepvhpfg
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000007756  ewggkprivrafmdgtncmtlvdkvgrandltidyadqrlywtdldtnmiessnmlgqervviaddlphpfgltqysd
ENSBTAP00000041372  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000004913  gsmggvyeyilvlnrekmetagvtsaeiqkcfgvslgieyeyseaiqikgssslgpckksgdgkltenekamgvedfi
ENSBTAP00000039211  ..............................................................................
ENSBTAP00000021495  yskddiyrllssysakqekmflhvkgkvhlgrfvmrsrdvmlqttfldsintlpttyekgeyfafletygthysssgs
ENSBTAP00000005988  dpingklywsdrgtnsglppkiasanmdgksprtlftgslenvafitldieeqklywavsstgviergnvdgtnrmil
ENSBTAP00000039366  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000020455  ..............................................................................
ENSBTAP00000001080  ..............................................................................
ENSBTAP00000005817  ..............................................................................
ENSBTAP00000037070  ..............................................................................
ENSBTAP00000015261  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000001511  ..............................................................................
ENSBTAP00000014664  lkvlaisdlviyrthadrlhndlfkflgdaseaylkhftkelkattarcgldvplstlgpaviifhetvhtqllgsdh
ENSBTAP00000008955  ..............................................................................
ENSBTAP00000026780  ..............................................................................
ENSBTAP00000037611  ..............................................................................
ENSBTAP00000011078  ..............................................................................
ENSBTAP00000039368  ..............................................................................
ENSBTAP00000008354  ..............................................................................
ENSBTAP00000001939  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000034199  edyiywtdgktkslsrahktsgadrlslinswhaitdiq.......................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000009285  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000011361  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000047769  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000017556  tlfedyvywtdwetksinrahkttgtnktllistlhrpmdlhvfhalrqpda..........................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000055280  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000028738  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000029257  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000010680  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000029170  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000005002  ..............................................................................
ENSBTAP00000018083  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000025803  ..............................................................................
ENSBTAP00000011877  ..............................................................................
ENSBTAP00000014377  ..............................................................................
ENSBTAP00000054551  ..............................................................................
ENSBTAP00000028615  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007349  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000003826  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000015268  ..............................................................................
ENSBTAP00000016342  ..............................................................................
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000037826  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000005988  phpfsislfegqlfftdwtkmavlkankfketnprlyyrsslkpfgvt..............................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000041521  edslywtdwhtksinsankftgknqeiirnklhfpmdih.......................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000018719  ..............................................................................
ENSBTAP00000017556  shpfavtlyggevywtdwrtntlakankwtghnvtvvqrtntqpfdlq..............................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002689  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000042093  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000012977  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000007931  ..............................................................................
ENSBTAP00000043345  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000027836  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000000946  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000013680  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000034199  gpkngvfrvqkfghgsveylalnvdktkg.................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009531  dlglpngltfdayssqlcwvdagahraeclkpgqssrrkvleglqypfavtsfgknlyytdwktnsvvavdlavsket
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000005529  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000008357  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000029084  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000004588  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000056590  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000017556  iqgiliehlygltvfenylyatnsdnanaqqktsvirvnrfnstdyqvvtrvdkggalhiyhqrrqpr..........
ENSBTAP00000052487  ..............................................................................
ENSBTAP00000053786  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000025815  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000027132  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000017556  lavygehifwtdwvrravqrankyvgsdmkllrvdipqqpmgiiava...............................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000007756  yiywtdwnlhsieradktsgrnrtliqghldfvmdil.........................................
ENSBTAP00000041372  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000004913  srvrggssgwggsltqdsslvtyrswgrslkynpavidfemkpiheilqhtnlgsletkrqnlrraldkyl.......
ENSBTAP00000039211  ..............................................................................
ENSBTAP00000021495  lgglyeliyvldkksmeqkdielrdvqrclgfdldlslkvgvevtgnfdsklcskkgmgqtetnpeadlfddvitfir
ENSBTAP00000005988  vnhlsypwglavhgrflyysdeeyeviervdkatgankvvlrnnlpdlrglki.........................
ENSBTAP00000039366  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000020455  ..............................................................................
ENSBTAP00000001080  ..............................................................................
ENSBTAP00000005817  ..............................................................................
ENSBTAP00000037070  ..............................................................................
ENSBTAP00000015261  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000001511  ..............................................................................
ENSBTAP00000014664  psevpekliqdrfrklgrfpeafssihykgtrtynpptdfsglrraleqqlennttrsprhpgvifkalkalsdrfsg
ENSBTAP00000008955  ..............................................................................
ENSBTAP00000026780  ..............................................................................
ENSBTAP00000037611  ..............................................................................
ENSBTAP00000011078  ..............................................................................
ENSBTAP00000039368  ..............................................................................
ENSBTAP00000008354  ..............................................................................
ENSBTAP00000001939  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ...........................................................................VN.
ENSBTAP00000008785  ...........................................................................--.
ENSBTAP00000036514  ...........................................................................--.
ENSBTAP00000053681  ...........................................................................--.
ENSBTAP00000053681  ...........................................................................--.
ENSBTAP00000053681  ...........................................................................--.
ENSBTAP00000036514  ...........................................................................--.
ENSBTAP00000034199  ...........................................................................V-.
ENSBTAP00000036514  ...........................................................................--.
ENSBTAP00000015445  ...........................................................................-Kf
ENSBTAP00000009285  ...........................................................................--.
ENSBTAP00000036514  ...........................................................................--.
ENSBTAP00000036514  ...........................................................................-E.
ENSBTAP00000011361  ...........................................................................--.
ENSBTAP00000053668  ...........................................................................DQ.
ENSBTAP00000047769  ...........................................................................--.
ENSBTAP00000036514  ...........................................................................--.
ENSBTAP00000017556  ...........................................................................V-.
ENSBTAP00000029056  ...........................................................................IWk
ENSBTAP00000013790  ...........................................................................AH.
ENSBTAP00000024122  ...........................................................................SD.
ENSBTAP00000055280  ...........................................................................--.
ENSBTAP00000037465  ...........................................................................GD.
ENSBTAP00000028738  ...........................................................................VD.
ENSBTAP00000035484  ...........................................................................ED.
ENSBTAP00000013790  ...........................................................................LE.
ENSBTAP00000022815  ...........................................................................AK.
ENSBTAP00000002944  ...........................................................................ID.
ENSBTAP00000053681  ...........................................................................--.
ENSBTAP00000055091  ...........................................................................LD.
ENSBTAP00000029257  ...........................................................................VD.
ENSBTAP00000027416  ...........................................................................GD.
ENSBTAP00000015445  ...........................................................................MK.
ENSBTAP00000005240  ...........................................................................ED.
ENSBTAP00000006244  ...........................................................................LD.
ENSBTAP00000020360  ...........................................................................TD.
ENSBTAP00000035484  ...........................................................................VD.
ENSBTAP00000035484  ...........................................................................VD.
ENSBTAP00000020360  ...........................................................................ED.
ENSBTAP00000035484  ...........................................................................MD.
ENSBTAP00000006244  ...........................................................................QD.
ENSBTAP00000002944  ...........................................................................RD.
ENSBTAP00000016040  ...........................................................................ED.
ENSBTAP00000055091  ...........................................................................QD.
ENSBTAP00000002944  ...........................................................................ID.
ENSBTAP00000012158  ...........................................................................LD.
ENSBTAP00000020360  ...........................................................................ID.
ENSBTAP00000010680  ...........................................................................PD.
ENSBTAP00000035484  ...........................................................................ED.
ENSBTAP00000010571  ...........................................................................AN.
ENSBTAP00000002944  ...........................................................................KD.
ENSBTAP00000002944  ...........................................................................MD.
ENSBTAP00000036514  ...........................................................................--.
ENSBTAP00000008880  ...........................................................................QD.
ENSBTAP00000020360  ...........................................................................MD.
ENSBTAP00000053681  ...........................................................................--.
ENSBTAP00000027416  ...........................................................................LD.
ENSBTAP00000012158  ...........................................................................GD.
ENSBTAP00000029056  ...........................................................................--.
ENSBTAP00000020360  ...........................................................................ID.
ENSBTAP00000002944  ...........................................................................ED.
ENSBTAP00000023206  ...........................................................................ED.
ENSBTAP00000035484  ...........................................................................VD.
ENSBTAP00000027771  ...........................................................................ED.
ENSBTAP00000029170  ...........................................................................-E.
ENSBTAP00000053668  ...........................................................................LE.
ENSBTAP00000053678  ...........................................................................QD.
ENSBTAP00000054188  ...........................................................................QD.
ENSBTAP00000020360  ...........................................................................TD.
ENSBTAP00000002944  ...........................................................................TD.
ENSBTAP00000002944  ...........................................................................TD.
ENSBTAP00000009531  ...........................................................................YD.
ENSBTAP00000028604  ...........................................................................SD.
ENSBTAP00000020360  ...........................................................................MD.
ENSBTAP00000037465  ...........................................................................LD.
ENSBTAP00000005002  ...........................................................................--.
ENSBTAP00000018083  ...........................................................................PD.
ENSBTAP00000022815  ...........................................................................SR.
ENSBTAP00000026435  ...........................................................................QD.
ENSBTAP00000028690  ...........................................................................VD.
ENSBTAP00000011042  ...........................................................................--.
ENSBTAP00000029274  ...........................................................................QD.
ENSBTAP00000020360  ...........................................................................SD.
ENSBTAP00000049409  ...........................................................................QD.
ENSBTAP00000025803  ...........................................................................--.
ENSBTAP00000011877  ...........................................................................--.
ENSBTAP00000014377  ...........................................................................LD.
ENSBTAP00000054551  ...........................................................................ED.
ENSBTAP00000028615  ...........................................................................--.
ENSBTAP00000020360  ...........................................................................TD.
ENSBTAP00000020360  ...........................................................................VD.
ENSBTAP00000035484  ...........................................................................TD.
ENSBTAP00000007349  ...........................................................................--.
ENSBTAP00000001939  ...........................................................................TE.
ENSBTAP00000009631  ...........................................................................LD.
ENSBTAP00000029274  ...........................................................................VD.
ENSBTAP00000016858  ...........................................................................VN.
ENSBTAP00000003826  ...........................................................................YSt
ENSBTAP00000035484  ...........................................................................ED.
ENSBTAP00000015268  ...........................................................................--.
ENSBTAP00000016342  ...........................................................................ED.
ENSBTAP00000035185  ...........................................................................LD.
ENSBTAP00000053357  ...........................................................................RD.
ENSBTAP00000009629  ...........................................................................VD.
ENSBTAP00000002944  ...........................................................................QD.
ENSBTAP00000037826  ...........................................................................--.
ENSBTAP00000017746  ...........................................................................YD.
ENSBTAP00000054188  ...........................................................................QD.
ENSBTAP00000023206  ...........................................................................VD.
ENSBTAP00000008785  ...........................................................................LP.
ENSBTAP00000026435  ...........................................................................ID.
ENSBTAP00000026435  ...........................................................................ED.
ENSBTAP00000055091  ...........................................................................AD.
ENSBTAP00000046844  ...........................................................................ED.
ENSBTAP00000032310  ...........................................................................KD.
ENSBTAP00000005988  ...........................................................................VY.
ENSBTAP00000035484  ...........................................................................KD.
ENSBTAP00000007111  ...........................................................................LD.
ENSBTAP00000035484  ...........................................................................ED.
ENSBTAP00000049409  ...........................................................................ID.
ENSBTAP00000041521  ...........................................................................TL.
ENSBTAP00000013316  ...........................................................................SS.
ENSBTAP00000027771  ...........................................................................ED.
ENSBTAP00000055091  ...........................................................................LD.
ENSBTAP00000010400  ...........................................................................LE.
ENSBTAP00000018719  ...........................................................................--.
ENSBTAP00000017556  ...........................................................................VY.
ENSBTAP00000053678  ...........................................................................LD.
ENSBTAP00000006244  ...........................................................................LD.
ENSBTAP00000002689  ...........................................................................--.
ENSBTAP00000017746  ...........................................................................GD.
ENSBTAP00000017746  ...........................................................................ED.
ENSBTAP00000053357  ...........................................................................DD.
ENSBTAP00000053357  ...........................................................................VE.
ENSBTAP00000029938  ...........................................................................VD.
ENSBTAP00000020360  ...........................................................................HD.
ENSBTAP00000003973  ...........................................................................VT.
ENSBTAP00000010400  ...........................................................................ID.
ENSBTAP00000042093  ...........................................................................--.
ENSBTAP00000017746  ...........................................................................SE.
ENSBTAP00000012977  ...........................................................................--.
ENSBTAP00000053357  ...........................................................................VD.
ENSBTAP00000007931  ...........................................................................--.
ENSBTAP00000043345  ...........................................................................ED.
ENSBTAP00000004564  ...........................................................................--.
ENSBTAP00000027836  ...........................................................................SV.
ENSBTAP00000049409  ...........................................................................ED.
ENSBTAP00000009629  ...........................................................................IN.
ENSBTAP00000010400  ...........................................................................YE.
ENSBTAP00000017746  ...........................................................................QD.
ENSBTAP00000008880  ...........................................................................VD.
ENSBTAP00000008880  ...........................................................................RD.
ENSBTAP00000017563  ...........................................................................RA.
ENSBTAP00000000946  ...........................................................................--.
ENSBTAP00000053678  ...........................................................................QD.
ENSBTAP00000035484  ...........................................................................QD.
ENSBTAP00000029274  ...........................................................................ID.
ENSBTAP00000010400  ...........................................................................ID.
ENSBTAP00000001939  ...........................................................................--.
ENSBTAP00000013680  ...........................................................................MP.
ENSBTAP00000005240  ...........................................................................KD.
ENSBTAP00000021383  ...........................................................................ID.
ENSBTAP00000005240  ...........................................................................TD.
ENSBTAP00000034199  ...........................................................................VL.
ENSBTAP00000053357  ...........................................................................TL.
ENSBTAP00000009531  ............................................................dsfhphkqtrlygitSA.
ENSBTAP00000037465  ...........................................................................--.
ENSBTAP00000046844  ...........................................................................QD.
ENSBTAP00000007111  ...........................................................................QD.
ENSBTAP00000028604  ...........................................................................VD.
ENSBTAP00000020360  ...........................................................................VD.
ENSBTAP00000005529  ...........................................................................DD.
ENSBTAP00000009631  ...........................................................................IN.
ENSBTAP00000006244  ...........................................................................AD.
ENSBTAP00000010390  ...........................................................................QD.
ENSBTAP00000042993  ...........................................................................TD.
ENSBTAP00000008357  ...........................................................................C-.
ENSBTAP00000054188  ...........................................................................ID.
ENSBTAP00000024122  ...........................................................................VD.
ENSBTAP00000029084  ...........................................................................ED.
ENSBTAP00000018790  ...........................................................................--.
ENSBTAP00000010400  ...........................................................................TL.
ENSBTAP00000016040  ...........................................................................KD.
ENSBTAP00000010390  ...........................................................................QD.
ENSBTAP00000051405  ...........................................................................LD.
ENSBTAP00000004588  ...........................................................................ED.
ENSBTAP00000054781  ...........................................................................--.
ENSBTAP00000017746  ...........................................................................TL.
ENSBTAP00000056590  ...........................................................................TV.
ENSBTAP00000020360  ...........................................................................ED.
ENSBTAP00000018790  ...........................................................................TV.
ENSBTAP00000051405  ...........................................................................VD.
ENSBTAP00000021383  ...........................................................................QL.
ENSBTAP00000055091  ...........................................................................QD.
ENSBTAP00000017556  ...........................................................................VR.
ENSBTAP00000052487  ...........................................................................ED.
ENSBTAP00000053786  ...........................................................................VD.
ENSBTAP00000002944  ...........................................................................VD.
ENSBTAP00000023842  ...........................................................................VD.
ENSBTAP00000010400  ...........................................................................HL.
ENSBTAP00000035484  ...........................................................................ED.
ENSBTAP00000046844  ...........................................................................HD.
ENSBTAP00000025815  ...........................................................................--.
ENSBTAP00000027416  ...........................................................................--.
ENSBTAP00000025033  ...........................................................................IA.
ENSBTAP00000027132  ...........................................................................PD.
ENSBTAP00000053357  ...........................................................................SD.
ENSBTAP00000017556  ...........................................................................ND.
ENSBTAP00000049409  ...........................................................................VD.
ENSBTAP00000012158  ...........................................................................--.
ENSBTAP00000053357  ...........................................................................GD.
ENSBTAP00000026435  ...........................................................................VD.
ENSBTAP00000007756  ...........................................................................VF.
ENSBTAP00000041372  ...........................................................................TD.
ENSBTAP00000033786  ...........................................................................KD.
ENSBTAP00000053179  ...........................................................................--.
ENSBTAP00000046844  ...........................................................................LP.
ENSBTAP00000027416  ...........................................................................--.
ENSBTAP00000029274  ...........................................................................VD.
ENSBTAP00000036514  ...........................................................................PS.
ENSBTAP00000004913  ...........................................................................ME.
ENSBTAP00000039211  ...........................................................................TL.
ENSBTAP00000021495  ggtrkyatelkekllrgarminvtdfvnwaaslnhapvlisqklvpiydlipvkmkdahlkkqnleraiedyineFS.
ENSBTAP00000005988  ...........................................................................YQ.
ENSBTAP00000039366  ...........................................................................--.
ENSBTAP00000033786  ...........................................................................--.
ENSBTAP00000020455  ...........................................................................--.
ENSBTAP00000001080  ...........................................................................--.
ENSBTAP00000005817  ...........................................................................VD.
ENSBTAP00000037070  ...........................................................................--.
ENSBTAP00000015261  ...........................................................................--.
ENSBTAP00000005240  ...........................................................................DD.
ENSBTAP00000001511  ...........................................................................KA.
ENSBTAP00000014664  ................................................................eipddqmahssFF.
ENSBTAP00000008955  ...........................................................................TF.
ENSBTAP00000026780  ...........................................................................--.
ENSBTAP00000037611  ...........................................................................--.
ENSBTAP00000011078  ...........................................................................--.
ENSBTAP00000039368  ...........................................................................--.
ENSBTAP00000008354  ...........................................................................--.
ENSBTAP00000001939  ...........................................................................LP.


                            100                      110                                120         
                              |                        |                                  |         
d2dtge6               ........FSFCQD..LHHK.............CK......NSRRQ...................GCHQ.........
ENSBTAP00000008785  ........-KNCLK..CHPS.............CK......KCIDEpek................CTVCkeg......
ENSBTAP00000036514  ........-HRCAP..CHSS.............CR......TCEGRhsmq...............CLSCqpg......
ENSBTAP00000053681  ........-GRCKV..CHNS.............CA......SCSGPtaah...............CTACihp......
ENSBTAP00000053681  ........-GSCTE..CHPT.............CR......QCHGPlesd...............CISChph......
ENSBTAP00000053681  ........-GLCKS..CESH.............CL......QCQGPhe.................CTRCeep......
ENSBTAP00000036514  ........-GHCQI..CEAS.............CI......QCRGPtqed...............CTGCpvt......
ENSBTAP00000034199  ........---YHS..YRQPdvfkhl.......CT......INNGG...................CSHL.........
ENSBTAP00000036514  ........-SLCRK..CSEN.............CK......TCTESdn.................CTECreglsi...
ENSBTAP00000015445  .....adaNHVCLL..CHPN.............CTy.....GCEGP...................----.........
ENSBTAP00000009285  ........-SMCPP..SPLG.............CE......LVKEPg..................CGCCmt.......
ENSBTAP00000036514  ........-KVCKD..CQKS.............CR......TCSSSga.................CTTCqegl.....
ENSBTAP00000036514  ........KFNCEK..CHES.............CI......ECKGPgtrn...............CT--.........
ENSBTAP00000011361  ........-GCCAT..CALGkgmp.........CG......VYTPR...................CGSGlr.......
ENSBTAP00000053668  ........DRECHP..CHPN.............CTq.....GCSGP...................----.........
ENSBTAP00000047769  ........-GCCLT..CALRegqp.........CG......VYTER...................CGSGlr.......
ENSBTAP00000036514  ........-DTCEH..CSSS.............CR......TCEGNatn................CQSCerg......
ENSBTAP00000017556  ........------..PNHP.............CK......VNNGG...................CSNL.........
ENSBTAP00000029056  ....fpdeEGICQP..CPIN.............--......-----...................CTHS.........
ENSBTAP00000013790  ........EAECFS..CHQE.............CQpmegtvTCNGSgsda...............CAQCa........
ENSBTAP00000024122  ........MDECSF..SEFL.............--......-----...................CQHE.........
ENSBTAP00000055280  ........--CCPM..CALP.............--......-----...................----.........
ENSBTAP00000037465  ........VDECSM..NNGS.............--......-----...................CDQG.........
ENSBTAP00000028738  ........VNECRR..----.............--......----Plerrv..............CHHS.........
ENSBTAP00000035484  ........IDECSL..NPLL.............--......-----...................CAFR.........
ENSBTAP00000013790  ........PNPHTK..YQYG.............-G......VCVAS...................CPHN.........
ENSBTAP00000022815  ........IDYCAS..PNHG.............--......-----...................CQHE.........
ENSBTAP00000002944  ........VDECAT..G---.............--......----Ngnl................CRNGq........
ENSBTAP00000053681  ........-ALCLA..CQPQ.............CS......TCTSGle.................CSSCqpp......
ENSBTAP00000055091  ........VDECHR..VPPP.............--......-----...................CDRGr........
ENSBTAP00000029257  ........VNECAT..GFHR.............--......-----...................CGPNsv.......
ENSBTAP00000027416  ........TNECSV..NNGG.............--......-----...................CQQV.........
ENSBTAP00000015445  ........VNPLGK..YSFG.............-A......TCVKK...................CPRN.........
ENSBTAP00000005240  ........VNECEA..----.............--......---QR...................CSQE.........
ENSBTAP00000006244  ........VDECHR..VPPP.............--......-----...................CDRGr........
ENSBTAP00000020360  ........VDECQT..----.............--......--PGI...................CMNGh........
ENSBTAP00000035484  ........IDECQT..----.............--......--PGI...................CMNGh........
ENSBTAP00000035484  ........VDECRT..RNGG.............--......-----...................CHVH.........
ENSBTAP00000020360  ........INECAQ..NPLL.............--......-----...................CAFR.........
ENSBTAP00000035484  ........VDECAR..DPLL.............--......-----...................CRGGt........
ENSBTAP00000006244  ........VDECAR..SPPP.............--......-----...................CAYGr........
ENSBTAP00000002944  ........IDECLQ..----.............--......---NGri.................CNNGr........
ENSBTAP00000016040  ........VNECNS..----.............--......---NP...................CSQE.........
ENSBTAP00000055091  ........VDECAR..SPPP.............--......-----...................CAYGr........
ENSBTAP00000002944  ........NNECTS..DINL.............--......-----...................CGSKgi.......
ENSBTAP00000012158  ........VDECAE..GNGG.............--......-----...................CQQS.........
ENSBTAP00000020360  ........IDECIQ..----.............--......---NGvl.................CKNGr........
ENSBTAP00000010680  ........INKCTK..CKAD.............CD......TCFNKnf.................CTKCksg......
ENSBTAP00000035484  ........IDECLS..----.............--......---NP...................CVNGv........
ENSBTAP00000010571  ........NGTRAG..CAAQ.............RN......FCDGTw..................CQNGgt.......
ENSBTAP00000002944  ........INECET..----.............--......--PGI...................CMNGr........
ENSBTAP00000002944  ........IDECQR..DPLL.............--......-----...................CRGGv........
ENSBTAP00000036514  ........-HTCQP..CPDN.............CE......LCHSThv.................CTRCvrg......
ENSBTAP00000008880  ........IDECSQ..DPGL.............--......-----...................CLPHga.......
ENSBTAP00000020360  ........IDECSS..FF--.............--......---GQv..................CRNGr........
ENSBTAP00000053681  ........-GACKK..CHSS.............CR......TCQGRgpfs...............CSSCdtgr.....
ENSBTAP00000027416  ........VDECLE..NNGG.............--......-----...................CQHT.........
ENSBTAP00000012158  ........VDECSI..NRGG.............--......-----...................CRFG.........
ENSBTAP00000029056  ........-FESMP..NPEGrytf.........GA......SCVTA...................CPYNy........
ENSBTAP00000020360  ........NNECGS..QPSL.............--......-----...................CGAKgi.......
ENSBTAP00000002944  ........INECAQ..NPLL.............--......-----...................CAFR.........
ENSBTAP00000023206  ........IDECRT..SSYL.............--......-----...................CQYQ.........
ENSBTAP00000035484  ........MDECTT..M---.............--......--VGQv..................CRFGq........
ENSBTAP00000027771  ........VDECAS..GRGG.............--......-----...................CEHH.........
ENSBTAP00000029170  ........VNRCKK..CGAT.............CE......SCFSQdf.................CIQCkrr......
ENSBTAP00000053668  ........HNFNAK..YTYG.............-A......FCVKK...................CPHN.........
ENSBTAP00000053678  ........INECQE..----.............--......--SSP...................CHHR.........
ENSBTAP00000054188  ........VNECLE..----.............--......---GDf..................CFPHge.......
ENSBTAP00000020360  ........IDECMI..MNGG.............--......-----...................CDTQ.........
ENSBTAP00000002944  ........IDECED..NPNI.............--......-----...................CDGGq........
ENSBTAP00000002944  ........LDECSE..NLNL.............--......-----...................CGNGq........
ENSBTAP00000009531  ........IDECSE..QPSV.............--......-----...................CGNHai.......
ENSBTAP00000028604  ........IDECSY..SSYL.............--......-----...................CQYR.........
ENSBTAP00000020360  ........IDECER..NPLL.............--......-----...................CRGGt........
ENSBTAP00000037465  ........VDECQD..NNGG.............--......-----...................CQQI.........
ENSBTAP00000005002  ........------..----.............--......-----...................----.........
ENSBTAP00000018083  ........MNRCAR..CRIEn............CD......SCFSKdf.................CTKCkvg......
ENSBTAP00000022815  ........VDYCLL..SRHG.............--......-----...................CEYS.........
ENSBTAP00000026435  ........INECEQ..----.............--......--PGL...................CGPHge.......
ENSBTAP00000028690  ........RDFCAN..IPNA.............--......--ESS...................DSEG.........
ENSBTAP00000011042  ........-GCCEV..CGAPegae.........CG......LQEGP...................CGEGlq.......
ENSBTAP00000029274  ........VDECAV..----.............--......--TDR...................CLGGq........
ENSBTAP00000020360  ........VDECAE..NINL.............--......-----...................CENGq........
ENSBTAP00000049409  ........INECEQ..----.............--......--PGL...................CGPHge.......
ENSBTAP00000025803  ........----PV..CARGe............GE......PCGGGgagrgh.............CAPGme.......
ENSBTAP00000011877  ........------..----.............--......-----...................----.........
ENSBTAP00000014377  ........VDECETavC---.............--......-----...................-PGEnqq......
ENSBTAP00000054551  ........IDECSL..AEKP.............--......-----...................CLRDnen......
ENSBTAP00000028615  ........------..----.............--......-----...................----.........
ENSBTAP00000020360  ........IDECAD..----.............--......----Pin.................CVNGl........
ENSBTAP00000020360  ........ENECRT..KPGI.............--......-----...................CENGr........
ENSBTAP00000035484  ........VNECAD..----.............--......----Pvn.................CINGl........
ENSBTAP00000007349  ........------..----.............--......VYTPR...................CGQGlr.......
ENSBTAP00000001939  ........VNECQS..----.............--......---SP...................CLNNav.......
ENSBTAP00000009631  ........IDYCEP..----.............--......---NP...................CQNGaq.......
ENSBTAP00000029274  ........VNECLT..----.............--......--PGV...................CTHGt........
ENSBTAP00000016858  ........FSFCQD..LHNK.............CK......NSRRQ...................GCHQ.........
ENSBTAP00000003826  endveiirASVCTP..CHAS.............CA......TCQGPaptd...............CL--.........
ENSBTAP00000035484  ........RDECAE..NVAL.............--......-----...................CENGq........
ENSBTAP00000015268  ........------..----.............--......-----...................CGCCwe.......
ENSBTAP00000016342  ........IDECQN..----.............--......--PDT...................CSQL.........
ENSBTAP00000035185  ........VDECVD..----.............--......--AGA...................CGAAr........
ENSBTAP00000053357  ........VDECLS..----.............--......---SP...................CGSGt........
ENSBTAP00000009629  ........IDLCEP..----.............--......---SP...................CQNGaq.......
ENSBTAP00000002944  ........INECGS..AQAP.............--......-----...................CSYG.........
ENSBTAP00000037826  ........---CKI..CARQp............G-......----Dt..................CNEAdl.......
ENSBTAP00000017746  ........VDECAS..----.............--......---TP...................CKNGak.......
ENSBTAP00000054188  ........VDECRN..----.............--......--RSF...................CGAHav.......
ENSBTAP00000023206  ........VDECTI..----.............--......---PPy..................CHQR.........
ENSBTAP00000008785  ........HKVCRR..CDES.............CL......SCEGSsrn................CSRCkag......
ENSBTAP00000026435  ........VDECLR..----.............--......--PDV...................CGEGh........
ENSBTAP00000026435  ........IDECQQ..----.............--......---GTm..................CMNGq........
ENSBTAP00000055091  ........VNECLE..----.............--......---GDf..................CFPHge.......
ENSBTAP00000046844  ........INECQS..----.............--......---SP...................CANGge.......
ENSBTAP00000032310  ........VDECVL..KPSI.............--......-----...................CGTAv........
ENSBTAP00000005988  ........HGLRQP..YARNp............CA......HENGG...................CQHI.........
ENSBTAP00000035484  ........VDECN-..----.............--......---GPhr.................CKHG.........
ENSBTAP00000007111  ........INECLQ..LPGP.............--......-----...................CAYQ.........
ENSBTAP00000035484  ........VDECLS..VPGL.............--......-----...................CSGGd........
ENSBTAP00000049409  ........VDECLR..----.............--......--PDV...................CGEGh........
ENSBTAP00000041521  ........HPQRQP..AGKNr............CG......DNNGG...................CTHL.........
ENSBTAP00000013316  ........VNYCEC..----.............--......---NP...................CFNGgs.......
ENSBTAP00000027771  ........VDECAT..GLAQ.............--......-----...................CAHG.........
ENSBTAP00000055091  ........IDECRE..----.............--......--RGPal.................CGSQr........
ENSBTAP00000010400  ........INECQS..----.............--......---NP...................CVNNgq.......
ENSBTAP00000018719  ........------..----.............--......-----...................----.........
ENSBTAP00000017556  ........HPSRQP..MAPNp............CE......A-NGGrgp................CSHLc........
ENSBTAP00000053678  ........INECEQ..VPKP.............--......-----...................CAYQ.........
ENSBTAP00000006244  ........IDECRE..----.............--......--RGPal.................CGSQr........
ENSBTAP00000002689  ........------..----.............--......-----...................----.........
ENSBTAP00000017746  ........VNECLS..----.............--......---NP...................CDARgtqn.....
ENSBTAP00000017746  ........INECAS..----.............--......---SP...................CRNGan.......
ENSBTAP00000053357  ........VDECAS..----.............--......---QP...................CQHGgi.......
ENSBTAP00000053357  ........INECAS..----.............--......---NP...................CGEGas.......
ENSBTAP00000029938  ........IDECAT..GRAS.............--......-----...................CPRHrq.......
ENSBTAP00000020360  ........VNECSS..SKNP.............--......-----...................CNYG.........
ENSBTAP00000003973  ........AERCAS..LRSV.............--......---PG...................RAST.........
ENSBTAP00000010400  ........IDECAS..----.............--......---NP...................CRKGat.......
ENSBTAP00000042093  ........------..CSAP.............VS......RCEHAp..................CHNGat.......
ENSBTAP00000017746  ........VNECSS..----.............--......---NP...................CIHGa........
ENSBTAP00000012977  ........------..----.............--......-----...................----.........
ENSBTAP00000053357  ........MDECQS..----.............--......---SP...................CVNGgv.......
ENSBTAP00000007931  ........------..----.............--......-----...................----.........
ENSBTAP00000043345  ........VDECAE..----.............--......---PGlsr................CHALat.......
ENSBTAP00000004564  ........-GCCRV..CAAAe............GE......ACGGPlgrp...............CAPGlq.......
ENSBTAP00000027836  ........LNQCAL..GSHG.............--......-----...................CQHI.........
ENSBTAP00000049409  ........IDECQH..H---.............--......----Hl..................CSNGq........
ENSBTAP00000009629  ........IDECQS..----.............--......---SP...................CAYGat.......
ENSBTAP00000010400  ........VDECQN..----.............--......---QP...................CQNGgt.......
ENSBTAP00000017746  ........VDECSL..GANP.............--......-----...................CEHAgk.......
ENSBTAP00000008880  ........LNECAK..----.............--......---PHl..................CGDGgf.......
ENSBTAP00000008880  ........VNECAE..----.............--......--GNP...................CSPGw........
ENSBTAP00000017563  ........VDVSSF..ADHP.............CT......QAEGQp..................CLHGas.......
ENSBTAP00000000946  ........------..----.............--......-----...................----.........
ENSBTAP00000053678  ........IDECLE..QNVR.............--......-----...................CGPNrm.......
ENSBTAP00000035484  ........VDECAA..RSGP.............--......-----...................CSYS.........
ENSBTAP00000029274  ........IDECAN..----.............--......---DTv..................CGSHgf.......
ENSBTAP00000010400  ........IDECVS..----.............--......---KP...................CMNHgl.......
ENSBTAP00000001939  ........-ETCES..CPLGs............YQ......PAFGSrg.................CLSCpentstvkr
ENSBTAP00000013680  ........AEACAS..----.............--......---GP...................CFNGat.......
ENSBTAP00000005240  ........LDECAL..GTHN.............--......-----...................CSEAet.......
ENSBTAP00000021383  ........INECDS..----.............--......---NP...................CHHAgt.......
ENSBTAP00000005240  ........VDECEL..GTHN.............--......-----...................CQAGav.......
ENSBTAP00000034199  ........ISHRYK..QLDL.............PN......PCSDLa..................CEFL.........
ENSBTAP00000053357  ........VDWCSR..----.............--......---SP...................CQNGgr.......
ENSBTAP00000009531  ........LSQCPE..GHNY.............CS......VNNGG...................CTHL.........
ENSBTAP00000037465  ........-RPCQA..CPMGtyqpepgrtg...CF......PCGGGlltkhegsasfqdceakvhCSPGh........
ENSBTAP00000046844  ........LDECQM..AQQG.............--......--PSP...................CEHGgs.......
ENSBTAP00000007111  ........INECEE..DGIE.............--......-----...................CGPSqm.......
ENSBTAP00000028604  ........VDECAQ..ALHD.............--......-----...................CRPSqe.......
ENSBTAP00000020360  ........IDECLV..NRLL.............--......-----...................CDNGl........
ENSBTAP00000005529  ........CGCCRV..CAAGlget.........CY......RTVSGmdgvk..............CGPGlr.......
ENSBTAP00000009631  ........INECQS..----.............--......---SP...................CAFGat.......
ENSBTAP00000006244  ........VNECLE..----.............--......---GDf..................CFPHge.......
ENSBTAP00000010390  ........IDECSQ..TPPT.............--......-----...................CGPNss.......
ENSBTAP00000042993  ........IDECSD..GFVQ.............--......-----...................CDSRan.......
ENSBTAP00000008357  ........-RVCAK..QLSE.............LC......TERDP...................CDPHkg.......
ENSBTAP00000054188  ........VDECRR..VPTP.............--......-----...................CAPGr........
ENSBTAP00000024122  ........VDECAT..DSHQ.............--......-----...................CNPTqi.......
ENSBTAP00000029084  ........VDECSS..GQHQ.............--......-----...................CHNStv.......
ENSBTAP00000018790  ........-DACLS..----.............--......---GP...................CQNGgt.......
ENSBTAP00000010400  ........VNLCSR..----.............--......---SP...................CKNKgt.......
ENSBTAP00000016040  ........IDECES..GIHN.............--......-----...................CLPDfi.......
ENSBTAP00000010390  ........IDECSQ..KPPP.............--......-----...................CGPNsr.......
ENSBTAP00000051405  ........VDECEV..Q---.............--......---QGgl.................CDSL.........
ENSBTAP00000004588  ........VDECSS..RQHQ.............--......-----...................CHNStv.......
ENSBTAP00000054781  ........-NCCLV..CAATegep.........CG......RPVDSp..................CGES.........
ENSBTAP00000017746  ........VRWCDS..----.............--......---SP...................CKNDgr.......
ENSBTAP00000056590  ........SDPCFS..----.............--......---SP...................CGGRgy.......
ENSBTAP00000020360  ........IDECSI..IPGI.............--......-----...................CETGe........
ENSBTAP00000018790  ........SDPCFS..----.............--......---SP...................CGGRgy.......
ENSBTAP00000051405  ........VDECRD..----.............--......---NP...................CAQD.........
ENSBTAP00000021383  ........VDFCAL..----.............--......---SP...................CAHGt........
ENSBTAP00000055091  ........VDECRN..----.............--......--RSF...................CGAHav.......
ENSBTAP00000017556  ........SHACEN..---D.............QY......----Gkpgg...............CSDI.........
ENSBTAP00000052487  ........VDDCAQ..LPSP.............--......-----...................CPQR.........
ENSBTAP00000053786  ........TDECQI..----.............--......--AGV...................CQQM.........
ENSBTAP00000002944  ........ENECQT..KPGI.............--......-----...................CENGr........
ENSBTAP00000023842  ........INECAA..NTHT.............--......-----...................CSLHan.......
ENSBTAP00000010400  ........DDACIS..----.............--......---NP...................CHKGalcd.....
ENSBTAP00000035484  ........VDECTS..GENP.............--......-----...................CQQNad.......
ENSBTAP00000046844  ........VNECYL..DPGP.............--......-----...................CPKGtt.......
ENSBTAP00000025815  ........-RRCPP..CRDGha...........CN......HVTGK...................CTRCn........
ENSBTAP00000027416  ........-ITCEP..CPRPgspgtlktpeawnVS......ECGGL...................CQPG.........
ENSBTAP00000025033  ........NNGTMPg.CPAK.............KN......VCDSNs..................CHNGgt.......
ENSBTAP00000027132  ........VDECSS..RQHQ.............--......-----...................CHNStv.......
ENSBTAP00000053357  ........VDECRM..----.............--......--GGP...................CRHGgt.......
ENSBTAP00000017556  ........TNSCEL..--SP.............CR......INNGG...................CQDL.........
ENSBTAP00000049409  ........VNECDE..LNNR.............--......--MSL...................CKNAk........
ENSBTAP00000012158  ........-KPCQP..----.............--......-----...................----.........
ENSBTAP00000053357  ........INECRPgaCHVA.............--......----H...................TRDC.........
ENSBTAP00000026435  ........VNECDE..LNNR.............--......--MSL...................CKNAk........
ENSBTAP00000007756  ........HSSRQD..GLND.............CM......HNNGQ...................CGQL.........
ENSBTAP00000041372  ........IDECEV..----.............--......--SSR...................CRRGgr.......
ENSBTAP00000033786  ........IDECAS..----.............--......---DP...................CLHGgr.......
ENSBTAP00000053179  ........----ED..NHKG.............CD......ECFCSgvsnr..............CQSS.........
ENSBTAP00000046844  ........LSSCQK..VALS.............QG......TEVSSl..................CQNGgv.......
ENSBTAP00000027416  ........------..----.............--......-----...................----.........
ENSBTAP00000029274  ........VNECDD..LNG-.............--......----Paal................CVHGh........
ENSBTAP00000036514  ........GNKCAI..CHNS.............TS......----Tiyk................RTPG.........
ENSBTAP00000004913  ........FNACRC..----.............--......---GP...................CFNNge.......
ENSBTAP00000039211  ........VDRCSV..NNGG.............--......-----...................CHPQas.......
ENSBTAP00000021495  ........VRKCQP..----.............--......-----...................CQNGgt.......
ENSBTAP00000005988  ........RRECSE..SSNG.............CS......NNMNA...................CQQI.........
ENSBTAP00000039366  ........---SQS..----.............--......-----...................CSKCpphs.....
ENSBTAP00000033786  ........-RDCSD..ILLG.............CAdh....PCLNNgt.................CVPH.........
ENSBTAP00000020455  ........-VACKA..CPAG.............MF......KASQEaev................CSHCpsns.....
ENSBTAP00000001080  ........-DACQA..CSPG.............FF......KPEASesp................CLECpaht.....
ENSBTAP00000005817  ........VDECRT..GVTL.............--......-----...................CSHR.........
ENSBTAP00000037070  ........-P----..----.............--......-----...................----.........
ENSBTAP00000015261  ........-STCPT..CVQGa............CD......AVTGE...................CVCN.........
ENSBTAP00000005240  ........QDECLL..LPG-.............--......----El..................CQHL.........
ENSBTAP00000001511  ........RPA---..----.............--......-----...................CTDKd........
ENSBTAP00000014664  ........PDEYFT..CSSL.............CL......SCGAG...................CKNSmnhg.....
ENSBTAP00000008955  ........NII---..----.............--......-----...................----.........
ENSBTAP00000026780  ........------..----.............--......-----...................----.........
ENSBTAP00000037611  ........DQLCAR..CPPH.............S-......-----...................----.........
ENSBTAP00000011078  ........------..----.............--......-----...................----.........
ENSBTAP00000039368  ........------..----.............--......----Qdlq................CSRCpths.....
ENSBTAP00000008354  ........------..----.............--......-----...................----.........
ENSBTAP00000001939  ........SGLWSS..SESS.............CRvr....TCPRLrqpkhgrls..........CSAG.........


                                                                                                    
                                                                                                    
d2dtge6               YVIH.NN....KC.................................................................
ENSBTAP00000008785  FSLA.RG....SC.................................................................
ENSBTAP00000036514  WFQL.GQ....EC.................................................................
ENSBTAP00000053681  QALR.QG....HC.................................................................
ENSBTAP00000053681  VPLT.AG....SC.................................................................
ENSBTAP00000053681  FLLL.EA....QC.................................................................
ENSBTAP00000036514  RVLD.DG....RC.................................................................
ENSBTAP00000034199  CLLA.PGk...SH.................................................................
ENSBTAP00000036514  SLHI.AN....HC.................................................................
ENSBTAP00000015445  ----.--....--.................................................................
ENSBTAP00000009285  CALA.EG....QScgvy.............................................................
ENSBTAP00000036514  RVNN.HG....GC.................................................................
ENSBTAP00000036514  ----.--....--.................................................................
ENSBTAP00000011361  C---.--....--.................................................................
ENSBTAP00000053668  ----.--....--.................................................................
ENSBTAP00000047769  CQ--.--....--.................................................................
ENSBTAP00000036514  LVLD.QG....VC.................................................................
ENSBTAP00000017556  CLLS.PGg...GH.................................................................
ENSBTAP00000029056  CVDL.--....--.................................................................
ENSBTAP00000013790  HFRD.GP....HC.................................................................
ENSBTAP00000024122  CVNQ.PG....TY.................................................................
ENSBTAP00000055280  ----.--....--.................................................................
ENSBTAP00000037465  CVNT.KG....GY.................................................................
ENSBTAP00000028738  CHNT.VG....SF.................................................................
ENSBTAP00000035484  CHNT.EG....SY.................................................................
ENSBTAP00000013790  FVVD.QT....SC.................................................................
ENSBTAP00000022815  CVNT.DD....SY.................................................................
ENSBTAP00000002944  CINT.VG....SF.................................................................
ENSBTAP00000053681  LLMQ.QG....QC.................................................................
ENSBTAP00000055091  CENT.PG....SF.................................................................
ENSBTAP00000029257  CVNL.LG....SY.................................................................
ENSBTAP00000027416  CVNT.VG....SY.................................................................
ENSBTAP00000015445  YVVT.DHg...SC.................................................................
ENSBTAP00000005240  CANI.YG....SY.................................................................
ENSBTAP00000006244  CENT.PG....SF.................................................................
ENSBTAP00000020360  CINN.EG....SF.................................................................
ENSBTAP00000035484  CTNT.EG....SF.................................................................
ENSBTAP00000035484  CVNT.KG....SY.................................................................
ENSBTAP00000020360  CMNT.FG....SY.................................................................
ENSBTAP00000035484  CTNT.DG....SY.................................................................
ENSBTAP00000006244  CENT.EG....GF.................................................................
ENSBTAP00000002944  CINT.DG....SF.................................................................
ENSBTAP00000016040  CANV.YG....SY.................................................................
ENSBTAP00000055091  CENT.EG....GF.................................................................
ENSBTAP00000002944  CQNT.PG....SF.................................................................
ENSBTAP00000012158  CVNM.MG....SY.................................................................
ENSBTAP00000020360  CVNT.DG....SF.................................................................
ENSBTAP00000010680  FYLH.LG....KC.................................................................
ENSBTAP00000035484  CRNL.AG....SY.................................................................
ENSBTAP00000010571  CVSG.WN....TY.................................................................
ENSBTAP00000002944  CVNT.DG....SY.................................................................
ENSBTAP00000002944  CLNT.EG....SY.................................................................
ENSBTAP00000036514  YFMV.PS....NH.................................................................
ENSBTAP00000008880  CENL.QG....SY.................................................................
ENSBTAP00000020360  CFNE.VG....SF.................................................................
ENSBTAP00000053681  VLSH.LG....TC.................................................................
ENSBTAP00000027416  CLNV.MG....SY.................................................................
ENSBTAP00000012158  CVNT.PG....SY.................................................................
ENSBTAP00000029056  LSTD.VG....SC.................................................................
ENSBTAP00000020360  CQNT.PG....SF.................................................................
ENSBTAP00000002944  CVNT.YG....SY.................................................................
ENSBTAP00000023206  CVNE.PG....KF.................................................................
ENSBTAP00000035484  CLNT.AG....SF.................................................................
ENSBTAP00000027771  CANL.AG....SF.................................................................
ENSBTAP00000029170  FYLY.KG....KC.................................................................
ENSBTAP00000053668  FVVD.SS....SC.................................................................
ENSBTAP00000053678  CFNA.IG....SF.................................................................
ENSBTAP00000054188  CLNT.DG....SF.................................................................
ENSBTAP00000020360  CTNA.EG....SY.................................................................
ENSBTAP00000002944  CTNI.PG....EY.................................................................
ENSBTAP00000002944  CLNA.PG....GY.................................................................
ENSBTAP00000009531  CNNH.PG....TF.................................................................
ENSBTAP00000028604  CVNE.PG....RF.................................................................
ENSBTAP00000020360  CVNT.EG....SF.................................................................
ENSBTAP00000037465  CVNA.MG....SY.................................................................
ENSBTAP00000005002  ----.--....--.................................................................
ENSBTAP00000018083  FYLH.RG....RC.................................................................
ENSBTAP00000022815  CVNT.DR....SF.................................................................
ENSBTAP00000026435  CLNT.DS....SF.................................................................
ENSBTAP00000028690  FVIH.DG....EC.................................................................
ENSBTAP00000011042  CVVP.FG....VPasatvrrraqsg.....................................................
ENSBTAP00000029274  CVNT.DG....SF.................................................................
ENSBTAP00000020360  CLNV.PG....AY.................................................................
ENSBTAP00000049409  CLNT.DS....SF.................................................................
ENSBTAP00000025803  CVKS.RK....RRkgkagaaaggpvvsg..................................................
ENSBTAP00000011877  ----.--....--.................................................................
ENSBTAP00000014377  CENT.EG....SY.................................................................
ENSBTAP00000054551  CYNT.PG....SF.................................................................
ENSBTAP00000028615  ----.--....-Y.................................................................
ENSBTAP00000020360  CVNT.PG....RY.................................................................
ENSBTAP00000020360  CVNT.IG....SY.................................................................
ENSBTAP00000035484  CVNT.PG....SY.................................................................
ENSBTAP00000007349  CYPN.PG....S-.................................................................
ENSBTAP00000001939  CEDQ.LG....GF.................................................................
ENSBTAP00000009631  CYNR.AS....DY.................................................................
ENSBTAP00000029274  CINL.EG....SF.................................................................
ENSBTAP00000016858  YVIH.NN....KC.................................................................
ENSBTAP00000003826  ----.--....--.................................................................
ENSBTAP00000035484  CLNV.PG....GY.................................................................
ENSBTAP00000015268  CANL.EG....QL.................................................................
ENSBTAP00000016342  CVNL.EG....SY.................................................................
ENSBTAP00000035185  CQNL.PG....SY.................................................................
ENSBTAP00000053357  CTDH.VA....SF.................................................................
ENSBTAP00000009629  CYNL.EG....DY.................................................................
ENSBTAP00000002944  CSNT.EG....GY.................................................................
ENSBTAP00000037826  CDPH.KG....LY.................................................................
ENSBTAP00000017746  CLDG.PN....TY.................................................................
ENSBTAP00000054188  CQNL.PG....SF.................................................................
ENSBTAP00000023206  CVNT.PG....SF.................................................................
ENSBTAP00000008785  FTQL.GT....SC.................................................................
ENSBTAP00000026435  CVNT.MG....AF.................................................................
ENSBTAP00000026435  CKNT.DG....SF.................................................................
ENSBTAP00000055091  CLNT.DG....SF.................................................................
ENSBTAP00000046844  CQDQ.PG....SF.................................................................
ENSBTAP00000032310  CKNI.PG....DF.................................................................
ENSBTAP00000005988  CVLS.HR....TFngglgy...........................................................
ENSBTAP00000035484  CQNE.LG....GY.................................................................
ENSBTAP00000007111  CHNL.QG....GY.................................................................
ENSBTAP00000035484  CTNT.VG....SY.................................................................
ENSBTAP00000049409  CVNT.MG....AF.................................................................
ENSBTAP00000041521  CLPS.GQ....NY.................................................................
ENSBTAP00000013316  CQSG.VE....SY.................................................................
ENSBTAP00000027771  CLNT.HG....SF.................................................................
ENSBTAP00000055091  CENS.PG....SY.................................................................
ENSBTAP00000010400  CVDK.VN....RF.................................................................
ENSBTAP00000018719  ----.--....--.................................................................
ENSBTAP00000017556  LIDY.NR....TV.................................................................
ENSBTAP00000053678  CFNT.PG....SF.................................................................
ENSBTAP00000006244  CENS.PG....SY.................................................................
ENSBTAP00000002689  ----.--....--.................................................................
ENSBTAP00000017746  CVQH.VN....AF.................................................................
ENSBTAP00000017746  CTDC.VD....SY.................................................................
ENSBTAP00000053357  CIDL.VA....HY.................................................................
ENSBTAP00000053357  CVDG.EN....GF.................................................................
ENSBTAP00000029938  CVNT.FG....SY.................................................................
ENSBTAP00000020360  CSNT.EG....GY.................................................................
ENSBTAP00000003973  FGIH.QG....SC.................................................................
ENSBTAP00000010400  CIND.VN....GF.................................................................
ENSBTAP00000042093  CHER.AF....RY.................................................................
ENSBTAP00000017746  CRDS.LN....GY.................................................................
ENSBTAP00000012977  ----.--....--.................................................................
ENSBTAP00000053357  CKDR.VN....GF.................................................................
ENSBTAP00000007931  ----.--....--.................................................................
ENSBTAP00000043345  CING.EG....NY.................................................................
ENSBTAP00000004564  C---.--....--.................................................................
ENSBTAP00000027836  CVYD.GNa...SY.................................................................
ENSBTAP00000049409  CRNT.EG....SF.................................................................
ENSBTAP00000009629  CVDE.IN....GY.................................................................
ENSBTAP00000010400  CIDL.VN....HF.................................................................
ENSBTAP00000017746  CINT.LG....SF.................................................................
ENSBTAP00000008880  CINF.PG....HY.................................................................
ENSBTAP00000008880  CENL.PG....SF.................................................................
ENSBTAP00000017563  CLPR.EA....SY.................................................................
ENSBTAP00000000946  --PH.RG....LY.................................................................
ENSBTAP00000053678  CFNM.RG....SY.................................................................
ENSBTAP00000035484  CANT.PG....GF.................................................................
ENSBTAP00000029274  CDNT.DG....SF.................................................................
ENSBTAP00000010400  CHNT.QG....SY.................................................................
ENSBTAP00000001939  GAVD.IS....AC.................................................................
ENSBTAP00000013680  C--Y.PGlppdNF.................................................................
ENSBTAP00000005240  CHNI.QG....GF.................................................................
ENSBTAP00000021383  CLDQ.PN....GY.................................................................
ENSBTAP00000005240  CHNT.KG....SF.................................................................
ENSBTAP00000034199  CLLN.PS....GA.................................................................
ENSBTAP00000053357  CART.GA....SF.................................................................
ENSBTAP00000009531  CLAT.PG....SR.................................................................
ENSBTAP00000037465  HYNT.TT....HR.................................................................
ENSBTAP00000046844  CLNT.PG....SF.................................................................
ENSBTAP00000007111  CFNT.RG....SY.................................................................
ENSBTAP00000028604  CHNL.PG....SY.................................................................
ENSBTAP00000020360  CRNT.PG....SY.................................................................
ENSBTAP00000005529  CQFY.N-....--.................................................................
ENSBTAP00000009631  CVDE.IN....GY.................................................................
ENSBTAP00000006244  CLNT.DG....SF.................................................................
ENSBTAP00000010390  CRNL.PG....RY.................................................................
ENSBTAP00000042993  CINL.PG....WY.................................................................
ENSBTAP00000008357  LFCD.--....--.................................................................
ENSBTAP00000054188  CENT.PG....SF.................................................................
ENSBTAP00000024122  CINT.EG....GY.................................................................
ENSBTAP00000029084  CFNT.VG....SY.................................................................
ENSBTAP00000018790  CVDA.DQ....GY.................................................................
ENSBTAP00000010400  CIQD.KA....ES.................................................................
ENSBTAP00000016040  CQNT.LG....SF.................................................................
ENSBTAP00000010390  CRNL.PG....RY.................................................................
ENSBTAP00000051405  CFNT.EG....SF.................................................................
ENSBTAP00000004588  YVNT.VG....SY.................................................................
ENSBTAP00000054781  LECV.RG....LC.................................................................
ENSBTAP00000017746  CWQT.NA....LY.................................................................
ENSBTAP00000056590  CLAS.NG....SH.................................................................
ENSBTAP00000020360  CSNT.VG....SY.................................................................
ENSBTAP00000018790  CLAS.NG....SH.................................................................
ENSBTAP00000051405  CVNT.PG....SF.................................................................
ENSBTAP00000021383  CRSV.GT....SY.................................................................
ENSBTAP00000055091  CQNL.PG....SF.................................................................
ENSBTAP00000017556  CLLA.NShk..AR.................................................................
ENSBTAP00000052487  CVNT.EG....GF.................................................................
ENSBTAP00000053786  CVNY.VG....GF.................................................................
ENSBTAP00000002944  CLNT.RG....SY.................................................................
ENSBTAP00000023842  CLNT.QG....SF.................................................................
ENSBTAP00000010400  TNPL.NG....QY.................................................................
ENSBTAP00000035484  CVNI.AG....SY.................................................................
ENSBTAP00000046844  CHNT.LG....SC.................................................................
ENSBTAP00000025815  AGWI.GD....RC.................................................................
ENSBTAP00000027416  EYSA.DGf...TP.................................................................
ENSBTAP00000025033  CVNQ.WD....AF.................................................................
ENSBTAP00000027132  CINT.VG....SY.................................................................
ENSBTAP00000053357  CLNT.PG....SF.................................................................
ENSBTAP00000017556  CLLThQG....HV.................................................................
ENSBTAP00000049409  CINT.EG....SY.................................................................
ENSBTAP00000012158  ----.--....--.................................................................
ENSBTAP00000053357  LQDP.GG....GF.................................................................
ENSBTAP00000026435  CINT.EG....SY.................................................................
ENSBTAP00000007756  CLAV.PS....GH.................................................................
ENSBTAP00000041372  CVNT.RG....SY.................................................................
ENSBTAP00000033786  CHDL.LN....GF.................................................................
ENSBTAP00000053179  YWTY.GN....IQdmsgwyltdisghirvapqlddldppqqisissvearqalpqsyfwsapapylgnkltaaggqlm
ENSBTAP00000046844  CIDS.GP....SH.................................................................
ENSBTAP00000027416  ----.--....--.................................................................
ENSBTAP00000029274  CENT.EG....SY.................................................................
ENSBTAP00000036514  TYLL.AQ....TC.................................................................
ENSBTAP00000004913  PILE.GT....SC.................................................................
ENSBTAP00000039211  CSLA.LGs...LP.................................................................
ENSBTAP00000021495  VVLL.DG....EC.................................................................
ENSBTAP00000005988  CLPV.PGr...LF.................................................................
ENSBTAP00000039366  YTHE.EA....ST.................................................................
ENSBTAP00000033786  VHDG.QH....GF.................................................................
ENSBTAP00000020455  RSPS.EA....SP.................................................................
ENSBTAP00000001080  LPSS.EG....AT.................................................................
ENSBTAP00000005817  CLNT.AG....SF.................................................................
ENSBTAP00000037070  ----.--....--.................................................................
ENSBTAP00000015261  AGYW.GP....SC.................................................................
ENSBTAP00000005240  CINT.VG....SY.................................................................
ENSBTAP00000001511  YFYT.HT....ACdangetqlmykwaqpkicsedlegavklpasglktg.............................
ENSBTAP00000014664  KEGV.PH....EA.................................................................
ENSBTAP00000008955  ----.--....--.................................................................
ENSBTAP00000026780  ----.--....--.................................................................
ENSBTAP00000037611  HSAA.PA....AQ.................................................................
ENSBTAP00000011078  ----.--....--.................................................................
ENSBTAP00000039368  FSDK.EG....SS.................................................................
ENSBTAP00000008354  ----.--....--.................................................................
ENSBTAP00000001939  EMSY.RT....MC.................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000009285  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000011361  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000047769  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000055280  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000028738  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000029257  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000010680  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000029170  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000005002  ..............................................................................
ENSBTAP00000018083  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000025803  ..............................................................................
ENSBTAP00000011877  ..............................................................................
ENSBTAP00000014377  ..............................................................................
ENSBTAP00000054551  ..............................................................................
ENSBTAP00000028615  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007349  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000003826  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000015268  ..............................................................................
ENSBTAP00000016342  ..............................................................................
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000037826  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000041521  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000018719  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002689  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000042093  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000012977  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000007931  ..............................................................................
ENSBTAP00000043345  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000027836  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000000946  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000013680  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000005529  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000008357  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000029084  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000004588  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000056590  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000052487  ..............................................................................
ENSBTAP00000053786  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000025815  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000027132  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000007756  ..............................................................................
ENSBTAP00000041372  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ftvsydleeanedaehtlqlmvilegkdlrissaqeevylqpseehinvlslkeesftthgtnfpvsrkefmtvlvnl
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000004913  ..............................................................................
ENSBTAP00000039211  ..............................................................................
ENSBTAP00000021495  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000039366  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000020455  ..............................................................................
ENSBTAP00000001080  ..............................................................................
ENSBTAP00000005817  ..............................................................................
ENSBTAP00000037070  ..............................................................................
ENSBTAP00000015261  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000001511  ..............................................................................
ENSBTAP00000014664  ..............................................................................
ENSBTAP00000008955  ..............................................................................
ENSBTAP00000026780  ..............................................................................
ENSBTAP00000037611  ..............................................................................
ENSBTAP00000011078  ..............................................................................
ENSBTAP00000039368  ..............................................................................
ENSBTAP00000008354  ..............................................................................
ENSBTAP00000001939  ..............................................................................


                                                              130                   140             
                                                                |                     |             
d2dtge6               .........................................IPE....CPSG........YTMNSSN...LLCTP...
ENSBTAP00000008785  .........................................IPD....CEPG........TYFDSEL...IQCGE...
ENSBTAP00000036514  .........................................LTQ....CREG........YYAENST...GQCRR...
ENSBTAP00000053681  .........................................LPN....CGEA........FYP--DH...GVCKA...
ENSBTAP00000053681  .........................................RAR....CKEE........QFLN-LV...GYCAD...
ENSBTAP00000053681  .........................................VQE....CGKG........FFADHAN...HKCTA...
ENSBTAP00000036514  .........................................VLN....CSLG........KFE--FR...NQCHP...
ENSBTAP00000034199  .........................................TCA....CPTN........FYLAADN...RTCLSn..
ENSBTAP00000036514  .........................................LIL....STSG........WFHYAVS...KKCDV...
ENSBTAP00000015445  .........................................---....----........-------...-----...
ENSBTAP00000009285  .........................................TER....CAQG........L------...-RC--...
ENSBTAP00000036514  .........................................---....----........-------...-----...
ENSBTAP00000036514  .........................................--V....CPAN........LVLHMDD...SRCLR...
ENSBTAP00000011361  .........................................---....----........-------...-----...
ENSBTAP00000053668  .........................................---....----........-------...-----...
ENSBTAP00000047769  .........................................---....----........-------...-----...
ENSBTAP00000036514  .........................................RET....CPER........HVA--ME...GVCKR...
ENSBTAP00000017556  .........................................KCA....CPTN........FYLGGDG...RNCVSn..
ENSBTAP00000029056  .........................................---....----........-------...-----...
ENSBTAP00000013790  .........................................VSS....CPFGvlgakgpiYKYPDAQ...NECRP...
ENSBTAP00000024122  .........................................FCS....CPAG........YILLDDN...RSCQDine
ENSBTAP00000055280  .........................................---....----........-------...-----...
ENSBTAP00000037465  .........................................ECV....CPPG........RRLHWNR...KDCV-...
ENSBTAP00000028738  .........................................LCT....CRPG........FRLRADR...VSCE-...
ENSBTAP00000035484  .........................................VCT....CPVG........YALREDG...AMCRDvde
ENSBTAP00000013790  .........................................VRA....CPPD........KMEVDKNgl.KICEP...
ENSBTAP00000022815  .........................................ACR....CLKG........FTLNPDQ...KTCR-...
ENSBTAP00000002944  .........................................QCQ....CNEG........YEVAPDG...RTCV-...
ENSBTAP00000053681  .........................................VST....CGIG........FYQ--DR...HSCAA...
ENSBTAP00000055091  .........................................LCV....CPAG........YQAAPHG...ASCQD...
ENSBTAP00000029257  .........................................RCE....CRSG........YEFADDR...HTCILitp
ENSBTAP00000027416  .........................................ECH....CHSG........YKLHWNK...KDCV-...
ENSBTAP00000015445  .........................................VRA....CSSD........SQEVEEDgv.RKCKK...
ENSBTAP00000005240  .........................................QCY....CRQG........YQLAEDG...HTCTD...
ENSBTAP00000006244  .........................................LCV....CPAG........YQAAPHG...ASCQD...
ENSBTAP00000020360  .........................................RCD....CPPG........LAVGVDG...RVCV-...
ENSBTAP00000035484  .........................................HCR....CLGG........LAVAADG...RVCVD...
ENSBTAP00000035484  .........................................QCE....CGPG........YSLMPDG...RACEDvde
ENSBTAP00000020360  .........................................ECT....CPIG........YALREDQ...KMCKDlde
ENSBTAP00000035484  .........................................ECQ....CPPG........HALAAEG...TACED...
ENSBTAP00000006244  .........................................QCV....CPTG........FQPNAAG...SECED...
ENSBTAP00000002944  .........................................HCV....CNAG........FHVTRDG...KNCED...
ENSBTAP00000016040  .........................................QCY....CRRG........YQLSDVDg..VTCE-...
ENSBTAP00000055091  .........................................QCV....CPTG........FQPNAAG...SECED...
ENSBTAP00000002944  .........................................TCE....CQRG........FSLDPSG...ASCED...
ENSBTAP00000012158  .........................................ECH....CREG........FFLSDNQ...HTCIQ...
ENSBTAP00000020360  .........................................QCI....CNAG........FELTTDG...KNCVD...
ENSBTAP00000010680  .........................................LDN....CPEG........LEANNHT...MECVSivh
ENSBTAP00000035484  .........................................ACE....CAPG........SRLGPSG...TMCL-...
ENSBTAP00000010571  .........................................LCE....CPLR........F----GG...KNCEQ...
ENSBTAP00000002944  .........................................RCE....CFPG........LAVGLDG...RVCV-...
ENSBTAP00000002944  .........................................RCE....CPPG........HQLAPNI...SACIDine
ENSBTAP00000036514  .........................................TCQkle.CGQG........EIQDPDY...EECVS...
ENSBTAP00000008880  .........................................VCI....CDEG........FTPTQDQ...HGCE-...
ENSBTAP00000020360  .........................................KCL....CNEG........YELTPDG...KNCI-...
ENSBTAP00000053681  .........................................SIA....CFPG........HYLD-DN...RVCQP...
ENSBTAP00000027416  .........................................ECR....CQEG........FFLSDNQ...HTCIH...
ENSBTAP00000012158  .........................................QCT....CPAG........QGRLHWNg..KDC--...
ENSBTAP00000029056  .........................................TLV....CPLN........NQEVTAEdgtQRCEK...
ENSBTAP00000020360  .........................................SCE....CQRG........FSLDATG...LNCEDvde
ENSBTAP00000002944  .........................................ECK....CPAG........YVLREDR...RMCKDede
ENSBTAP00000023206  .........................................SCM....CPQG........YQVV-RG...RTCQD...
ENSBTAP00000035484  .........................................HCL....CKDG........FELTSDG...KNCI-...
ENSBTAP00000027771  .........................................QCS....CEAG........YQLDEDR...RGCT-...
ENSBTAP00000029170  .........................................LPT....CPPG........TAAQQST...RECQEece
ENSBTAP00000053668  .........................................VRA....CPSS........KMEVEENgi.KMCKP...
ENSBTAP00000053678  .........................................HCG....CEPG........YQL--KG...RKCVD...
ENSBTAP00000054188  .........................................ACT....CAPG........YRPGPRG...ASCLD...
ENSBTAP00000020360  .........................................ECS....CSEG........YALMPDG...RSCADide
ENSBTAP00000002944  .........................................RCL....CYDG........FMASEDM...KTCV-...
ENSBTAP00000002944  .........................................RCE....CDMG........FVPSADG...KACED...
ENSBTAP00000009531  .........................................RCE....CVEG........YQFS-EA...GTCV-...
ENSBTAP00000028604  .........................................SCH....CPQG........YQLL-AT...RLCQDide
ENSBTAP00000020360  .........................................QCD....CPLG........HELSPSR...EDCV-...
ENSBTAP00000037465  .........................................ECQ....CHSG........FFLSDNQ...HTCIH...
ENSBTAP00000005002  .........................................---....----........-------...MEC--...
ENSBTAP00000018083  .........................................FEE....CPDG........FAALDET...MECVE...
ENSBTAP00000022815  .........................................VCE....CPEG........HVLRSDG...KTCAK...
ENSBTAP00000026435  .........................................HCI....CEQG........FSISADG...RTCEDide
ENSBTAP00000028690  .........................................MQE....CPSG........FIRNGSQs..MYCIP...
ENSBTAP00000011042  .........................................LCV....CASN........-------...-----...
ENSBTAP00000029274  .........................................NCV....CETG........FQPSPES...GECVD...
ENSBTAP00000020360  .........................................RCE....CEMG........FTPASDS...RSCQD...
ENSBTAP00000049409  .........................................HCI....CEQG........FSISADG...RTCEDide
ENSBTAP00000025803  .........................................VCV....CKSR........Y------...-----...
ENSBTAP00000011877  .........................................---....----........-------...-----...
ENSBTAP00000014377  .........................................RCI....CADG........YKQ--ME...GICV-...
ENSBTAP00000054551  .........................................VCV....CPDG........FEE--AE...DTCV-...
ENSBTAP00000028615  .........................................TPN....CAPG........LQC----...-----...
ENSBTAP00000020360  .........................................ECN....CPPD........FQLNPTG...VGCVDn..
ENSBTAP00000020360  .........................................RCE....CNEG........FQSSSSG...TECL-...
ENSBTAP00000035484  .........................................LCN....CPQD........FELNPSG...VGCVDt..
ENSBTAP00000007349  .........................................---....----........-------...-----...
ENSBTAP00000001939  .........................................LCK....CPPG........F----LG...TRCDI...
ENSBTAP00000009631  .........................................FCK....CPED........Y----EG...KNCSH...
ENSBTAP00000029274  .........................................RCS....CEQG........YEVTPDE...KGCQD...
ENSBTAP00000016858  .........................................IPE....CPSG........YTMNSSN...LMCTP...
ENSBTAP00000003826  .........................................--S....CPSH........ASLDPVE...QTC--...
ENSBTAP00000035484  .........................................RCE....CEMG........FSPTKDQ...HACQD...
ENSBTAP00000015268  .........................................CDL....DPS-........-------...-----...
ENSBTAP00000016342  .........................................KCE....CEEG........FRLEPLT...KACK-...
ENSBTAP00000035185  .........................................SCV....CDEG........YVFSSQE...KGCQD...
ENSBTAP00000053357  .........................................TCT....CPPG........Y----SG...FHCEQ...
ENSBTAP00000009629  .........................................YCA....CPDD........M----GG...KNCSE...
ENSBTAP00000002944  .........................................LCA....CPPG........YFRI-GQ...GHCV-...
ENSBTAP00000037826  .........................................CD-....----........-------...-----...
ENSBTAP00000017746  .........................................TCV....CTEG........Y----TG...PHCEV...
ENSBTAP00000054188  .........................................QCL....CDQG........YEGARDG...RHCE-...
ENSBTAP00000023206  .........................................YCQ....CNPG........FQLAANN...YTCVDine
ENSBTAP00000008785  .........................................I--....----........-----TN...HTC--...
ENSBTAP00000026435  .........................................RCEy...CDSG........YHMT-PG...GQCED...
ENSBTAP00000026435  .........................................RCT....CGQG........YQLSAAK...DQCED...
ENSBTAP00000055091  .........................................ACT....CAPG........YRPGPRG...ASCLD...
ENSBTAP00000046844  .........................................HCK....CPPG........F----EG...PRCQE...
ENSBTAP00000032310  .........................................ECE....CAEG........YKYNPVS...KSC--...
ENSBTAP00000005988  .........................................RCK....CRLG........YIPDWDD...YHCV-...
ENSBTAP00000035484  .........................................RCS....CPQG........FTPHSQW...SQCVDene
ENSBTAP00000007111  .........................................RCL....CPPG........QTLLRDG...KTCTP...
ENSBTAP00000035484  .........................................VCT....CPHG........YASSLDG...TRCLD...
ENSBTAP00000049409  .........................................RCEy...CDSG........YHMT-PG...GQCED...
ENSBTAP00000041521  .........................................TCA....CPTG........FRKI-SS...-----...
ENSBTAP00000013316  .........................................YCH....CPFG........V----FG...KHCE-...
ENSBTAP00000027771  .........................................KCV....CNAG........YELGADG...RQCY-...
ENSBTAP00000055091  .........................................RCVrd..CDPG........YHAG-PE...GTC--...
ENSBTAP00000010400  .........................................QCL....CPPG........F----TG...PVCQI...
ENSBTAP00000018719  .........................................---....----........-------...-----...
ENSBTAP00000017556  .........................................SCA....CPHL........MKLHKDN...TTCY-...
ENSBTAP00000053678  .........................................KCI....CPPG........QHLLGDG...KSC--...
ENSBTAP00000006244  .........................................RCVrd..CDPG........YHAG-PE...GTC--...
ENSBTAP00000002689  .........................................---....----........-------...-----...
ENSBTAP00000017746  .........................................HCE....CRAG........H----TG...RRCES...
ENSBTAP00000017746  .........................................TCT....CPTG........F----SG...IHCEN...
ENSBTAP00000053357  .........................................LCS....CPPG........T----LG...VLCEI...
ENSBTAP00000053357  .........................................RCL....CPPG........S----LP...PLCLP...
ENSBTAP00000029938  .........................................ICK....CHKG........F------...-----...
ENSBTAP00000020360  .........................................LCG....CPPG........YYRV-GQ...GHCV-...
ENSBTAP00000003973  .........................................LAQ....CPPG........FTRNDSS...IFCHK...
ENSBTAP00000010400  .........................................RCI....CPEG........P----HH...PSCYS...
ENSBTAP00000042093  .........................................LCE....CARG........Y----GG...PNCQ-...
ENSBTAP00000017746  .........................................KCD....CDPG........W----SG...ANCDV...
ENSBTAP00000012977  .........................................---....----........-------...-----...
ENSBTAP00000053357  .........................................SCT....CPSG........F----SG...AMCQL...
ENSBTAP00000007931  .........................................---....----........-------...-----...
ENSBTAP00000043345  .........................................SCV....CPAG........YLG--DG...RHCEC...
ENSBTAP00000004564  .........................................---....----........-------...-----...
ENSBTAP00000027836  .........................................HCD....CDTG........YTLNEDK...KTCS-...
ENSBTAP00000049409  .........................................RCV....CDHG........YRASALG...DHCE-...
ENSBTAP00000009629  .........................................RCS....CPPG........R----SG...LRCQ-...
ENSBTAP00000010400  .........................................KCS....CPPG........T----RG...LLCEE...
ENSBTAP00000017746  .........................................ECQ....CLQG........Y----TG...PRCEI...
ENSBTAP00000008880  .........................................KCN....CYPG........YRL----...-----...
ENSBTAP00000008880  .........................................RCT....CAQG........YAPAQDG...RSCLD...
ENSBTAP00000017563  .........................................ECL....CPAG........F----SG...LHCE-...
ENSBTAP00000000946  .........................................C--....----........-------...-----...
ENSBTAP00000053678  .........................................RCIetp.CPPD........YQRDPVS...GFCLKn..
ENSBTAP00000035484  .........................................LCG....CPRG........YFRA-GQ...GHCV-...
ENSBTAP00000029274  .........................................RCL....CDQG........FETSPSG...WDCV-...
ENSBTAP00000010400  .........................................MCE....CPPG........F----SG...MDCEE...
ENSBTAP00000001939  .........................................GVP....CPVG........EFSRSGL...MPCYP...
ENSBTAP00000013680  .........................................VCN....CPYG........F----VG...SRC--...
ENSBTAP00000005240  .........................................RCLrfd.CPPN........YVRV-SE...TKCERal.
ENSBTAP00000021383  .........................................TCH....CPHG........W----VG...ANC--...
ENSBTAP00000005240  .........................................YCQarqrCLEG........FLQD-PE...GNC--...
ENSBTAP00000034199  .........................................TCA....CPEG........KYL--IN...GTC--...
ENSBTAP00000053357  .........................................YCL....CPPG........W----SG...RLCDI...
ENSBTAP00000009531  .........................................TCR....CPDN........T----LG...VDC--...
ENSBTAP00000037465  .........................................CIR....CPVG........TYQPEFGq..NHCIT...
ENSBTAP00000046844  .........................................ECL....CPPG........Y----TG...SRCEA...
ENSBTAP00000007111  .........................................QCVdtp.CPAT........YRQGSSP...GTCFRr..
ENSBTAP00000028604  .........................................QCT....CPDG........YRK--IG...PECVD...
ENSBTAP00000020360  .........................................SCT....CPPG........YVFRTET...ETCE-...
ENSBTAP00000005529  .........................................---....----........-------...-----...
ENSBTAP00000009631  .........................................RCI....CPPG........H----SG...AKCQ-...
ENSBTAP00000006244  .........................................ACT....CAPG........YRPGPRG...ASCLD...
ENSBTAP00000010390  .........................................ECS....CLTG........F------...-----...
ENSBTAP00000042993  .........................................HCE....CRDG........Y------...-----...
ENSBTAP00000008357  .........................................---....----........-------...-----...
ENSBTAP00000054188  .........................................RCV....CGPG........FRAGPRG...TECLD...
ENSBTAP00000024122  .........................................TCS....CTDG........YWL--LE...GQCL-...
ENSBTAP00000029084  .........................................TCH....CREG........W------...-----...
ENSBTAP00000018790  .........................................VCE....CPEG........F----MG...LDCR-...
ENSBTAP00000010400  .........................................RCL....CPSG........W----AG...AYCDV...
ENSBTAP00000016040  .........................................RCRpklqCKSG........FIQD-AL...GNC--...
ENSBTAP00000010390  .........................................ECS....CLTG........F------...-----...
ENSBTAP00000051405  .........................................RCG....CLPG........WELDPNG...VSCT-...
ENSBTAP00000004588  .........................................TCH....CRQG........W------...-----...
ENSBTAP00000054781  .........................................RC-....----........-------...-----...
ENSBTAP00000017746  .........................................RCE....CHSG........W----TG...LYCDV...
ENSBTAP00000056590  .........................................SCT....CKVG........Y----TG...RDCD-...
ENSBTAP00000020360  .........................................FCV....CPRG........YVTSTDG...SRCIG...
ENSBTAP00000018790  .........................................SCT....CKVG........Y----TG...RDCD-...
ENSBTAP00000051405  .........................................RCE....CWVG........FE-----...-----...
ENSBTAP00000021383  .........................................KCL....CDPG........Y----HG...LYCEE...
ENSBTAP00000055091  .........................................QCL....CDQG........YEGARDG...RHCV-...
ENSBTAP00000017556  .........................................TCR....CRSG........FSLGSDG...KSC--...
ENSBTAP00000052487  .........................................QCH....CDTG........YEL--VD...GECVD...
ENSBTAP00000053786  .........................................ECY....CSEG........HELEADG...ISCSP...
ENSBTAP00000002944  .........................................TCE....CNDG........FTASPNQ...DECLD...
ENSBTAP00000023842  .........................................KYK....CKRG........YKG--SG...LQCA-...
ENSBTAP00000010400  .........................................ICT....CPQG........Y----KG...SDCTE...
ENSBTAP00000035484  .........................................RCK....CAQG........YKLS-PG...GACV-...
ENSBTAP00000046844  .........................................QCL....CPAG........R----EG...PRCGL...
ENSBTAP00000025815  .........................................ETK....CSNG........TYGEDCA...FVCAD...
ENSBTAP00000027416  .........................................CQP....CARG........TFQPEAGr..TSCFP...
ENSBTAP00000025033  .........................................SCE....CPLG........F----GG...KSCA-...
ENSBTAP00000027132  .........................................TCH....CRQG........W------...-----...
ENSBTAP00000053357  .........................................RCQ....CPGG........Y----TG...PLCESpav
ENSBTAP00000017556  .........................................NCS....CRGG........RILQ-DD...FTCQA...
ENSBTAP00000049409  .........................................KCV....CLPG........FVPSDKP...NYCTP...
ENSBTAP00000012158  .........................................---....CPRG........TYQPEAGr..TLCFP...
ENSBTAP00000053357  .........................................RCL....CHPG........F----TG...PRCQT...
ENSBTAP00000026435  .........................................KCV....CLPG........FVPSDKP...NYCTP...
ENSBTAP00000007756  .........................................RCS....CASH........YTLDPSS...RNCSP...
ENSBTAP00000041372  .........................................ECY....CMDG........Y------...-----...
ENSBTAP00000033786  .........................................RCV....CALA........F----AG...PRC--...
ENSBTAP00000053179  qriliqityslgmdaifrlssvnlesavpispdgsfataveVCQ....CPPG........Y----TG...SSCES...
ENSBTAP00000046844  .........................................FCH....CPPG........F----QG...SICQD...
ENSBTAP00000027416  .........................................---....----........-------...-----...
ENSBTAP00000029274  .........................................RCH....CLPG........YVAEAGP...PHC--...
ENSBTAP00000036514  .........................................VPS....CPQG........TWPSVRS...GSCEN...
ENSBTAP00000004913  .........................................KCQ....CPVG........H----QG...LACE-...
ENSBTAP00000039211  .........................................LCT....CLPG........YTGNGYGp..NGCVQ...
ENSBTAP00000021495  .........................................VCS....CPKE........F----KG...VAC--...
ENSBTAP00000005988  .........................................SCA....CATG........FKLNPDH...QTCSP...
ENSBTAP00000039366  .........................................SCV....CEKD........YFRRESD...-----...
ENSBTAP00000033786  .........................................DCL....CPPG........Y----TG...SRC--...
ENSBTAP00000020455  .........................................ICT....CRTG........YYRAD--...-----...
ENSBTAP00000001080  .........................................ACE....CEDG........YFRAPQ-...-----...
ENSBTAP00000005817  .........................................TCG....CPHG........LVLGLDG...RTCA-...
ENSBTAP00000037070  .........................................---....----........-------...-----...
ENSBTAP00000015261  .........................................NTS....CPSG........FHGNNCS...VPCEC...
ENSBTAP00000005240  .........................................RCA....CFPG........FSLQDDG...RTCRP...
ENSBTAP00000001511  .........................................CPP....CNPG........FFKT-NS...STCEP...
ENSBTAP00000014664  .........................................KSR....CRYS........HQYDNRV...FTCKA...
ENSBTAP00000008955  .........................................CKK....CGWN........------V...KQCEP...
ENSBTAP00000026780  .........................................---....----........-------...-----...
ENSBTAP00000037611  .........................................ACR....CDLS........YYR----...-----...
ENSBTAP00000011078  .........................................---....----........-------...-----...
ENSBTAP00000039368  .........................................RCD....CEDG........YYRA---...-----...
ENSBTAP00000008354  .........................................---....----........-------...-----...
ENSBTAP00000001939  .........................................LVT....CDEG........YRLEGSAr..LTC--...


                               150                                                                  
                                 |                                                                  
d2dtge6               .........CLGPC---pkv..........................................................
ENSBTAP00000008785  .........CHHTCRTCvg...........................................................
ENSBTAP00000036514  .........CHRSCKACqg...........................................................
ENSBTAP00000053681  .........CHTSCLTCvg...........................................................
ENSBTAP00000053681  .........CHPLCHHCa............................................................
ENSBTAP00000053681  .........CPKGCLQCs............................................................
ENSBTAP00000036514  .........CHFTCQECqg...........................................................
ENSBTAP00000034199  .........CTASQFRC.............................................................
ENSBTAP00000036514  .........C-------r............................................................
ENSBTAP00000015445  .........--------glegc........................................................
ENSBTAP00000009285  .........--------lprqdeekplhallhgrgvclneksy...................................
ENSBTAP00000036514  .........--------vp...........................................................
ENSBTAP00000036514  .........CC------sasdptdaqeccdchd.............................................
ENSBTAP00000011361  .........--------ypprgvekplhtlvhgqgvcmela.....................................
ENSBTAP00000053668  .........--------tshdc........................................................
ENSBTAP00000047769  .........--------pppgdprplqalldgrglcanas......................................
ENSBTAP00000036514  .........CPEMCQDCi............................................................
ENSBTAP00000017556  .........CTASQFVC.............................................................
ENSBTAP00000029056  .........--------ddkgc........................................................
ENSBTAP00000013790  .........CHENCT--qgckgpelqdc..................................................
ENSBTAP00000024122  .........CEHRNHTC.............................................................
ENSBTAP00000055280  .........--------lgaacgvatarcarglscralpgeprplhaltrgqgacmtt....................
ENSBTAP00000037465  .........--------etgrc........................................................
ENSBTAP00000028738  .........--------a............................................................
ENSBTAP00000035484  .........CADGEQDC.............................................................
ENSBTAP00000013790  .........CGGLC---pkace........................................................
ENSBTAP00000022815  .........--------r............................................................
ENSBTAP00000002944  .........--------d............................................................
ENSBTAP00000053681  .........CHESCAACwgpt.........................................................
ENSBTAP00000055091  .........--------.............................................................
ENSBTAP00000029257  .....ppnpCEDGHHNC.............................................................
ENSBTAP00000027416  .........--------e............................................................
ENSBTAP00000015445  .........CDGPC---gkvcng.......................................................
ENSBTAP00000005240  .........--------i............................................................
ENSBTAP00000006244  .........V-------dec..........................................................
ENSBTAP00000020360  .........--------d............................................................
ENSBTAP00000035484  .........--------thv..........................................................
ENSBTAP00000035484  .........CEQNPDIC.............................................................
ENSBTAP00000020360  .........CAEGLHDC.............................................................
ENSBTAP00000035484  .........--------v............................................................
ENSBTAP00000006244  .........V-------dec..........................................................
ENSBTAP00000002944  .........M-------dec..........................................................
ENSBTAP00000016040  .........--------di...........................................................
ENSBTAP00000055091  .........V-------dec..........................................................
ENSBTAP00000002944  .........V-------dec..........................................................
ENSBTAP00000012158  .........RPEEGMNC.............................................................
ENSBTAP00000020360  .........--------h............................................................
ENSBTAP00000010680  .........C-------easewspwspctkkgktc...........................................
ENSBTAP00000035484  .........--------d............................................................
ENSBTAP00000010571  .........--------v............................................................
ENSBTAP00000002944  .........--------d............................................................
ENSBTAP00000002944  .........CELSAHLC.............................................................
ENSBTAP00000036514  .........CEEGC---l............................................................
ENSBTAP00000008880  .........--------ev...........................................................
ENSBTAP00000020360  .........--------d............................................................
ENSBTAP00000053681  .........CNMHCGRCdsqasctscr...................................................
ENSBTAP00000027416  .........RSEEGLSC.............................................................
ENSBTAP00000012158  .........--------te...........................................................
ENSBTAP00000029056  .........CSKPC---apvcy........................................................
ENSBTAP00000020360  .........CDG-----n............................................................
ENSBTAP00000002944  .........CEEGKHDC.............................................................
ENSBTAP00000023206  .........--------inec.........................................................
ENSBTAP00000035484  .........--------d............................................................
ENSBTAP00000027771  .........--------.............................................................
ENSBTAP00000029170  lnpwgswspCTHN----gktcgs.......................................................
ENSBTAP00000053668  .........CTDIC---p............................................................
ENSBTAP00000053678  .........--------inecrq.......................................................
ENSBTAP00000054188  .........--------vdec.........................................................
ENSBTAP00000020360  .........CENNPDIC.............................................................
ENSBTAP00000002944  .........--------d............................................................
ENSBTAP00000002944  .........I-------dec..........................................................
ENSBTAP00000009531  .........--------aavglrp......................................................
ENSBTAP00000028604  .........CESGAHQC.............................................................
ENSBTAP00000020360  .........--------d............................................................
ENSBTAP00000037465  .........RSSEGMNC.............................................................
ENSBTAP00000005002  .........--------s............................................................
ENSBTAP00000018083  .........--------gce..........................................................
ENSBTAP00000022815  .........--------ldacal.......................................................
ENSBTAP00000026435  .........CV------nn...........................................................
ENSBTAP00000028690  .........CEGPC---.............................................................
ENSBTAP00000011042  .........--------epvcgsd......................................................
ENSBTAP00000029274  .........--------i............................................................
ENSBTAP00000020360  .........I-------dec..........................................................
ENSBTAP00000049409  .........CV------nn...........................................................
ENSBTAP00000025803  .........--------pvcgsdg......................................................
ENSBTAP00000011877  .........--------cdrglrcvirpplngdsiteyevgvced.................................
ENSBTAP00000014377  .........--------k............................................................
ENSBTAP00000054551  .........--------q............................................................
ENSBTAP00000028615  .........--------qppekedlplrallqgrgrcgra......................................
ENSBTAP00000020360  .........RVGNC---.............................................................
ENSBTAP00000020360  .........--------d............................................................
ENSBTAP00000035484  .........RVGNC---.............................................................
ENSBTAP00000007349  .........--------elplralvhgegtcekh............................................
ENSBTAP00000001939  .........NMDEC---l............................................................
ENSBTAP00000009631  .........LKDH----c............................................................
ENSBTAP00000029274  .........--------v............................................................
ENSBTAP00000016858  .........CLGPC---.............................................................
ENSBTAP00000003826  .........--------s............................................................
ENSBTAP00000035484  .........--------vd...........................................................
ENSBTAP00000015268  .........--------ahfygrcgeqlecrldaggdlsrgevpeplcvcrsqrplcgsdg.................
ENSBTAP00000016342  .........--------avgtiaylfftnrhevrkmtldrseytslipnlknvvaldtevasnriywsdlsqrkiysa
ENSBTAP00000035185  .........--------t............................................................
ENSBTAP00000053357  .........DLPDC---spssc........................................................
ENSBTAP00000009629  .........--------prapc........................................................
ENSBTAP00000002944  .........--------.............................................................
ENSBTAP00000037826  .........--------ysadrpryetgvcayli............................................
ENSBTAP00000017746  .........DIDEC---.............................................................
ENSBTAP00000054188  .........--------t............................................................
ENSBTAP00000023206  .........C-------d............................................................
ENSBTAP00000008785  .........--------snadet.......................................................
ENSBTAP00000026435  .........--------v............................................................
ENSBTAP00000026435  .........I-------dec..........................................................
ENSBTAP00000055091  .........--------vdec.........................................................
ENSBTAP00000046844  .........EVDEC---l............................................................
ENSBTAP00000032310  .........--------.............................................................
ENSBTAP00000005988  .........--------a............................................................
ENSBTAP00000035484  .........C-------vls..........................................................
ENSBTAP00000007111  .........--------.............................................................
ENSBTAP00000035484  .........--------hrag.........................................................
ENSBTAP00000049409  .........V-------dec..........................................................
ENSBTAP00000041521  .........--------hac..........................................................
ENSBTAP00000013316  .........--------l............................................................
ENSBTAP00000027771  .........--------r............................................................
ENSBTAP00000055091  .........--------d............................................................
ENSBTAP00000010400  .........DIDDC---.............................................................
ENSBTAP00000018719  .........--------raagaapegtglcvcaqrgsvcgsdg...................................
ENSBTAP00000017556  .........--------.............................................................
ENSBTAP00000053678  .........--------.............................................................
ENSBTAP00000006244  .........--------d............................................................
ENSBTAP00000002689  .........--------svllpceesrglfcdrradpsaqtgicmavegdncvfdg......................
ENSBTAP00000017746  .........VINGC---k............................................................
ENSBTAP00000017746  .........NTPDC---.............................................................
ENSBTAP00000053357  .........NEDDC---.............................................................
ENSBTAP00000053357  .........PSHPC---.............................................................
ENSBTAP00000029938  .........--------dlm..........................................................
ENSBTAP00000020360  .........--------.............................................................
ENSBTAP00000003973  .........CEGLC---pkec.........................................................
ENSBTAP00000010400  .........QVNEC---.............................................................
ENSBTAP00000042093  .........--------f............................................................
ENSBTAP00000017746  .........NNDEC---.............................................................
ENSBTAP00000012977  .........--------aqsegrpceyn..................................................
ENSBTAP00000053357  .........DVDEC---.............................................................
ENSBTAP00000007931  .........--------pgagpggrgavclwgeddgscevn.....................................
ENSBTAP00000043345  .........SPGSC---.............................................................
ENSBTAP00000004564  .........--------lapraprllggrplgtcgcpaagatvcgsdg..............................
ENSBTAP00000027836  .........--------a............................................................
ENSBTAP00000049409  .........--------d............................................................
ENSBTAP00000009629  .........--------e............................................................
ENSBTAP00000010400  .........NVDDC---.............................................................
ENSBTAP00000017746  .........DVNEC---.............................................................
ENSBTAP00000008880  .........--------kasr.........................................................
ENSBTAP00000008880  .........V-------dec..........................................................
ENSBTAP00000017563  .........--------k............................................................
ENSBTAP00000000946  .........--------dysgdhpryavgvcaqvv...........................................
ENSBTAP00000053678  .........CPPNDLEC.............................................................
ENSBTAP00000035484  .........--------s............................................................
ENSBTAP00000029274  .........--------d............................................................
ENSBTAP00000010400  .........DIDDC---.............................................................
ENSBTAP00000001939  .........CPQD----yy...........................................................
ENSBTAP00000013680  .........--------e............................................................
ENSBTAP00000005240  .........CH------d............................................................
ENSBTAP00000021383  .........--------e............................................................
ENSBTAP00000005240  .........--------v............................................................
ENSBTAP00000034199  .........--------n............................................................
ENSBTAP00000053357  .........RSLPC---.............................................................
ENSBTAP00000009531  .........--------i............................................................
ENSBTAP00000037465  .........CPGNT---stdfdgstnvthcknqhcg..........................................
ENSBTAP00000046844  .........DHNEC---l............................................................
ENSBTAP00000007111  .........CSQDC---s............................................................
ENSBTAP00000028604  .........--------i............................................................
ENSBTAP00000020360  .........--------v............................................................
ENSBTAP00000005529  .........--------eeddfgdefgickd...............................................
ENSBTAP00000009631  .........--------e............................................................
ENSBTAP00000006244  .........--------vdec.........................................................
ENSBTAP00000010390  .........--------ss...........................................................
ENSBTAP00000042993  .........--------hd...........................................................
ENSBTAP00000008357  .........--------fgspanrkigvctakdgapcvfgg.....................................
ENSBTAP00000054188  .........V-------deci.........................................................
ENSBTAP00000024122  .........--------d............................................................
ENSBTAP00000029084  .........--------e............................................................
ENSBTAP00000018790  .........--------ertp.........................................................
ENSBTAP00000010400  .........--------psvsc........................................................
ENSBTAP00000016040  .........--------i............................................................
ENSBTAP00000010390  .........--------ss...........................................................
ENSBTAP00000051405  .........--------.............................................................
ENSBTAP00000004588  .........--------ep...........................................................
ENSBTAP00000054781  .........--------rwanavcgtdg..................................................
ENSBTAP00000017746  .........P-------svsc.........................................................
ENSBTAP00000056590  .........--------k............................................................
ENSBTAP00000020360  .........LDQRTGTC.............................................................
ENSBTAP00000018790  .........--------k............................................................
ENSBTAP00000051405  .........--------pggpeegac....................................................
ENSBTAP00000021383  .........EYDEC---.............................................................
ENSBTAP00000055091  .........--------d............................................................
ENSBTAP00000017556  .........--------.............................................................
ENSBTAP00000052487  .........PVDPC---fdnnc........................................................
ENSBTAP00000053786  .........--------.............................................................
ENSBTAP00000002944  .........--------nregyc.......................................................
ENSBTAP00000023842  .........--------lipe.........................................................
ENSBTAP00000010400  .........DVDEC---.............................................................
ENSBTAP00000035484  .........--------.............................................................
ENSBTAP00000046844  .........RPGPC---.............................................................
ENSBTAP00000025815  .........CGS-----g............................................................
ENSBTAP00000027416  .........CG------gg...........................................................
ENSBTAP00000025033  .........--------q............................................................
ENSBTAP00000027132  .........--------e............................................................
ENSBTAP00000053357  ........pC-------apspc........................................................
ENSBTAP00000017556  .........VNSSC---.............................................................
ENSBTAP00000049409  .........--------.............................................................
ENSBTAP00000012158  .........CG------gglt.........................................................
ENSBTAP00000053357  .........VLSPC---.............................................................
ENSBTAP00000026435  .........--------.............................................................
ENSBTAP00000007756  .........--------.............................................................
ENSBTAP00000041372  .........--------lp...........................................................
ENSBTAP00000033786  .........--------e............................................................
ENSBTAP00000053179  .........C-------w............................................................
ENSBTAP00000046844  .........QVNPC---.............................................................
ENSBTAP00000027416  .........--------gstnitqcknrrc................................................
ENSBTAP00000029274  .........--------t............................................................
ENSBTAP00000036514  .........CTEDCASCsevnlc.......................................................
ENSBTAP00000004913  .........--------qm...........................................................
ENSBTAP00000039211  .........LSNIC---l............................................................
ENSBTAP00000021495  .........--------e............................................................
ENSBTAP00000005988  .........--------y............................................................
ENSBTAP00000039366  .........--------pptmactrppsaprnaisnvnetsvflewippadtggrkdvsyyiackkcnshagvcdecg
ENSBTAP00000033786  .........--------.............................................................
ENSBTAP00000020455  .........--------fdppevactsvpsgprnvisivnetsiilewhppretggrddvtyniickkcradrrscsr
ENSBTAP00000001080  .........--------dplslpc......................................................
ENSBTAP00000005817  .........--------erapepptsasilnvavreagldkralrreigelrgrlerleqwagqagawvravlpvppe
ENSBTAP00000037070  .........--------rsapcttppsaprsvvprlngsalrlewsaplesggredltyalrcrecrpggsctpcg..
ENSBTAP00000015261  .........PEGNC---.............................................................
ENSBTAP00000005240  .........--------.............................................................
ENSBTAP00000001511  .........CPYG----sysngsd......................................................
ENSBTAP00000014664  .........C-------.............................................................
ENSBTAP00000008955  .........CS------pnv..........................................................
ENSBTAP00000026780  .........--------gdnvqy.......................................................
ENSBTAP00000037611  .........--------aaldppsaactrppsapvnlissvngtsvtlewappldrggrsditynavcrrcpwalghc
ENSBTAP00000011078  .........--------p............................................................
ENSBTAP00000039368  .........--------psd..........................................................
ENSBTAP00000008354  .........--------gvrfs........................................................
ENSBTAP00000001939  .........--------q............................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000009285  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000011361  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000047769  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000055280  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000028738  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000029257  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000010680  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000029170  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000005002  ..............................................................................
ENSBTAP00000018083  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000025803  ..............................................................................
ENSBTAP00000011877  ..............................................................................
ENSBTAP00000014377  ..............................................................................
ENSBTAP00000054551  ..............................................................................
ENSBTAP00000028615  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007349  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000003826  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000015268  ..............................................................................
ENSBTAP00000016342  qidgapgfssydtvigedlqapdglavdwihsniywtdsilgtvsvadtkgvkrktlfqeegskpraivvdpvhgfmy
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000037826  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000041521  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000018719  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002689  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000042093  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000012977  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000007931  ..............................................................................
ENSBTAP00000043345  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000027836  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000000946  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000013680  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000005529  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000008357  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000029084  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000004588  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000056590  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000052487  ..............................................................................
ENSBTAP00000053786  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000025815  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000027132  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000007756  ..............................................................................
ENSBTAP00000041372  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000004913  ..............................................................................
ENSBTAP00000039211  ..............................................................................
ENSBTAP00000021495  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000039366  g.............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000020455  cddnvefv......................................................................
ENSBTAP00000001080  ..............................................................................
ENSBTAP00000005817  elqpeqvaelwgqgdrieslsdqvllleerlgtcscedns......................................
ENSBTAP00000037070  ..............................................................................
ENSBTAP00000015261  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000001511  ..............................................................................
ENSBTAP00000014664  ..............................................................................
ENSBTAP00000008955  ..............................................................................
ENSBTAP00000026780  ..............................................................................
ENSBTAP00000037611  etcgsgtrfvpqq.................................................................
ENSBTAP00000011078  ..............................................................................
ENSBTAP00000039368  ..............................................................................
ENSBTAP00000008354  ..............................................................................
ENSBTAP00000001939  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000009285  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000011361  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000047769  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000055280  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000028738  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000029257  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000010680  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000029170  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000005002  ..............................................................................
ENSBTAP00000018083  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000025803  ..............................................................................
ENSBTAP00000011877  ..............................................................................
ENSBTAP00000014377  ..............................................................................
ENSBTAP00000054551  ..............................................................................
ENSBTAP00000028615  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007349  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000003826  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000015268  ..............................................................................
ENSBTAP00000016342  wtdwgapaeikkgglngvdvyslvtediqwpngitldlsggrlywvdsklhsissidvnggnrktvledkkklahpfs
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000037826  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000041521  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000018719  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002689  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000042093  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000012977  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000007931  ..............................................................................
ENSBTAP00000043345  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000027836  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000000946  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000013680  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000005529  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000008357  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000029084  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000004588  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000056590  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000052487  ..............................................................................
ENSBTAP00000053786  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000025815  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000027132  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000007756  ..............................................................................
ENSBTAP00000041372  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000004913  ..............................................................................
ENSBTAP00000039211  ..............................................................................
ENSBTAP00000021495  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000039366  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000020455  ..............................................................................
ENSBTAP00000001080  ..............................................................................
ENSBTAP00000005817  ..............................................................................
ENSBTAP00000037070  ..............................................................................
ENSBTAP00000015261  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000001511  ..............................................................................
ENSBTAP00000014664  ..............................................................................
ENSBTAP00000008955  ..............................................................................
ENSBTAP00000026780  ..............................................................................
ENSBTAP00000037611  ..............................................................................
ENSBTAP00000011078  ..............................................................................
ENSBTAP00000039368  ..............................................................................
ENSBTAP00000008354  ..............................................................................
ENSBTAP00000001939  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000009285  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000011361  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000047769  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000055280  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000028738  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000013790  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000029257  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000015445  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000010680  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000010571  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000053681  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000029056  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000029170  ..............................................................................
ENSBTAP00000053668  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000005002  ..............................................................................
ENSBTAP00000018083  ..............................................................................
ENSBTAP00000022815  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000028690  ..............................................................................
ENSBTAP00000011042  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000025803  ..............................................................................
ENSBTAP00000011877  ..............................................................................
ENSBTAP00000014377  ..............................................................................
ENSBTAP00000054551  ..............................................................................
ENSBTAP00000028615  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007349  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000016858  ..............................................................................
ENSBTAP00000003826  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000015268  ..............................................................................
ENSBTAP00000016342  laifedkvfwtdvineaifsanrltgsdislmaenllspedivlfhnltqprgvnwcertalrnggcqylclpapqin
ENSBTAP00000035185  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000037826  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000023206  ..............................................................................
ENSBTAP00000008785  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000032310  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000041521  ..............................................................................
ENSBTAP00000013316  ..............................................................................
ENSBTAP00000027771  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000018719  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000002689  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000029938  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000003973  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000042093  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000012977  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000007931  ..............................................................................
ENSBTAP00000043345  ..............................................................................
ENSBTAP00000004564  ..............................................................................
ENSBTAP00000027836  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000009629  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000008880  ..............................................................................
ENSBTAP00000017563  ..............................................................................
ENSBTAP00000000946  ..............................................................................
ENSBTAP00000053678  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000001939  ..............................................................................
ENSBTAP00000013680  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000034199  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000009531  ..............................................................................
ENSBTAP00000037465  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000007111  ..............................................................................
ENSBTAP00000028604  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000005529  ..............................................................................
ENSBTAP00000009631  ..............................................................................
ENSBTAP00000006244  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000042993  ..............................................................................
ENSBTAP00000008357  ..............................................................................
ENSBTAP00000054188  ..............................................................................
ENSBTAP00000024122  ..............................................................................
ENSBTAP00000029084  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000016040  ..............................................................................
ENSBTAP00000010390  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000004588  ..............................................................................
ENSBTAP00000054781  ..............................................................................
ENSBTAP00000017746  ..............................................................................
ENSBTAP00000056590  ..............................................................................
ENSBTAP00000020360  ..............................................................................
ENSBTAP00000018790  ..............................................................................
ENSBTAP00000051405  ..............................................................................
ENSBTAP00000021383  ..............................................................................
ENSBTAP00000055091  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000052487  ..............................................................................
ENSBTAP00000053786  ..............................................................................
ENSBTAP00000002944  ..............................................................................
ENSBTAP00000023842  ..............................................................................
ENSBTAP00000010400  ..............................................................................
ENSBTAP00000035484  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000025815  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000025033  ..............................................................................
ENSBTAP00000027132  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000017556  ..............................................................................
ENSBTAP00000049409  ..............................................................................
ENSBTAP00000012158  ..............................................................................
ENSBTAP00000053357  ..............................................................................
ENSBTAP00000026435  ..............................................................................
ENSBTAP00000007756  ..............................................................................
ENSBTAP00000041372  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000053179  ..............................................................................
ENSBTAP00000046844  ..............................................................................
ENSBTAP00000027416  ..............................................................................
ENSBTAP00000029274  ..............................................................................
ENSBTAP00000036514  ..............................................................................
ENSBTAP00000004913  ..............................................................................
ENSBTAP00000039211  ..............................................................................
ENSBTAP00000021495  ..............................................................................
ENSBTAP00000005988  ..............................................................................
ENSBTAP00000039366  ..............................................................................
ENSBTAP00000033786  ..............................................................................
ENSBTAP00000020455  ..............................................................................
ENSBTAP00000001080  ..............................................................................
ENSBTAP00000005817  ..............................................................................
ENSBTAP00000037070  ..............................................................................
ENSBTAP00000015261  ..............................................................................
ENSBTAP00000005240  ..............................................................................
ENSBTAP00000001511  ..............................................................................
ENSBTAP00000014664  ..............................................................................
ENSBTAP00000008955  ..............................................................................
ENSBTAP00000026780  ..............................................................................
ENSBTAP00000037611  ..............................................................................
ENSBTAP00000011078  ..............................................................................
ENSBTAP00000039368  ..............................................................................
ENSBTAP00000008354  ..............................................................................
ENSBTAP00000001939  ..............................................................................


                                             
                                             
d2dtge6               .......................
ENSBTAP00000008785  .......................
ENSBTAP00000036514  .......................
ENSBTAP00000053681  .......................
ENSBTAP00000053681  .......................
ENSBTAP00000053681  .......................
ENSBTAP00000036514  .......................
ENSBTAP00000034199  .......................
ENSBTAP00000036514  .......................
ENSBTAP00000015445  .......................
ENSBTAP00000009285  .......................
ENSBTAP00000036514  .......................
ENSBTAP00000036514  .......................
ENSBTAP00000011361  .......................
ENSBTAP00000053668  .......................
ENSBTAP00000047769  .......................
ENSBTAP00000036514  .......................
ENSBTAP00000017556  .......................
ENSBTAP00000029056  .......................
ENSBTAP00000013790  .......................
ENSBTAP00000024122  .......................
ENSBTAP00000055280  .......................
ENSBTAP00000037465  .......................
ENSBTAP00000028738  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000013790  .......................
ENSBTAP00000022815  .......................
ENSBTAP00000002944  .......................
ENSBTAP00000053681  .......................
ENSBTAP00000055091  .......................
ENSBTAP00000029257  .......................
ENSBTAP00000027416  .......................
ENSBTAP00000015445  .......................
ENSBTAP00000005240  .......................
ENSBTAP00000006244  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000006244  .......................
ENSBTAP00000002944  .......................
ENSBTAP00000016040  .......................
ENSBTAP00000055091  .......................
ENSBTAP00000002944  .......................
ENSBTAP00000012158  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000010680  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000010571  .......................
ENSBTAP00000002944  .......................
ENSBTAP00000002944  .......................
ENSBTAP00000036514  .......................
ENSBTAP00000008880  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000053681  .......................
ENSBTAP00000027416  .......................
ENSBTAP00000012158  .......................
ENSBTAP00000029056  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000002944  .......................
ENSBTAP00000023206  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000027771  .......................
ENSBTAP00000029170  .......................
ENSBTAP00000053668  .......................
ENSBTAP00000053678  .......................
ENSBTAP00000054188  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000002944  .......................
ENSBTAP00000002944  .......................
ENSBTAP00000009531  .......................
ENSBTAP00000028604  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000037465  .......................
ENSBTAP00000005002  .......................
ENSBTAP00000018083  .......................
ENSBTAP00000022815  .......................
ENSBTAP00000026435  .......................
ENSBTAP00000028690  .......................
ENSBTAP00000011042  .......................
ENSBTAP00000029274  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000049409  .......................
ENSBTAP00000025803  .......................
ENSBTAP00000011877  .......................
ENSBTAP00000014377  .......................
ENSBTAP00000054551  .......................
ENSBTAP00000028615  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000007349  .......................
ENSBTAP00000001939  .......................
ENSBTAP00000009631  .......................
ENSBTAP00000029274  .......................
ENSBTAP00000016858  .......................
ENSBTAP00000003826  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000015268  .......................
ENSBTAP00000016342  prspkftcacpdgmllakdmrsc
ENSBTAP00000035185  .......................
ENSBTAP00000053357  .......................
ENSBTAP00000009629  .......................
ENSBTAP00000002944  .......................
ENSBTAP00000037826  .......................
ENSBTAP00000017746  .......................
ENSBTAP00000054188  .......................
ENSBTAP00000023206  .......................
ENSBTAP00000008785  .......................
ENSBTAP00000026435  .......................
ENSBTAP00000026435  .......................
ENSBTAP00000055091  .......................
ENSBTAP00000046844  .......................
ENSBTAP00000032310  .......................
ENSBTAP00000005988  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000007111  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000049409  .......................
ENSBTAP00000041521  .......................
ENSBTAP00000013316  .......................
ENSBTAP00000027771  .......................
ENSBTAP00000055091  .......................
ENSBTAP00000010400  .......................
ENSBTAP00000018719  .......................
ENSBTAP00000017556  .......................
ENSBTAP00000053678  .......................
ENSBTAP00000006244  .......................
ENSBTAP00000002689  .......................
ENSBTAP00000017746  .......................
ENSBTAP00000017746  .......................
ENSBTAP00000053357  .......................
ENSBTAP00000053357  .......................
ENSBTAP00000029938  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000003973  .......................
ENSBTAP00000010400  .......................
ENSBTAP00000042093  .......................
ENSBTAP00000017746  .......................
ENSBTAP00000012977  .......................
ENSBTAP00000053357  .......................
ENSBTAP00000007931  .......................
ENSBTAP00000043345  .......................
ENSBTAP00000004564  .......................
ENSBTAP00000027836  .......................
ENSBTAP00000049409  .......................
ENSBTAP00000009629  .......................
ENSBTAP00000010400  .......................
ENSBTAP00000017746  .......................
ENSBTAP00000008880  .......................
ENSBTAP00000008880  .......................
ENSBTAP00000017563  .......................
ENSBTAP00000000946  .......................
ENSBTAP00000053678  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000029274  .......................
ENSBTAP00000010400  .......................
ENSBTAP00000001939  .......................
ENSBTAP00000013680  .......................
ENSBTAP00000005240  .......................
ENSBTAP00000021383  .......................
ENSBTAP00000005240  .......................
ENSBTAP00000034199  .......................
ENSBTAP00000053357  .......................
ENSBTAP00000009531  .......................
ENSBTAP00000037465  .......................
ENSBTAP00000046844  .......................
ENSBTAP00000007111  .......................
ENSBTAP00000028604  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000005529  .......................
ENSBTAP00000009631  .......................
ENSBTAP00000006244  .......................
ENSBTAP00000010390  .......................
ENSBTAP00000042993  .......................
ENSBTAP00000008357  .......................
ENSBTAP00000054188  .......................
ENSBTAP00000024122  .......................
ENSBTAP00000029084  .......................
ENSBTAP00000018790  .......................
ENSBTAP00000010400  .......................
ENSBTAP00000016040  .......................
ENSBTAP00000010390  .......................
ENSBTAP00000051405  .......................
ENSBTAP00000004588  .......................
ENSBTAP00000054781  .......................
ENSBTAP00000017746  .......................
ENSBTAP00000056590  .......................
ENSBTAP00000020360  .......................
ENSBTAP00000018790  .......................
ENSBTAP00000051405  .......................
ENSBTAP00000021383  .......................
ENSBTAP00000055091  .......................
ENSBTAP00000017556  .......................
ENSBTAP00000052487  .......................
ENSBTAP00000053786  .......................
ENSBTAP00000002944  .......................
ENSBTAP00000023842  .......................
ENSBTAP00000010400  .......................
ENSBTAP00000035484  .......................
ENSBTAP00000046844  .......................
ENSBTAP00000025815  .......................
ENSBTAP00000027416  .......................
ENSBTAP00000025033  .......................
ENSBTAP00000027132  .......................
ENSBTAP00000053357  .......................
ENSBTAP00000017556  .......................
ENSBTAP00000049409  .......................
ENSBTAP00000012158  .......................
ENSBTAP00000053357  .......................
ENSBTAP00000026435  .......................
ENSBTAP00000007756  .......................
ENSBTAP00000041372  .......................
ENSBTAP00000033786  .......................
ENSBTAP00000053179  .......................
ENSBTAP00000046844  .......................
ENSBTAP00000027416  .......................
ENSBTAP00000029274  .......................
ENSBTAP00000036514  .......................
ENSBTAP00000004913  .......................
ENSBTAP00000039211  .......................
ENSBTAP00000021495  .......................
ENSBTAP00000005988  .......................
ENSBTAP00000039366  .......................
ENSBTAP00000033786  .......................
ENSBTAP00000020455  .......................
ENSBTAP00000001080  .......................
ENSBTAP00000005817  .......................
ENSBTAP00000037070  .......................
ENSBTAP00000015261  .......................
ENSBTAP00000005240  .......................
ENSBTAP00000001511  .......................
ENSBTAP00000014664  .......................
ENSBTAP00000008955  .......................
ENSBTAP00000026780  .......................
ENSBTAP00000037611  .......................
ENSBTAP00000011078  .......................
ENSBTAP00000039368  .......................
ENSBTAP00000008354  .......................
ENSBTAP00000001939  .......................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053854 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)