SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Growth factor receptor domain alignments in Cavia porcellus 69_3

These alignments are sequences aligned to the 0053854 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d2dtge6               dicpgtakgktncpatvingqf........................................................
ENSCPOP00000005160  gv............................................................................
ENSCPOP00000002433  q.............................................................................
ENSCPOP00000002433  gp............................................................................
ENSCPOP00000011550  r.............................................................................
ENSCPOP00000011550  hg............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  v.............................................................................
ENSCPOP00000009044  lvhcepcdekal..................................................................
ENSCPOP00000012721  dernch........................................................................
ENSCPOP00000019239  vv............................................................................
ENSCPOP00000011550  y.............................................................................
ENSCPOP00000013382  v.............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  fh............................................................................
ENSCPOP00000001198  san...........................................................................
ENSCPOP00000000218  wh............................................................................
ENSCPOP00000013382  n.............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  d.............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  d.............................................................................
ENSCPOP00000003877  q.............................................................................
ENSCPOP00000002772  hm............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  e.............................................................................
ENSCPOP00000008922  s.............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000005471  pt............................................................................
ENSCPOP00000000646  cssg..........................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  d.............................................................................
ENSCPOP00000009997  id............................................................................
ENSCPOP00000014227  lr............................................................................
ENSCPOP00000009997  e.............................................................................
ENSCPOP00000003877  it............................................................................
ENSCPOP00000013776  dv............................................................................
ENSCPOP00000000646  cvv...........................................................................
ENSCPOP00000020809  vdv...........................................................................
ENSCPOP00000010019  n.............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  yivgnkspkecgdlcpgtmeekplcekttinney............................................
ENSCPOP00000007268  rps...........................................................................
ENSCPOP00000000646  dl............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  vd............................................................................
ENSCPOP00000003877  gmtsagt.......................................................................
ENSCPOP00000003877  dl............................................................................
ENSCPOP00000003570  sqa...........................................................................
ENSCPOP00000003877  ffk...........................................................................
ENSCPOP00000013776  kd............................................................................
ENSCPOP00000003877  f.............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  k.............................................................................
ENSCPOP00000002772  n.............................................................................
ENSCPOP00000000646  fy............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005210  s.............................................................................
ENSCPOP00000006323  ecqh..........................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  s.............................................................................
ENSCPOP00000011692  cpstvingqfve..................................................................
ENSCPOP00000008828  g.............................................................................
ENSCPOP00000017054  geacgvyt......................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  dq............................................................................
ENSCPOP00000013204  ttd...........................................................................
ENSCPOP00000014227  de............................................................................
ENSCPOP00000006144  kchtgecitldrvcdgardcrdwsdeplkec...............................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000010019  s.............................................................................
ENSCPOP00000002393  c.............................................................................
ENSCPOP00000017907  acgpckpaacpplppr..............................................................
ENSCPOP00000000646  dr............................................................................
ENSCPOP00000014227  d.............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  rregqqcgvy....................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  clt...........................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000013204  catgl.........................................................................
ENSCPOP00000014227  vd............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ceg...........................................................................
ENSCPOP00000013762  aca...........................................................................
ENSCPOP00000004344  wpcscph.......................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  cte...........................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  tpcacpwppp....................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  p.............................................................................
ENSCPOP00000006876  crqn..........................................................................
ENSCPOP00000001031  d.............................................................................
ENSCPOP00000006612  tkhpdfvtcv....................................................................
ENSCPOP00000000646  cdg...........................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  tachcpleapk...................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  wpcecppspp....................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  si............................................................................
ENSCPOP00000014192  e.............................................................................
ENSCPOP00000010099  fe............................................................................
ENSCPOP00000013776  vcrpgqh.......................................................................
ENSCPOP00000016148  c.............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  tq............................................................................
ENSCPOP00000016303  qctqcasep.....................................................................
ENSCPOP00000010587  fcrpgsvl......................................................................
ENSCPOP00000013620  c.............................................................................
ENSCPOP00000003279  thgpcqnggscirrlavgstl.........................................................
ENSCPOP00000005471  l.............................................................................
ENSCPOP00000007268  pds...........................................................................
ENSCPOP00000014968  decs..........................................................................
ENSCPOP00000000520  e.............................................................................
ENSCPOP00000017876  carttfnghtdy..................................................................
ENSCPOP00000000697  de............................................................................
ENSCPOP00000005525  ckd...........................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ceen..........................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ececpagvcragrwe...............................................................
ENSCPOP00000007253  ya............................................................................
ENSCPOP00000011665  ce............................................................................
ENSCPOP00000000646  pcemcp........................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  sfcaslpprfehr.................................................................
ENSCPOP00000000646  di............................................................................
ENSCPOP00000015957  ms............................................................................
ENSCPOP00000004271  k.............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  cak...........................................................................
ENSCPOP00000019055  qcfrg.........................................................................
ENSCPOP00000005648  s.............................................................................
ENSCPOP00000001400  sv............................................................................
ENSCPOP00000007117  gr............................................................................
ENSCPOP00000016677  vcvn..........................................................................
ENSCPOP00000001031  eecg..........................................................................
ENSCPOP00000014168  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  e.............................................................................
ENSCPOP00000006323  aeec..........................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  k.............................................................................
ENSCPOP00000005446  t.............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  r.............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  secggl........................................................................
ENSCPOP00000012721  te............................................................................
ENSCPOP00000014166  ts............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  c.............................................................................
ENSCPOP00000014227  aqc...........................................................................
ENSCPOP00000010877  algargdrsss...................................................................
ENSCPOP00000008998  aa............................................................................
ENSCPOP00000013252  pvgqcf........................................................................
ENSCPOP00000002774  ig............................................................................
ENSCPOP00000013057  g.............................................................................
ENSCPOP00000001828  r.............................................................................
ENSCPOP00000014166  gvasycr.......................................................................
ENSCPOP00000014227  ln............................................................................
ENSCPOP00000004446  pigk..........................................................................
ENSCPOP00000012415  tfscgsgeylemrnqvcskcaegsyslgsgikfdewdelpagfsnvatfmdtvlgpldsrpdscsnsswtprgnyies
ENSCPOP00000009033  wlvpig........................................................................
ENSCPOP00000019082  ywlnriq.......................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  srd...........................................................................
ENSCPOP00000000875  ck............................................................................
ENSCPOP00000012415  as............................................................................
ENSCPOP00000010587  csy...........................................................................
ENSCPOP00000006471  tcdghracstyrtiyrtayrrgpglgptrpr...............................................
ENSCPOP00000010723  ld............................................................................


                                   10                            20                            30   
                                    |                             |                             |   
d2dtge6               .....----------.......-------.........-....--..........--Ve....RC...W-.TH.SHCQ
ENSCPOP00000005160  .....----------.......-------.........C....HP..........ECGdk...GC...DG.PN.ADQC
ENSCPOP00000002433  .....----------.......---DCQP.........C....HR..........FCA.....TC...VG.AG.ADGC
ENSCPOP00000002433  .....----------.......-------.........C....DP..........ECSev...GC...DG.PG.PDHC
ENSCPOP00000011550  .....----------.......--NSCAA.........C....HV..........SCA.....GC...SG.PT.EKHC
ENSCPOP00000011550  .....----------.......---VCTA.........C....HA..........TCQ.....AC...VG.PE.PSHC
ENSCPOP00000011550  .....----------.......----CRE.........C....DW..........SCS.....EC...SG.PL.RTDC
ENSCPOP00000000034  .....----------.......-------.........C....HP..........LCSse...GC...WG.PE.AQDC
ENSCPOP00000009044  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000012721  .....----------.......-INECLS.........Kk...TS..........GCSq....DC...QD.LP.VSYK
ENSCPOP00000019239  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000011550  .....----------.......----CID.........C....HP..........LCQ.....HCtanLQ.DT.GSIC
ENSCPOP00000013382  .....----------.......-------.........C....DP..........LCSsg...GC...WG.QG.PGQC
ENSCPOP00000005210  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000007246  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000001198  .....----------.......-KETCEH.........H....HG..........QCSqha..FC...TD.YA.TGFC
ENSCPOP00000000218  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000013382  .....----------.......-GRSCPP.........C....HE..........ACKg....RC...WG.PG.PEDC
ENSCPOP00000014227  .....-CPFGYGVVPgpgdareDVDECAE.........N....PG..........VCGhg...LC...VN.TD.GSFR
ENSCPOP00000020809  .....----------.......-INECQV.........N....TG..........GCDh....FC...RN.TV.GSFE
ENSCPOP00000000034  .....----------.......----CQK.........C....DP..........SCPng...SC...WG.PG.AENC
ENSCPOP00000000646  .....----------.......-VNECLE.........S....PG..........ICSng...QC...IN.TD.GSFR
ENSCPOP00000003877  .....--------CN.......DRNECQE.........I....PN..........ICShg...QC...ID.TV.GSFY
ENSCPOP00000002772  .....----------.......----CSI.........L....EH..........NCAh....FC...IN.TP.GSYE
ENSCPOP00000011550  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000000646  .....----------.......----CIQ.........N....GV..........LCKng...RC...VN.TD.GSFQ
ENSCPOP00000008922  .....----------.......-------.........-....--..........-CEg....RC...MN.TE.GGFV
ENSCPOP00000005525  .....-CRHGYHANE.......DGTQCVDvne......C....ATgvh.......RCGsgq..VC...HN.LP.GSYR
ENSCPOP00000012721  .....-CPDGSDEGD.......LCDECSL.........N....NG..........GCSn....QCs..VV.PG.RGIV
ENSCPOP00000005471  .....----------.......-------.........-....--..........--Q.....IC...IN.TE.GGYT
ENSCPOP00000000646  .....-----VGITVdgr....DINECAL.........D....PD..........ICAng...IC...EN.LR.GSYR
ENSCPOP00000002433  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000014227  .....---------P.......DVDECAR.........D....PL..........LCRgg...TC...TN.TD.GSYE
ENSCPOP00000009997  .....----------.......---ECQT.........R....NG..........GCDh....FC...KN.TV.GSFD
ENSCPOP00000014227  .....----------.......-QNECQE.........I....PH..........VCIhg...DC...VD.TE.GSYI
ENSCPOP00000009997  .....----------.......----CAQ.........G....LD..........DCHada..LC...QN.TP.TSYK
ENSCPOP00000003877  .....----------.......-TDYCQL.........V....RY..........LCQng...RC...IP.TP.GSYR
ENSCPOP00000013776  .....----------.......--DECVE.........G....TD..........NCHida..IC...QN.TP.RSYK
ENSCPOP00000000646  .....----------.......DRNECLE.........I....PN..........VCShg...LC...VD.LQ.GSYQ
ENSCPOP00000020809  .....----------.......--DECSE.........G....TD..........DCHida..IC...QN.TP.KSYK
ENSCPOP00000010019  .....----------.......---SCEV.........G....NG..........GCSh....GC...RH.SS.GGPL
ENSCPOP00000003877  .....----GKTGCT.......DINECEI.........G....AH..........NCGrha..VC...TN.TA.GSFR
ENSCPOP00000004859  .....----------.......-------.........-....--..........-NY.....RC...W-.TT.NRCQ
ENSCPOP00000007268  .....----------.......-------.........-....--..........--Q.....DC...HN.LP.GSYQ
ENSCPOP00000000646  .....----------.......--DECSQ.........S....PK..........PCNf....IC...KN.TE.GSYQ
ENSCPOP00000000264  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000001031  .....----------.......---ECED.........P....HS..........SCLgg...EC...KN.TA.GSYQ
ENSCPOP00000003877  .....----------.......DINECAL.........D....PD..........ICPng...IC...EN.LR.GSYK
ENSCPOP00000003877  .....----------.......--NECDQ.........A....PK..........PCNf....IC...KN.TE.GSYQ
ENSCPOP00000003570  .....-CAKGCELCS.......EVNGCLK.........C....SP..........KLFillerND...IR.QV.GVCL
ENSCPOP00000003877  .....----------.......DINECKM.........I....PS..........LCThg...KC...RN.TI.GSFK
ENSCPOP00000013776  .....----------.......-IDECRL.........N....NG..........GCDh....IC...RN.TV.GSFE
ENSCPOP00000003877  .....--------CV.......DIDECSI.........M....NG..........GCEt....FC...TN.SE.GSYE
ENSCPOP00000006876  .....QCPSGFTLDS.......VGPFCADede......Caa..GN..........PCSh....TC...HN.AM.GAYY
ENSCPOP00000007897  .....----------.......-------.........-....--..........---.....RC...LN.TP.GSFR
ENSCPOP00000000646  .....----GTTGCT.......DVDECEI.........G....AH..........NCDmha..SC...LN.VP.GSFK
ENSCPOP00000002772  .....----------.......---YCAL.........N....KP..........GCEh....EC...VN.TE.ESYY
ENSCPOP00000000646  .....---------K.......DINECKA.........F....PG..........MCTyg...KC...RN.TI.GSFK
ENSCPOP00000000697  .....-CPSGAS---.......-------.........-....--..........GCSh....GC...VL.TS.DGPL
ENSCPOP00000005210  .....----------.......--RTCLP.........C....SP..........ACRap...YC...WG.GS.PQDC
ENSCPOP00000006323  .....----------.......-------.........-....HH..........LCThg...QC...RN.TE.GSFQ
ENSCPOP00000006040  .....QCGLGYFEAErns....SHLVCLA.........C....FG..........PCA.....RC...SG.PE.ESHC
ENSCPOP00000007782  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000011692  .....----------.......-------.........-....--..........---.....RC...W-.TH.THCQ
ENSCPOP00000008828  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000017054  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000010587  .....-CPPGYTGLK.......CETDIDE.........C....SSl.........PCLnng..IC...KD.QV.GGFI
ENSCPOP00000000645  .....----------.......----CDPlp.......C....NK..........DGYm....SC...VD.GQ.ATFT
ENSCPOP00000013204  .....----------.......SQQTCAS.........N....RH..........QCSvha..EC...RD.YR.TGFC
ENSCPOP00000014227  .....----------.......----CAE.........D....MD..........LCEng...QC...LN.VP.GGYR
ENSCPOP00000006144  .....----------.......GTNECLD.........N....NG..........GCSh....VC...ND.LK.IGYQ
ENSCPOP00000001400  .....-CPRGADENS.......TSNESHCgtsl.....Cs...VL..........NCEf....QC...HK.TP.YGGS
ENSCPOP00000010019  .....----------.......----CAL.........G....NG..........GCQh....QC...LQlTT.TRHR
ENSCPOP00000002393  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000017907  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000000646  .....------QGCT.......DIDECMI.........M....NG..........GCDt....QC...TN.AE.GSYE
ENSCPOP00000014227  .....----------.......---ECST.........R....QH..........NCQf....LC...VN.TV.GAFT
ENSCPOP00000016431  .....-CMDGYFQSLkte....THSSCTA.........C....DE..........ACR.....TC...SG.PT.NRDC
ENSCPOP00000005160  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000005059  .....----------.......-------.........-....--..........---.....--...--.--.---T
ENSCPOP00000014573  .....-CLPGWMGQN.......CDININD.........C....LG..........QCQnda..SC...QD.LV.NGYR
ENSCPOP00000001031  .....----------.......-------.........-....PG..........VCAhg...RC...IN.LE.GSFR
ENSCPOP00000001400  .....-CPNGTDESPlc.....NEDSCSH.........F....NG..........GCTh....QC...IQ.GP.FGVT
ENSCPOP00000013204  .....----------.......-----HD.........C....DI..........PQRa....TC...IY.TGgSSYT
ENSCPOP00000014227  .....----------.......---ECKE.........N....PD..........ICGqg...QC...AN.VP.GAHR
ENSCPOP00000016148  .....-CPLGWQGPR.......CQQDVDE.........Cad..PA..........ACGphg..TC...TN.LA.GSFS
ENSCPOP00000016148  .....ECPAGYSGDN.......CEDDVDE.........Ca...SQ..........PCQhgg..SC...ID.LV.ARYL
ENSCPOP00000003877  .....----------.......-------.........-....NH..........RCQh....GC...QN.II.GGYR
ENSCPOP00000013762  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000004344  .....----------.......-------.........-....--..........---.....--...--.--.--QK
ENSCPOP00000014192  .....ICNPGYMGAI.......CSDQIDE.........Cy...SS..........PCLneg..RC...ID.LV.NGYQ
ENSCPOP00000009997  .....ECRPGFELAK.......NQRDCILt........C....NHgng.......GCQh....SC...ED.TA.EGPE
ENSCPOP00000014192  .....----------.......DVDECAM.........Tn...SN..........PCEhag..KC...VN.TD.GAFH
ENSCPOP00000014227  .....----------.......-------.........-....--..........-CAf....RC...RN.TE.GSYL
ENSCPOP00000018258  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000016148  .....-CAPGYTGTR.......CESQVDE.........Cr...SQ..........PCRhgg..KC...LD.LV.DKYL
ENSCPOP00000011900  .....----------.......----CLE.........Q....RD..........QCLynq..LC...EN.TA.GGHH
ENSCPOP00000006323  .....----------.......-------.........-....-S..........TCPde...QC...VN.SP.GSYQ
ENSCPOP00000006876  .....----------.......-------.........-....--..........VCRpdq..HC...KN.TR.GGYK
ENSCPOP00000001031  .....----------.......-------.........-....--..........PCLgg...HC...VN.TE.GSFN
ENSCPOP00000006612  .....----------.......------Qnlpdq....Ct...PN..........PCDkqgtqVC...QD.LM.GNFF
ENSCPOP00000000646  .....----------.......-------.........-....NH..........RCQh....GC...QN.IL.GGYR
ENSCPOP00000011665  .....KCVAGYHGTN.......CSEETNE.........Cl...SQ..........PCQngg..TC...ID.LT.NTYK
ENSCPOP00000009088  .....-CAPGVGLVR.......DGCGCCKv........CakqlNE..........DCS.....KT...QP.CD.HTKG
ENSCPOP00000010393  .....-CLPGYTGDL.......CQSKIDY.........Cv...LD..........PCRnga..TC...IS.SL.SGFT
ENSCPOP00000007568  .....-CLPGWKGAN.......CHINVND.........C....RG..........QCQhgg..TC...KD.LV.NGYQ
ENSCPOP00000014192  .....TCKKGFKGYN.......CQVNIDE.........Ca...SN..........PCLnqg..TC...FD.DV.SGYT
ENSCPOP00000011665  .....ICPSGWQGQT.......CEVDINE.........Cv...KS..........PCRhga..SC...QN.TN.GDYR
ENSCPOP00000019462  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000017174  .....RCPVGYSGFN.......CEKKMDH.........Cs...SA..........PCSsga..RC...VD.LG.DAYL
ENSCPOP00000005525  .....----------.......-------.........-....--..........---.....-C...VN.TL.GSFR
ENSCPOP00000011665  .....-CLKGTTGPN.......CEINLDD.........Ca...SS..........PCDag...TC...LD.KI.DGYE
ENSCPOP00000002335  .....----------.......-------.........-....--..........---.....--...--.--.PSHR
ENSCPOP00000014192  .....----------.......-------.........Ca...SN..........PCKhga..TC...TD.FI.GGYR
ENSCPOP00000010099  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000013776  .....----------.......-------.........-....--..........---.....--...--.RA.GAKC
ENSCPOP00000016148  .....--------DQ.......DVDECSI.........G....AN..........PCEhlg..RC...VN.TQ.GSFL
ENSCPOP00000007568  .....-CLPGWKGST.......CTIAENSs........Cl...PN..........PCMngg..TC...VG.SG.DSFS
ENSCPOP00000006323  .....----------.......----CTQ.........A....QH..........LCSqg...RC...EN.TE.GSFL
ENSCPOP00000005525  .....----------.......-------.........-....--..........RCSq....EC...AN.IY.GSYQ
ENSCPOP00000016303  .....----------.......-------.........-....--..........---.....--...--.--.---A
ENSCPOP00000010587  .....----------.......-------.........-....--..........---.....--...--.-R.GRMC
ENSCPOP00000013620  .....----------.......-----SD.........C....HS..........NA-.....TC...LE.DG.VITT
ENSCPOP00000003279  .....----------.......-------.........-....--..........---.....--...--.--.---K
ENSCPOP00000005471  .....----------.......-------.........-....--..........---.....-C...LP.SP.GNAQ
ENSCPOP00000007268  .....----------.......-------.........-....--..........---.....--...--.--.---Y
ENSCPOP00000014968  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000000520  .....----------.......-------.........Cl...SQ..........PCHpgs..TC...LD.LL.ATFH
ENSCPOP00000017876  .....----------.......-------.........-....--..........---.....RC...W-.-T.SSHC
ENSCPOP00000000697  .....----------.......-------.........Ct...PA..........ACGeha..QC...VS.EG.DRAM
ENSCPOP00000005525  .....----------.......-------.........-....NE..........PCRq....VC...SV.IR.GSAV
ENSCPOP00000000875  .....-CPESHQITL.......SHSCCKV.........C....KGydfcserh..NCMens..VC...RN.LN.DRAV
ENSCPOP00000000520  .....----------.......----LDD.........Ci...DA..........TCApgs..TC...ID.RV.GSFA
ENSCPOP00000010233  .....ECPPNFTGSN.......CEKKVDR.........Ct...NN..........PCAngg..QC...LN.RG.PSRT
ENSCPOP00000001031  .....----------.......-------.........-....--..........---.....AV...HP.TK.GAYH
ENSCPOP00000007253  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000011665  .....----------.......--NNTPD.........Ct...ES..........SCFngg..TC...VD.GI.NSFT
ENSCPOP00000000646  .....----------.......-------.........-....--..........---.....--...--.--.-AQP
ENSCPOP00000005648  .....-CLAGFTGRR.......CQLDVNE.........Ca...SH..........PCQngg..TC...TH.SV.NSFS
ENSCPOP00000014192  .....-CPVGFTGPF.......CLHEINE.........Cs...SH..........PCLneg..TC...VD.GL.GTYR
ENSCPOP00000009046  .....RCPLGYAGVT.......CEAEVDE.........Ca...SA..........PCLhgg..SC...LD.GV.GSYL
ENSCPOP00000007268  .....----------.......-------.........-....--..........PCEq....RC...FN.SY.GTFL
ENSCPOP00000006033  .....-CCWGWARRS.......WG-QCQPv........C....HP..........QCKhg...EC...VG.PN.---K
ENSCPOP00000002433  .....----------.......-------.........-....--..........---.....--...--.--.--CY
ENSCPOP00000000646  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000015957  .....----------.......----CGP.........D....NG..........GCEh....ECm..ED.MN.GQVS
ENSCPOP00000004271  .....----------.......----CAL.........N....TH..........GCEh....LC...VDeGT.GSYH
ENSCPOP00000016148  .....-CPGGFAGPL.......CESPAVP.........Ca...PS..........PCRngg..TC...RQ.SG.ELTY
ENSCPOP00000012510  .....----------.......-------.........-....-T..........NCQy....GC...ED.TE.EGPR
ENSCPOP00000019055  .....----------.......---RCHP.........V....DG..........TCA.....CE...PG.YR.GKYC
ENSCPOP00000005648  .....----------.......------P.........Cd...SD..........PCFngg..SC...DA.HD.DSYT
ENSCPOP00000001400  .....----------.......------P.........C....SH..........LCL.....LS...SQ.GP.RFYS
ENSCPOP00000007117  .....------FACT.......DTDECLAgg.......A....--..........-CPeha..DC...TN.FP.GGFN
ENSCPOP00000016677  .....----------.......PELGCSF.........N....NG..........GCEq....DCf..EG.GA.GSFR
ENSCPOP00000001031  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000014168  .....RCPPGFTGDY.......CETEVDL.........Cy...SR..........PCGphg..RC...RS.RE.GGYT
ENSCPOP00000012510  .....-CCYGWRRNN.......KGVCEAT.........C....EL..........GCKfg...EC...VG.PN.---K
ENSCPOP00000006033  .....----------.......-------.........-....--..........NCQy....GC...DV.IK.GQVR
ENSCPOP00000007039  .....TCSHNQYFDI.......SALSCVS.........C....GA..........NQKh....D-...--.-A.RGTS
ENSCPOP00000006323  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000014192  .....-CPPQWTGQFcte....DVDECLL.........Q....PN..........ACQngg..TC...TN.RN.GGYG
ENSCPOP00000006380  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000005446  .....----------.......-------.........-....--..........-CHeha..TC...QQ.RD.GRKI
ENSCPOP00000017174  .....-CRVGWQGRY.......CD-ECIR.........-....YP..........GCLhg...TC...QQ.P-.--WQ
ENSCPOP00000009739  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000014075  .....-CPGGYYVYRlskpsvcF-----HvycghfydiC....DE..........DCHg....SC...--.-L.GTSQ
ENSCPOP00000009997  .....-CQPGEYSVD.......GFAPCQL.........C....ALgtfqpeagrtSCF.....SC...GG.GL.PTKH
ENSCPOP00000012721  .....----------.......--YTCED.........N....VN..........PCGdda..YC...NQ.IK.TSVF
ENSCPOP00000014166  .....----------.......---ECFP.........C....KP..........GTYa....AK...--.QG.STFC
ENSCPOP00000000520  .....VCDVGWTGPE.......CEAELGG.........Cv...SA..........PCAhgg..TC...HP.QP.SGYN
ENSCPOP00000000520  .....----------.......-------.........Ca...DS..........PCRnra..TC...QD.NP.QGPR
ENSCPOP00000020809  .....----------.......-------.........-....--..........--G.....TG...QV.LQ.DGKC
ENSCPOP00000014227  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000010877  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000008998  .....----------.......-------.........-....--..........---.....--...--.--.-GYV
ENSCPOP00000013252  .....-CEPGYEEGS.......GGVGCTA.........C....PRgsyrtdlstsRCL.....KC...--.PH.HS-S
ENSCPOP00000002774  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000013057  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000001828  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000014166  .....----------.......-------.........-....--..........PCA.....ME...AS.DV.GSSC
ENSCPOP00000014227  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000004446  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000012415  nrddc----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000009033  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000019082  .....----------.......---SFLY.........C....NE..........NGL.....LG...SF.SE.ETHS
ENSCPOP00000008922  .....-CCPGWAPSM.......GSGHCTLpl.......C....SF..........GCGsg...VC...IA.PN.---V
ENSCPOP00000008698  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000000875  .....----------.......-------.........-....-D..........G--.....-C...--.RN.GGAC
ENSCPOP00000012415  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000010587  .....-------LCE.......AGKDCCD.........R....MA..........SCK.....-C...GT.HT.GQFE
ENSCPOP00000006471  .....----------.......-------.........-....--..........---.....--...--.--.----
ENSCPOP00000010723  .....----------.......-------.........-....--..........PCEh....QC...DP.ET.GRQE


                                                       40                              50           
                                                        |                               |           
d2dtge6               .........................KV..CPT.ICKSH..GC................T....AEGL...........
ENSCPOP00000005160  .......lncvhfslgssktgrkcvSE..CPL.GYFRD..KA................A....RRCR...........
ENSCPOP00000002433  .........................IN..CTE.GYFME..--................E....GRCVqscgisyyldq
ENSCPOP00000002433  .......sdclhyyyklknntricvSS..CPP.GHYHA..-D................K....KRCR...........
ENSCPOP00000011550  .........racrdplkvlrhgsceNS..CGD.GFYDK..--................Q....GTCM...........
ENSCPOP00000011550  tecknpeaglqvgqllatvpsgeclPR..CRA.QFYLE..-S................T....GLCE...........
ENSCPOP00000011550  .........................LQ..CMD.GYVLQ..--................D....GACQ...........
ENSCPOP00000000034  .........................VS..CQN.VSRGR..ECvarcnifegeprefveN....SECI...........
ENSCPOP00000009044  .........................--..---.-----..--................-....----...........
ENSCPOP00000012721  .........................CK..CWP.GFQMK..DD................G....KTCV...........
ENSCPOP00000019239  .........................--..---.-----..--................-....-RCE...........
ENSCPOP00000011550  .........lrcqnahhlllgdhcvPH..CPS.GYYTE..--................R....STCK...........
ENSCPOP00000013382  .........................LS..CRN.YSRGG..VCvthcnflngeprefayE....AECF...........
ENSCPOP00000005210  .........................--..---.-----..--................-....----...........
ENSCPOP00000007246  .........................--..---.-----..--................-....--CT...........
ENSCPOP00000001198  .........................CH..CQS.RFNGN..--................G....KHCLpegaphrvngk
ENSCPOP00000000218  .........................--..---.-----..--................-....--CA...........
ENSCPOP00000013382  ....................qtltkTI..CAP.QCNGH..CF................G....PDPN...........
ENSCPOP00000014227  .........................CQ..CPS.GYSLD..PA................G....LGCV...........
ENSCPOP00000020809  .........................CS..CRK.GYKLL..TD................E....RTCQ...........
ENSCPOP00000000034  ....................qkltkII..CAQ.QCSGR..CR................G....KSPS...........
ENSCPOP00000000646  .........................CE..CPM.GYNLD..YT................G....VRCV...........
ENSCPOP00000003877  .........................CL..CHT.GFKTN..PD................Q....TMCL...........
ENSCPOP00000002772  .........................CR..CKQ.GYILH..AD................Q....KTCR...........
ENSCPOP00000011550  .........................--..---.-----..--................-....----...........
ENSCPOP00000000646  .........................CI..CNA.GFELT..TD................G....KNCV...........
ENSCPOP00000008922  .........................CE..CGP.GMQLA..AD................R....HSCQ...........
ENSCPOP00000005525  .........................CD..CKA.GFQRD..AF................G....RSCI...........
ENSCPOP00000012721  .........................CS..CPK.GLQLN..KD................N....KTCE...........
ENSCPOP00000005471  .........................CS..CTD.GYWLL..--................E....GQCL...........
ENSCPOP00000000646  .........................CN..CNS.GYEPD..AS................G....RNCI...........
ENSCPOP00000002433  .........................--..---.-----..--................-....--CH...........
ENSCPOP00000014227  .........................CQ..CPP.GHTLT..AE................G....TACE...........
ENSCPOP00000009997  .........................CS..CKK.GFKLL..TD................E....KSCQ...........
ENSCPOP00000014227  .........................CL..CHR.GFRAS..TD................G....TLCV...........
ENSCPOP00000009997  .........................CS..CKP.GYQGE..--................G....RQCQ...........
ENSCPOP00000003877  .........................CE..CNK.GFQLD..-L................R....GECI...........
ENSCPOP00000013776  .........................CI..CKS.GYTGD..--................G....KHCK...........
ENSCPOP00000000646  .........................CI..CHN.GFKAS..QD................Q....TMCM...........
ENSCPOP00000020809  .........................CL..CKP.GYKGE..--................G....RQCE...........
ENSCPOP00000010019  .........................CT..CPR.GYELD..QD................Q....RTCV...........
ENSCPOP00000003877  .........................CS..CSP.GWIGD..--................G....IKCT...........
ENSCPOP00000004859  .........................KM..CPS.ACGKR..AC................T....EYQE...........
ENSCPOP00000007268  .........................CT..CPD.GYRKI..--................G....PECV...........
ENSCPOP00000000646  .........................CS..CPR.GYVLQ..ED................G....KTCK...........
ENSCPOP00000000264  .........................--..---.-----..--................-....----...........
ENSCPOP00000001031  .........................CL..CPP.GFQLA..-N................G....TVCE...........
ENSCPOP00000003877  .........................CI..CNS.GYEVD..IT................G....KNCV...........
ENSCPOP00000003877  .........................CS..CPK.GYILQ..ED................G....RSCK...........
ENSCPOP00000003570  .........................PS..CPP.GYFDArnPD................M....NKCI...........
ENSCPOP00000003877  .........................CR..CDS.GFALD..SE................E....RNCT...........
ENSCPOP00000013776  .........................CS..CKK.GYKLL..IN................E....RNCQ...........
ENSCPOP00000003877  .........................CS..CQP.GFALM..PD................Q....RSCT...........
ENSCPOP00000006876  .........................CS..CPT.GLTIA..AD................G....RTCQ...........
ENSCPOP00000007897  .........................CD..CKA.GYYFD..SI................S....RTCV...........
ENSCPOP00000000646  .........................CS..CRE.GWVGN..--................G....IKCI...........
ENSCPOP00000002772  .........................CR..CRR.GYTLD..PN................G....RTCS...........
ENSCPOP00000000646  .........................CR..CNS.GFALD..ME................E....RNCT...........
ENSCPOP00000000697  .........................CF..CPK.GSVLQ..AD................G....KTCS...........
ENSCPOP00000005210  ....................qnltrTV..CAG.GCARC..KG................P....LPTD...........
ENSCPOP00000006323  .........................CV..CDH.GYRAS..AL................G....DHCE...........
ENSCPOP00000006040  .........................LQ..CKK.GWALH..--................H....LKCV...........
ENSCPOP00000007782  .........................--..---.-----..--................-....----...........
ENSCPOP00000011692  .........................KV..CPT.ACKSH..GC................T....AEGL...........
ENSCPOP00000008828  .........................--..---.-----..--................-....----...........
ENSCPOP00000017054  .........................PR..---.-----..--................-....----...........
ENSCPOP00000010587  .........................CE..CVL.GYTGQ..LC................E....KNTD...........
ENSCPOP00000000645  .........................CN..CKP.GWQGN..MC................E....FECK...........
ENSCPOP00000013204  .........................CS..CVA.GYTGN..--................G....RQCVaegspqrvngk
ENSCPOP00000014227  .........................CE..CEM.GFGPT..ED................H....GGCQ...........
ENSCPOP00000006144  .........................CL..CPS.GFHLV..-G................Q....WQCE...........
ENSCPOP00000001400  .........................CF..CPP.GYVINq.ND................S....RTCV...........
ENSCPOP00000010019  .........................CQ..CHP.GFQLQ..ED................G....RRCV...........
ENSCPOP00000002393  .........................--..---.-----..--................-....----...........
ENSCPOP00000017907  .........................--..---.-----..--................-....----...........
ENSCPOP00000000646  .........................CS..CSE.GYALL..PD................G....RSCA...........
ENSCPOP00000014227  .........................CR..CPP.GFTQR..--................Q....QACF...........
ENSCPOP00000016431  .........................VE..CEA.GWTRV..--................E....DACV...........
ENSCPOP00000005160  .........................--..CEP.GTYFD..SE................L....IQCM...........
ENSCPOP00000005059  .........................PF..CAP.GLQC-..--................-....----...........
ENSCPOP00000014573  .........................CI..CPP.GYAGD..HC................E....RDID...........
ENSCPOP00000001031  .........................CS..CEQ.GYEVT..SD................K....KGCQ...........
ENSCPOP00000001400  .........................CL..CPS.GYQLA..ND................T....KTCE...........
ENSCPOP00000013204  .........................CS..CLP.GFSGD..--................G....RACQ...........
ENSCPOP00000014227  .........................CL..CND.GFTAT..PD................M....KTCV...........
ENSCPOP00000016148  .........................CT..CHG.GYTGP..SC................D....KDID...........
ENSCPOP00000016148  .........................CS..CPP.GTLGS..HC................E....VNED...........
ENSCPOP00000003877  .........................CS..CPQ.GYLQH..YQ................W....NQCV...........
ENSCPOP00000013762  .........................--..---.-----..--................-....----...........
ENSCPOP00000004344  .........................P-..---.-----..--................-....----...........
ENSCPOP00000014192  .........................CN..CQP.GTSGV..NC................E....INFD...........
ENSCPOP00000009997  .........................CS..CHP.QYKLH..TD................G....RSCF...........
ENSCPOP00000014192  .........................CE..CLK.GYAGP..RC................E....MDIN...........
ENSCPOP00000014227  .........................CT..CPA.GYALR..ED................G....ATCR...........
ENSCPOP00000018258  .........................-R..CPP.GVPLV..LD................G....CGCC...........
ENSCPOP00000016148  .........................CR..CPP.GTTGV..NC................E....VNID...........
ENSCPOP00000011900  .........................CS..CPR.GYRTQ..GP................G....LPCL...........
ENSCPOP00000006323  .........................CVp.CTE.GFRGW..--................N....GQCL...........
ENSCPOP00000006876  .........................CIdlCPN.GMTKA..-E................N....GTCI...........
ENSCPOP00000001031  .........................CL..CEA.GFRPS..PE................S....GQCV...........
ENSCPOP00000006612  .........................CM..CRA.GWGGR..RC................D....RDVD...........
ENSCPOP00000000646  .........................CG..CPQ.GYIQH..YQ................W....NQCV...........
ENSCPOP00000011665  .........................CS..CPR.GTQGV..HC................E....INVD...........
ENSCPOP00000009088  .........................LE..CNF.GASST..AL................K....GICR...........
ENSCPOP00000010393  .........................CQ..CPE.GYFGS..AC................E....EKVD...........
ENSCPOP00000007568  .........................CV..CPR.GFGGR..HC................E....LVRG...........
ENSCPOP00000014192  .........................CQ..CAL.PYTGK..NC................Q....TVLA...........
ENSCPOP00000011665  .........................CH..CQA.GYTGR..DC................E....TDVD...........
ENSCPOP00000019462  .........................-R..CPL.GVSLI..TD................G....CECC...........
ENSCPOP00000017174  .........................CR..CQA.GFSGR..HC................E....DNVD...........
ENSCPOP00000005525  .....................cykaLT..CDP.GYVLK..--................D....GECV...........
ENSCPOP00000011665  .........................CA..CEP.GYTGS..MC................N....INID...........
ENSCPOP00000002335  .........................IQ..CPA.GYEQS..-E................H....NLCQ...........
ENSCPOP00000014192  .........................CE..CVP.GYQGV..NC................E....YEVD...........
ENSCPOP00000010099  .........................--..---.-----..-N................G....SVCV...........
ENSCPOP00000013776  .........................VS..CPQ.GTYYH..GQ................T....EQCV...........
ENSCPOP00000016148  .........................CQ..CGR.GYTGP..RC................E....TDVN...........
ENSCPOP00000007568  .........................CI..CRD.GWEGR..TC................T....HNTN...........
ENSCPOP00000006323  .........................CI..CPA.GFMAS..EE................G....TNCI...........
ENSCPOP00000005525  .........................CY..CRQ.GYQLA..ED................G....HTCT...........
ENSCPOP00000016303  .........................P-..---.-----..--................-....----...........
ENSCPOP00000010587  .........................VN..CPL.GTYYS..LE................H....SACE...........
ENSCPOP00000013620  .........................CT..CQD.GFSGD..--................G....ILCT...........
ENSCPOP00000003279  ......sheslpviimgneplqpflCK..CLP.GYAGS..WC................E....IDID...........
ENSCPOP00000005471  .........................QQ..CTN.GFDLD..RQ................T....GQCL...........
ENSCPOP00000007268  .........................TE..CTD.GYEWD..PE................S....QHCR...........
ENSCPOP00000014968  .........................--..---.-----..--................-....----...........
ENSCPOP00000000520  .........................CL..CPP.GLEGQ..LC................E....VETN...........
ENSCPOP00000017876  ......................qrvCP..CPQ.GLACT..--................-....ISGE...........
ENSCPOP00000000697  .........................CQ..CAE.GFAGD..--................G....KQCT...........
ENSCPOP00000005525  .........................CS..CFP.GYAIM..AD................G....VSCE...........
ENSCPOP00000000875  .........................CS..CRD.GFRALr.ED................N....AYCE...........
ENSCPOP00000000520  .........................CL..CPP.GRTGL..LC................H....LEDM...........
ENSCPOP00000010233  .........................CR..CRP.GFTGT..LC................E....LHIS...........
ENSCPOP00000001031  .........................RE..CDP.GYTLV..-R................K....GGCQ...........
ENSCPOP00000007253  .........................--..---.-----..--................-....---V...........
ENSCPOP00000011665  .........................CL..CPP.GFTGS..YC................Q....HDIN...........
ENSCPOP00000000646  .........................QP..CRR.GFIPN..IR................T....GACQ...........
ENSCPOP00000005648  .........................CQ..CPA.GFRGP..TC................E....SAQS...........
ENSCPOP00000014192  .........................CT..CPL.GYTGK..NC................Q....TLVN...........
ENSCPOP00000009046  .........................CM..CAP.GYGGA..SC................Q....LDLD...........
ENSCPOP00000007268  .........................CR..CNQ.GYELH..RD................G....FSCS...........
ENSCPOP00000006033  .........................CK..CHP.GYAGK..TC................N....QDLN...........
ENSCPOP00000002433  .........................RA..CPE.KTFAE..--................E....RECR...........
ENSCPOP00000000646  .........................--..---.-----..--................-....--CK...........
ENSCPOP00000015957  .........................CH..CTE.GFRLA..AD................G....HSCE...........
ENSCPOP00000004271  .........................CE..CYE.GHTLN..ED................K....KSCS...........
ENSCPOP00000016148  ........................dCA..CLP.GFEGQ..HC................E....VNVD...........
ENSCPOP00000012510  .........................CL..CPSsGLRLA..SN................G....RVCL...........
ENSCPOP00000019055  ........................rEP..CPA.GFYGL..GC................R....RRCG...........
ENSCPOP00000005648  .........................CE..CPR.GFHGR..HC................E....KARP...........
ENSCPOP00000001400  .........................CA..CPS.GWNLS..HD................S....MSCVrgdqpflmtvr
ENSCPOP00000007117  .........................CS..CRA.GFEAR..--................G....AVCA...........
ENSCPOP00000016677  .........................CG..CRP.GFRLR..DD................L....VSCA...........
ENSCPOP00000001031  .........................--..---.-----..--................-....----...........
ENSCPOP00000014168  .........................CL..CRD.GYTGE..HC................E....VSAR...........
ENSCPOP00000012510  .........................CR..CFP.GYTGK..SC................S....QDVN...........
ENSCPOP00000006033  .........................CQ..CPSpGLRLA..PD................G....RTCV...........
ENSCPOP00000007039  .........................CV..CLP.GFQMI..SN................NggpaIICK...........
ENSCPOP00000006323  .........................--..---.-----..--................-....----...........
ENSCPOP00000014192  .........................CV..CVN.GWSGD..DC................S....ENID...........
ENSCPOP00000006380  .........................--..---.-----..--................-....NRCG...........
ENSCPOP00000005446  .........................CM..CNY.GFVGN..-G................R....TQCI...........
ENSCPOP00000017174  .........................CN..CQE.GWGGL..FC................N....QDLN...........
ENSCPOP00000009739  .........................CM..CKA.GFEAV..EN................G....TVCR...........
ENSCPOP00000014075  .........................CT..CSP.GTVLG..PD................G....QTCF...........
ENSCPOP00000009997  ............lgatsfqdcetraVQ..CSP.GHFYN..TT................T....HRCI...........
ENSCPOP00000012721  .........................CR..CKP.GFQRN..MK................N....RQCE...........
ENSCPOP00000014166  .........................KL..CPA.NTYSN..KG................E....ASCH...........
ENSCPOP00000000520  .........................CT..CPA.GYTGP..TC................H....EEVT...........
ENSCPOP00000000520  .........................CL..CPS.GYTGS..SC................Q....TLVD...........
ENSCPOP00000020809  .........................VA..CGP.GTYFS..GE................Q....GQCV...........
ENSCPOP00000014227  .........................--..---.-----..VD................E....NKCA...........
ENSCPOP00000010877  .........................--..---.-----..--................-....--CP...........
ENSCPOP00000008998  .........................CV..CQP.GFTGI..HC................E....EDIN...........
ENSCPOP00000013252  .................adaegatvCT..CES.GHYRA..PG................E....GHQE...........
ENSCPOP00000002774  .........................--..---.-----..--................-....----...........
ENSCPOP00000013057  .........................CT..CAA.GYEAV..EG................N....TRCR...........
ENSCPOP00000001828  .........................--..---.-----..--................-....----...........
ENSCPOP00000014166  .........................TS..CPT.GYYID..RN................S....GTCH...........
ENSCPOP00000014227  .........................--..---.-----..QT................G....NVCH...........
ENSCPOP00000004446  .........................--..---.-----..--................-....----...........
ENSCPOP00000012415  .........................--..---.-----..--................-....---Tvsliyavhlkk
ENSCPOP00000009033  .........................--..---.-----..--................-....----...........
ENSCPOP00000019082  .........................CT..CPN.DQVVC..TA................F....LPCT...........
ENSCPOP00000008922  .........................CS..CVD.GEQGA..--................-....-TCP...........
ENSCPOP00000008698  .........................--..---.-----..--................-....----...........
ENSCPOP00000000875  ....................iaanlCA..CPQ.GFTGP..SC................E....TDID...........
ENSCPOP00000012415  .........................--..---.-----..--................-....----...........
ENSCPOP00000010587  .........................CI..CEK.GYYGK..GL................Q....YECT...........
ENSCPOP00000006471  .........................FA..CCP.GWKRT..--................Gglp.GACA...........
ENSCPOP00000010723  ...................hraageCL..CYE.GYMKD..PV................Hk...HLCIrnewgtnqgpw


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000002433  saehgykfck....................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000009044  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000019239  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  ..............................................................................
ENSCPOP00000001198  vsghlhvghtpvhfsdvdlhayivsndgraytaishipppaaqallpltpigglfgwlfalekpgfkngfsltgaafv
ENSCPOP00000000218  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003570  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  ..............................................................................
ENSCPOP00000011692  ..............................................................................
ENSCPOP00000008828  ..............................................................................
ENSCPOP00000017054  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  ..............................................................................
ENSCPOP00000013204  vkgrifvgsshtpvvfentdlhsyvvmnhgrsytaistipetvgysllplapiggiigwmfaveqngfkngfsitgge
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000006144  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000002393  ..............................................................................
ENSCPOP00000017907  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  ..............................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013762  ..............................................................................
ENSCPOP00000004344  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000006612  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  ..............................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000010099  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000016303  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000013620  ..............................................................................
ENSCPOP00000003279  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000014968  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000017876  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000007253  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000015957  ..............................................................................
ENSCPOP00000004271  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000019055  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000001400  mhvifgisldpevksndamvpiagiqsgfdvefdeveqfiywvenpgeihrvktdgtnrtvfaplsllgssmglafdw
ENSCPOP00000007117  ..............................................................................
ENSCPOP00000016677  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000014168  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  ..............................................................................
ENSCPOP00000005446  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  ..............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000010877  ..............................................................................
ENSCPOP00000008998  ..............................................................................
ENSCPOP00000013252  ..............................................................................
ENSCPOP00000002774  ..............................................................................
ENSCPOP00000013057  ..............................................................................
ENSCPOP00000001828  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000004446  ..............................................................................
ENSCPOP00000012415  sgyvffeyqyvdnniffeffiqndqcrdmdsatdkwvkltdsgewgshsvmlksgtnilywrttgilmgskavkpvlv
ENSCPOP00000009033  ..............................................................................
ENSCPOP00000019082  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000006471  ..............................................................................
ENSCPOP00000010723  pytifqrgfdlvlgeqpsdkifrftytlgegmwlplsksfvippaelainpsakcktdmtvmedavevreelmtsssf


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000009044  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000019239  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  ..............................................................................
ENSCPOP00000001198  hnaevtfypgeervwitqtaegldsenylimktniqgqvpaipanfmahippykelyhysdsavtvtssrdysltfga
ENSCPOP00000000218  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003570  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  ..............................................................................
ENSCPOP00000011692  ..............................................................................
ENSCPOP00000008828  ..............................................................................
ENSCPOP00000017054  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  ..............................................................................
ENSCPOP00000013204  ftrqaevtfvghpgklvirqqfsgidehghltidtelegrvpqipagssvtiepytelyhysgsvimssstreytvte
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000006144  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000002393  ..............................................................................
ENSCPOP00000017907  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  ..............................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013762  ..............................................................................
ENSCPOP00000004344  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000006612  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  ..............................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000010099  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000016303  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000013620  ..............................................................................
ENSCPOP00000003279  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000014968  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000017876  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000007253  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000015957  ..............................................................................
ENSCPOP00000004271  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000019055  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000001400  isrnmyyttpasqsievltlrgetryrktlitndgtnlgvgfpvgiavdpargklywsdqgtdsgipakiasanmdgt
ENSCPOP00000007117  ..............................................................................
ENSCPOP00000016677  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000014168  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  ..............................................................................
ENSCPOP00000005446  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  ..............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000010877  ..............................................................................
ENSCPOP00000008998  ..............................................................................
ENSCPOP00000013252  ..............................................................................
ENSCPOP00000002774  ..............................................................................
ENSCPOP00000013057  ..............................................................................
ENSCPOP00000001828  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000004446  ..............................................................................
ENSCPOP00000012415  knitiegva.....................................................................
ENSCPOP00000009033  ..............................................................................
ENSCPOP00000019082  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000006471  ..............................................................................
ENSCPOP00000010723  dslevlldsfgpvr................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000009044  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000019239  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  ..............................................................................
ENSCPOP00000001198  lnqmgsyrihqnitfqacrhagrqavptpqqlsvdrvfalysedegvlrfavtnqigpvevdsepilvn.........
ENSCPOP00000000218  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003570  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  ..............................................................................
ENSCPOP00000011692  ..............................................................................
ENSCPOP00000008828  ..............................................................................
ENSCPOP00000017054  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  ..............................................................................
ENSCPOP00000013204  pepagaapshtyvyqwrqtitfeecvhdtarqalpstqqlsvdsvfvlynqeerilryalsnsigpvregspdalqn.
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000006144  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000002393  ..............................................................................
ENSCPOP00000017907  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  ..............................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013762  ..............................................................................
ENSCPOP00000004344  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000006612  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  ..............................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000010099  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000016303  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000013620  ..............................................................................
ENSCPOP00000003279  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000014968  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000017876  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000007253  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000015957  ..............................................................................
ENSCPOP00000004271  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000019055  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000001400  sskilftgnmdhleivtldikeqklywavtsrgviergnvdgtermilvyhlshpwgiavhdsflyysdeqyevierv
ENSCPOP00000007117  ..............................................................................
ENSCPOP00000016677  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000014168  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  ..............................................................................
ENSCPOP00000005446  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  ..............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000010877  ..............................................................................
ENSCPOP00000008998  ..............................................................................
ENSCPOP00000013252  ..............................................................................
ENSCPOP00000002774  ..............................................................................
ENSCPOP00000013057  ..............................................................................
ENSCPOP00000001828  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000004446  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000009033  ..............................................................................
ENSCPOP00000019082  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000006471  ..............................................................................
ENSCPOP00000010723  ..............................................................................


                                                                                                  60
                                                                                                   |
d2dtge6               ..................................C.....CHS.......................ECL......GNC
ENSCPOP00000005160  ..................................R.....CHK.......................GCE......-TC
ENSCPOP00000002433  ..................................R.....CDT.......................SCL......-TC
ENSCPOP00000002433  ..................................K.....CAP.......................SCE......-SC
ENSCPOP00000011550  ..................................A.....CDQ.......................SCK......-SC
ENSCPOP00000011550  ..................................A.....CHQ.......................SCL......-GC
ENSCPOP00000011550  ..................................Eq....CSPafyrdlgvck.............SCD......NHC
ENSCPOP00000000034  ..................................Q.....CHP.......................ECLpqamn.VTC
ENSCPOP00000009044  ..................................-.....---.......................---......---
ENSCPOP00000012721  ..................................D.....IDEcssgf..................PCS......QHC
ENSCPOP00000019239  ..................................P.....CDA.......................RAL......AQC
ENSCPOP00000011550  ..................................R.....CHS.......................SCR......-TC
ENSCPOP00000013382  ..................................S.....CHP.......................ECQpmegm.ATC
ENSCPOP00000005210  ..................................-.....CDP.......................LCAh.....GHC
ENSCPOP00000007246  ..................................P.....CTEela....................RCRpp....VGC
ENSCPOP00000001198  ..................................P.....CYDgsh....................TCDsa....ARC
ENSCPOP00000000218  ..................................P.....CSAerla...................LCPpvp...ASC
ENSCPOP00000013382  ..................................Qc....CHD.......................ECA......GGC
ENSCPOP00000014227  ..................................D.....TDEcsagk..................PCGe.....GTC
ENSCPOP00000020809  ..................................D.....IDEcsfer..................TCD......HVC
ENSCPOP00000000034  ..................................Dc....CHN.......................QCA......AGC
ENSCPOP00000000646  ..................................D.....TDEcsign..................PCGn.....GTC
ENSCPOP00000003877  ..................................D.....INEcerd...................ACGn.....GTC
ENSCPOP00000002772  ..................................I.....QDLcaledh.................ACE......QLC
ENSCPOP00000011550  ..................................-.....CHP.......................DCL......-TC
ENSCPOP00000000646  ..................................D.....HDEctttn..................MCLn.....GMC
ENSCPOP00000008922  ..................................D.....RNEclgt...................PCQ......QKC
ENSCPOP00000005525  ..................................D.....VNEcwtspsr................LCQ......HTC
ENSCPOP00000012721  ..................................Ivdy..CSShl.....................KCS......QVC
ENSCPOP00000005471  ..................................D.....IDEcryg...................YCQ......QLC
ENSCPOP00000000646  ..................................D.....IDEclvnrl.................LCDn.....GLC
ENSCPOP00000002433  ..................................P.....CHH.......................TCR......-GC
ENSCPOP00000014227  ..................................D.....VDEcalsss.................LCPh.....GRC
ENSCPOP00000009997  ..................................D.....VDEcsldr..................TCD......HSC
ENSCPOP00000014227  ..................................D.....LDEckqq...................PCGn.....GTC
ENSCPOP00000009997  ..................................D.....IDEcenelng................GCV......HDC
ENSCPOP00000003877  ..................................D.....VDEcekn...................PCTg.....GEC
ENSCPOP00000013776  ..................................D.....VDEceredna................GCV......HDC
ENSCPOP00000000646  ..................................D.....VDEcerh...................PCGn.....GTC
ENSCPOP00000020809  ..................................D.....IDEcendsyng...............GCV......HEC
ENSCPOP00000010019  ..................................D.....VDDcadap..................CCQ......QVC
ENSCPOP00000003877  ..................................D.....LDEcsngth.................LCSqh....ADC
ENSCPOP00000004859  ..................................C.....CHP.......................ECL......GSC
ENSCPOP00000007268  ..................................D.....IDEcryr...................YCQ......HRC
ENSCPOP00000000646  ..................................D.....LDEcqtkqh.................NCQ......FLC
ENSCPOP00000000264  ..................................-.....CQG.......................GCA......-TC
ENSCPOP00000001031  ..................................D.....VDEctgke..................HCAph....GEC
ENSCPOP00000003877  ..................................D.....INEcvlnsl.................LCDn.....GQC
ENSCPOP00000003877  ..................................D.....LDEcatkqh.................NCQ......FLC
ENSCPOP00000003570  ..................................K.....CKIe......................HCE......-AC
ENSCPOP00000003877  ..................................D.....IDEcrispd.................LCGr.....GQC
ENSCPOP00000013776  ..................................D.....IDEcsfdr..................TCD......HIC
ENSCPOP00000003877  ..................................D.....IDEcednpn.................ICDg.....GQC
ENSCPOP00000006876  ..................................D.....IDEcalggh.................TCHpg....QDC
ENSCPOP00000007897  ..................................D.....INEcqryagr................LCG......HKC
ENSCPOP00000000646  ..................................D.....LDEcsngth.................QCSin....AQC
ENSCPOP00000002772  ..................................R.....VDHcaqdh..................DCE......QLC
ENSCPOP00000000646  ..................................D.....IDEcrispd.................LCGs.....GIC
ENSCPOP00000000697  ..................................G.....CSSpdng...................GCS......QHC
ENSCPOP00000005210  ..................................C.....CHE.......................QCA......AGC
ENSCPOP00000006323  ..................................D.....INEcledks.................ACQg.....GDC
ENSCPOP00000006040  ..................................D.....IDEcgtera.................SCGad....QFC
ENSCPOP00000007782  ..................................-.....---.......................---......-GC
ENSCPOP00000011692  ..................................C.....CHS.......................ECL......GNC
ENSCPOP00000008828  ..................................-.....---.......................-CI......-IC
ENSCPOP00000017054  ..................................-.....---.......................---......---
ENSCPOP00000010587  ..................................E.....CSSg......................PCLnk....GTC
ENSCPOP00000000645  ..................................Dpln..VNG.......................GCS......QIC
ENSCPOP00000013204  ..................................P.....CYIgth....................GCDtn....AAC
ENSCPOP00000014227  ..................................D.....VDEcalgn..................FCAf.....GSC
ENSCPOP00000006144  ..................................Adide.CQQpd.....................TCS......QLC
ENSCPOP00000001400  ..................................Afdd..CQIwg.....................ICD......QKC
ENSCPOP00000010019  ..................................Rrsp..CAEgng....................GCM......HTC
ENSCPOP00000002393  ..................................-.....---.......................--K......-GC
ENSCPOP00000017907  ..................................-.....---.......................---......---
ENSCPOP00000000646  ..................................D.....IDEcennpe.................ICDg.....GQC
ENSCPOP00000014227  ..................................D.....NNEclaqps.................PCGtr....GRC
ENSCPOP00000016431  ..................................D.....VDEcaadtp.................PCNdt....QYC
ENSCPOP00000005160  ..................................E.....CHS.......................TCR......-TC
ENSCPOP00000005059  ..................................-.....---.......................---......---
ENSCPOP00000014573  ..................................E.....CASn......................PCLng....GHC
ENSCPOP00000001031  ..................................D.....VNEcasra..................SCPk.....GLC
ENSCPOP00000001400  ..................................D.....INEcdtpg..................FCS......QLC
ENSCPOP00000013204  ..................................D.....VDEcqls...................RCHpd....AFC
ENSCPOP00000014227  ..................................D.....VNEcdlnph.................ICLh.....GNC
ENSCPOP00000016148  ..................................D.....CNPn......................PCLng....GSC
ENSCPOP00000016148  ..................................D.....CGPspdlgl.................RCLhn....GTC
ENSCPOP00000003877  ..................................D.....ENEclsah..................ICGg.....ASC
ENSCPOP00000013762  ..................................-.....---.......................---......---
ENSCPOP00000004344  ..................................-.....---.......................---......---
ENSCPOP00000014192  ..................................D.....CASs......................PCVn.....GTC
ENSCPOP00000009997  ..................................Et....CAVnng....................GCD......RTC
ENSCPOP00000014192  ..................................E.....CHSd......................PCQnd....ATC
ENSCPOP00000014227  ..................................D.....VDEcadtsq.................DCQarg...MLC
ENSCPOP00000018258  ..................................Qv....CARrlge...................PCDhl....HVC
ENSCPOP00000016148  ..................................D.....CASn......................PCTf.....GVC
ENSCPOP00000011900  ..................................D.....VNEcqqlpe.................PCG......YQC
ENSCPOP00000006323  ..................................D.....IDEclepn..................VCAn.....GSC
ENSCPOP00000006876  ..................................D.....IDEckdgth.................QCRyn....QIC
ENSCPOP00000001031  ..................................D.....VDEcedyaep................VCGa.....WKC
ENSCPOP00000006612  ..................................E.....CSQqng....................GCG......QVC
ENSCPOP00000000646  ..................................Dene..CSNpg.....................ACGs.....ASC
ENSCPOP00000011665  ..................................D.....CSPlhdlasrsp..............KCFnn....GTC
ENSCPOP00000009088  ..................................A.....---.......................---......---
ENSCPOP00000010393  ..................................P.....CASs......................PCQnn....GTC
ENSCPOP00000007568  ..................................E.....CASs......................PCRgg....GIC
ENSCPOP00000014192  ..................................P.....CSPn......................PCEna....AVC
ENSCPOP00000011665  ..................................D.....CRPn......................PCHng....GSC
ENSCPOP00000019462  ..................................Ki....CAQqlgd...................NCTea....AIC
ENSCPOP00000017174  ..................................D.....CASs......................PCAng....GTC
ENSCPOP00000005525  ..................................D.....VDEcavgsh.................TCQpg....SSC
ENSCPOP00000011665  ..................................E.....CAGs......................PCHng....GTC
ENSCPOP00000002335  ..................................D.....TDEctagth.................NCRad....QVC
ENSCPOP00000014192  ..................................E.....CQNq......................PCRng....GTC
ENSCPOP00000010099  ..................................E.....CDP.......................QCEkveeglLTC
ENSCPOP00000013776  ..................................P.....CPA.......................G--......-TF
ENSCPOP00000016148  ..................................E.....CLSg......................PCRnq....ATC
ENSCPOP00000007568  ..................................D.....CNPl......................PCYng....GIC
ENSCPOP00000006323  ..................................D.....VDEclrpd..................VCGd.....GHC
ENSCPOP00000005525  ..................................D.....IDEcaqaagm................LCT......FRC
ENSCPOP00000016303  ..................................-.....---.......................---......---
ENSCPOP00000010587  ..................................-.....---.......................SCRl.....GSY
ENSCPOP00000013620  ..................................D.....VDEcaipgas................NCSan....SSC
ENSCPOP00000003279  ..................................E.....CLPt......................PCHng....GTC
ENSCPOP00000005471  ..................................D.....VDEcrtipe.................ACRgd....MMC
ENSCPOP00000007268  ..................................D.....VNEcltipe.................ACKge....MKC
ENSCPOP00000014968  ..................................-.....--Rpnrg...................GCE......QRC
ENSCPOP00000000520  ..................................E.....CASa......................PCLnh....ANC
ENSCPOP00000017876  ..................................C.....CHT.......................ECL......GGC
ENSCPOP00000000697  ..................................D.....IDEcaadra.................VCPsps...SKC
ENSCPOP00000005525  ..................................D.....QDEcllgth.................DCSrr....QFC
ENSCPOP00000000875  ..................................D.....IDEcaegrh.................YCRen....TMC
ENSCPOP00000000520  ..................................C.....LSQ.......................PCHre....AQC
ENSCPOP00000010233  ..................................D.....CTRn......................PCAhg....GTC
ENSCPOP00000001031  ..................................N.....IDEcrqpg..................TCPd.....GRC
ENSCPOP00000007253  ..................................D.....CPE.......................HCDn.....SEC
ENSCPOP00000011665  ..................................E.....CDSr......................PCLng....GTC
ENSCPOP00000000646  ..................................D.....VDEcqaipg.................ICQg.....GNC
ENSCPOP00000005648  ..................................L.....CDNt......................ECQng....GQC
ENSCPOP00000014192  ..................................L.....CSQs......................PCKnk....GTC
ENSCPOP00000009046  ..................................E.....CHSq......................PCAhg....GTC
ENSCPOP00000007268  ..................................D.....IDEcsyssy.................LCQ......YRC
ENSCPOP00000006033  ..................................E.....CGLkpr....................PCK......HRC
ENSCPOP00000002433  ..................................A.....CSA.......................HCG......-SC
ENSCPOP00000000646  ..................................H.....HAN.......................LCLn.....GRC
ENSCPOP00000015957  ..................................Dp....CAQa......................PCE......HHC
ENSCPOP00000004271  ..................................Aqdk..CASgth....................GCQ......HIC
ENSCPOP00000016148  ..................................D.....CPGh......................QCLng....GTC
ENSCPOP00000012510  ..................................D.....IDEcasgka.................VCPfn....RRC
ENSCPOP00000019055  ..................................Q.....CKGqq.....................PCT......---
ENSCPOP00000005648  ..................................Hl....CSSg......................PCRng....GTC
ENSCPOP00000001400  dkasgankvvmrdnvpnlrglrvyhrrnvgessnG.....CSNnvn....................TCQ......QIC
ENSCPOP00000007117  ..................................D.....IDEclssg..................ICPen....AYC
ENSCPOP00000016677  ..................................Srnp..CSSn......................PCKge....ATC
ENSCPOP00000001031  ..................................-.....--Iln.....................GCEn.....GRC
ENSCPOP00000014168  ..................................Sgr...CTPg......................VCKng....GTC
ENSCPOP00000012510  ..................................E.....CGIkpr....................LCQ......HRC
ENSCPOP00000006033  ..................................D.....VDEcatgrv.................SCPrf....RQC
ENSCPOP00000007039  ..................................K.....CPE.......................NMK......GVT
ENSCPOP00000006323  ..................................-.....-GIln.....................GCEn.....GRC
ENSCPOP00000014192  ..................................D.....CAFa......................SCTpg....STC
ENSCPOP00000006380  ..................................D.....NNG.......................GCT......HLC
ENSCPOP00000005446  ..................................AtdkneCQFgaav...................VCGnh....TSC
ENSCPOP00000017174  ..................................Y.....CTHht.....................PCRng....ATC
ENSCPOP00000009739  ..................................G.....CPS.......................G--......-TF
ENSCPOP00000014075  ..................................Dene..CEQdng....................GCS......EIC
ENSCPOP00000009997  ..................................R.....CSS.......................G--......-TY
ENSCPOP00000012721  ..................................D.....LNEclvfg..................MCS......QQC
ENSCPOP00000014166  ..................................P.....CDSdkysekgss..............SCKmr....PAC
ENSCPOP00000000520  ..................................A.....CYSe......................PCLng....GSC
ENSCPOP00000000520  ..................................P.....CAQe......................PCPpt....SRC
ENSCPOP00000020809  ..................................P.....CVS.......................G--......-TY
ENSCPOP00000014227  ..................................V.....SPA.......................ACGs.....ASC
ENSCPOP00000010877  ..................................V.....CARqrge...................SCSel....APC
ENSCPOP00000008998  ..................................E.....CLSh......................PCKng....GTC
ENSCPOP00000013252  ..................................A.....CTRppsapgnlsfsvsgtqlslrwepPTDm.....GGR
ENSCPOP00000002774  ..................................-.....---.......................---......---
ENSCPOP00000013057  ..................................A.....CGQgtfkpqsgegscq..........PCPa.....NSH
ENSCPOP00000001828  ..................................-.....---.......................---......---
ENSCPOP00000014166  ..................................P.....CPP.......................NTI......LKA
ENSCPOP00000014227  ..................................H.....FTD.......................LCPn.....GRC
ENSCPOP00000004446  ..................................-.....---.......................---......---
ENSCPOP00000012415  ..................................Y.....T-Secf....................PCKa.....GTF
ENSCPOP00000009033  ..................................-.....---.......................---......---
ENSCPOP00000019082  ..................................V.....GDAs......................ACL......-TC
ENSCPOP00000008922  ..................................D.....AHG.......................PCG......---
ENSCPOP00000008698  ..................................-.....---.......................---......---
ENSCPOP00000000875  ..................................E.....CSDgfv....................QCDsr....ANC
ENSCPOP00000012415  ..................................-.....---.......................---......---
ENSCPOP00000010587  ..................................A.....CPSgtykpegs...............P--......---
ENSCPOP00000006471  ..................................Tav...CQP.......................PCGng....GSC
ENSCPOP00000010723  ..................................D.....C--.......................--Skdn...GGC


                                  70                              80                                
                                   |                               |                                
d2dtge6               S..QPD..DPTKCVAC.......RNFYL...D.......G.....RCVE.............................
ENSCPOP00000005160  S..SRS..-PTQCLSCrr.....GFYHHqe.M.......S.....TCVT.............................
ENSCPOP00000002433  H..GPG..-FKDCTSCps.....GYLLD...L.......G.....TCQLga...........................
ENSCPOP00000002433  F..GSH..-SDQCLSCky.....GYFLNee.T.......N.....SCVV.............................
ENSCPOP00000011550  G..P--..NSPRCLTCie.....NMVLH...N.......G.....QCIS.............................
ENSCPOP00000011550  T..GKN..-SHDCIACqp.....SHVLL...D.......G.....QCLS.............................
ENSCPOP00000011550  L..QCQ..DLHQCTHCee.....PFLLL...G.......A.....QCVQ.............................
ENSCPOP00000000034  T..GRG..-PDNCVQC.......AHHID...G.......P.....HCVK.............................
ENSCPOP00000009044  -..---..--------.......-----...-.......-.....----.............................
ENSCPOP00000012721  I..NTY..GTYKC---.......-----...-.......-.....----.............................
ENSCPOP00000019239  A..PPP..TAPACA--.......ELVRE...-.......-.....----.............................
ENSCPOP00000011550  R..AGG..-PFSCSSCnt.....NLVLTh..I.......G.....TCSA.............................
ENSCPOP00000013382  N..GSG..-SDACVQC.......AHFRD...G.......P.....HCVS.............................
ENSCPOP00000005210  W..GPG..-PTQCVNC.......SQFLR...G.......Q.....ECVR.............................
ENSCPOP00000007246  E..ELV..REPGC---.......-----...-.......-.....----.............................
ENSCPOP00000001198  Hp.GTG..VDYTC---.......-----...-.......-.....----.............................
ENSCPOP00000000218  Q..EVS..RPAGC---.......-----...-.......-.....----.............................
ENSCPOP00000013382  S..GPQ..-DTDCFAC.......RHFND...S.......G.....ACVP.............................
ENSCPOP00000014227  T..NVI..GGFQC---.......-----...-.......-.....----.............................
ENSCPOP00000020809  I..NSP..GSFQC---.......-----...-.......-.....----.............................
ENSCPOP00000000034  T..GPR..-ESDCLVC.......RRFRD...E.......A.....TCKD.............................
ENSCPOP00000000646  T..NVI..GSFEC---.......-----...-.......-.....----.............................
ENSCPOP00000003877  R..NTI..GSFNC---.......-----...-.......-.....----.............................
ENSCPOP00000002772  V..NVP..GSFVC---.......-----...-.......-.....----.............................
ENSCPOP00000011550  S..HS-..-PNHCDLCqd.....PTKLLe..N.......G.....RCVH.............................
ENSCPOP00000000646  I..NED..GSFKC---.......-----...-.......-.....----.............................
ENSCPOP00000008922  R..NSV..GSYQC---.......-----...-.......-.....----.............................
ENSCPOP00000005525  E..NTL..GSYRC---.......-----...-.......-.....----.............................
ENSCPOP00000012721  E..QHK..HTVKC---.......-----...-.......-.....----.............................
ENSCPOP00000005471  A..NVP..GSYSC---.......-----...-.......-.....----.............................
ENSCPOP00000000646  R..NTP..GSYSC---.......-----...-.......-.....----.............................
ENSCPOP00000002433  R..GSG..-PSSCTSCgadkqgrERFLH...Q.......G.....ECLE.............................
ENSCPOP00000014227  I..NVV..GAFQC---.......-----...-.......-.....----.............................
ENSCPOP00000009997  L..NYP..GTFAC---.......-----...-.......-.....----.............................
ENSCPOP00000014227  R..NTV..GSYTC---.......-----...-.......-.....----.............................
ENSCPOP00000009997  L..NIP..GNYRC---.......-----...-.......-.....----.............................
ENSCPOP00000003877  V..NTP..GSYTC---.......-----...-.......-.....----.............................
ENSCPOP00000013776  V..NIP..GNYRC---.......-----...-.......-.....----.............................
ENSCPOP00000000646  K..NTV..GSYNC---.......-----...-.......-.....----.............................
ENSCPOP00000020809  I..NIP..GNYRC---.......-----...-.......-.....----.............................
ENSCPOP00000010019  T..NTP..GGYEC---.......-----...-.......-.....----.............................
ENSCPOP00000003877  K..NTL..GSYRC---.......-----...-.......-.....----.............................
ENSCPOP00000004859  H..APD..DDTACVAC.......RHFYY...A.......G.....ICVP.............................
ENSCPOP00000007268  V..NLP..GSFRC---.......-----...-.......-.....----.............................
ENSCPOP00000000646  V..NTL..GGFTC---.......-----...-.......-.....----.............................
ENSCPOP00000000264  S..D--..-YNGCLSCkp.....RLFFVl..ErigmkqiG.....VCLS.............................
ENSCPOP00000001031  L..NSH..GSFFC---.......-----...-.......-.....----.............................
ENSCPOP00000003877  R..NTP..GSFVC---.......-----...-.......-.....----.............................
ENSCPOP00000003877  V..NTI..GGFTC---.......-----...-.......-.....----.............................
ENSCPOP00000003570  F..S--..-HNFCTKCqe.....GRYLH...K.......G.....RCYP.............................
ENSCPOP00000003877  V..NTP..GDFEC---.......-----...-.......-.....----.............................
ENSCPOP00000013776  V..NTP..GSFQC---.......-----...-.......-.....----.............................
ENSCPOP00000003877  T..NIP..GEYRC---.......-----...-.......-.....----.............................
ENSCPOP00000006876  D..NTI..GSYRC---.......-----...-.......-.....--VV.............................
ENSCPOP00000007897  E..NTP..GSYHC---.......-----...-.......-.....----.............................
ENSCPOP00000000646  V..NTP..GSYRC---.......-----...-.......-.....----.............................
ENSCPOP00000002772  L..NTE..ESFVC---.......-----...-.......-.....----.............................
ENSCPOP00000000646  V..NTP..GSFEC---.......-----...-.......-.....----.............................
ENSCPOP00000000697  ItrSPV..-SWEC---.......-----...-.......-.....----.............................
ENSCPOP00000005210  T..GPK..-HSDCLAC.......LHFNH...S.......G.....TCEM.............................
ENSCPOP00000006323  I..NTD..GSYDC---.......-----...-.......-.....----.............................
ENSCPOP00000006040  V..NTE..GAYECRDCakacl..GCMGAg..P.......G.....RCK-.............................
ENSCPOP00000007782  K..TLT..SSQACVVCee.....GFSLH...Q.......K.....TCVQ.............................
ENSCPOP00000011692  T..EPD..DPTKCVAC.......RNFYL...D.......G.....RCVA.............................
ENSCPOP00000008828  S..E--..-ENGCSTCqq.....KLFLLirrEgirqy..G.....KCVH.............................
ENSCPOP00000017054  -..---..--------.......-----...-.......-.....----.............................
ENSCPOP00000010587  V..DGV..AGYRC---.......-----...-.......-.....----.............................
ENSCPOP00000000645  D..NTP..GSYQC---.......-----...-.......-.....----.............................
ENSCPOP00000013204  Rp.GQG..TTFTC---.......-----...-.......-.....----.............................
ENSCPOP00000014227  E..NLP..GFFRC---.......-----...-.......-.....----.............................
ENSCPOP00000006144  V..NLE..GSYKC---.......-----...-.......-.....----.............................
ENSCPOP00000001400  E..NRM..GHHRC---.......-----...-.......-.....----.............................
ENSCPOP00000010019  Q..ELQ..GLAQC---.......-----...-.......-.....----.............................
ENSCPOP00000002393  L..SCS..KDNGCSRCqqkl...F--FFlrrEgmrqh..G.....ECLH.............................
ENSCPOP00000017907  -..---..--------.......-----...-.......-.....----.............................
ENSCPOP00000000646  T..NIP..GEYRC---.......-----...-.......-.....----.............................
ENSCPOP00000014227  L..NAP..GSFHC---.......-----...-.......-.....----.............................
ENSCPOP00000016431  D..NVA..GSYACEECdstcv..GCTGKg..P.......A.....NCK-.............................
ENSCPOP00000005160  V..GPS..-REECIHCak.....NFSFQ...D.......W.....KCVP.............................
ENSCPOP00000005059  -..---..--------.......-----...-.......-.....----.............................
ENSCPOP00000014573  Q..NEI..NRFQC---.......-----...-.......-.....----.............................
ENSCPOP00000001031  L..NTE..GSFTCT--.......-----...-.......-.....----.............................
ENSCPOP00000001400  Y..NLR..GSFRC---.......-----...-.......-.....----.............................
ENSCPOP00000013204  Y..NTP..GSFMC-QCkp.....GYQGD...G.......F.....QCVPgevektrcqqerehilgavgaadtqrprp
ENSCPOP00000014227  E..NTA..GSFVC---.......-----...-.......-.....----.............................
ENSCPOP00000016148  E..DGV..GSFSC---.......-----...-.......-.....----.............................
ENSCPOP00000016148  V..DLV..GGFRC---.......-----...-.......-.....----.............................
ENSCPOP00000003877  H..NTL..GSYKC---.......-----...-.......-.....----.............................
ENSCPOP00000013762  -..---..--------.......-----...-.......-.....----.............................
ENSCPOP00000004344  -..---..--------.......-----...-.......-.....----.............................
ENSCPOP00000014192  V..DGI..SRYSC---.......-----...-.......-.....----.............................
ENSCPOP00000009997  K..DTS..TGVHC---.......-----...-.......-.....----.............................
ENSCPOP00000014192  L..DKI..GGFTC---.......-----...-.......-.....----.............................
ENSCPOP00000014227  K..NLI..GTFEC---.......-----...-.......-.....----.............................
ENSCPOP00000018258  D..PNQ..-GLVCQ--.......-----...-.......-.....----.............................
ENSCPOP00000016148  R..DGI..NRYDC---.......-----...-.......-.....----.............................
ENSCPOP00000011900  H..NLQ..GSYRC-LCpa.....GYTLLrd.G.......K.....ACTPlerkgqnvttvshrrpsmpwlrprapipg
ENSCPOP00000006323  S..NLE..GSYMC---.......-----...-.......-.....----.............................
ENSCPOP00000006876  E..NTR..GSYRC---.......-----...-.......-.....----.............................
ENSCPOP00000001031  E..NSP..GSYRC---.......-----...-.......-.....--VP.............................
ENSCPOP00000006612  L..NTP..GGFYC---.......-----...-.......-.....----.............................
ENSCPOP00000000646  Y..NTL..GSYKC---.......-----...-.......-.....----.............................
ENSCPOP00000011665  V..DQV..GGYTC---.......-----...-.......-.....----.............................
ENSCPOP00000009088  -..---..--------.......-----...-.......-.....----.............................
ENSCPOP00000010393  Y..VDG..VHFTC---.......-----...-.......-.....----.............................
ENSCPOP00000007568  E..DLA..DGFHC---.......-----...-.......-.....----.............................
ENSCPOP00000014192  K..EAPnfESFTC---.......-----...-.......-.....----.............................
ENSCPOP00000011665  T..DGV..NTAFC---.......-----...-.......-.....----.............................
ENSCPOP00000019462  D..---..--------.......-----...-.......-.....----.............................
ENSCPOP00000017174  R..DGV..NDYSC---.......-----...-.......-.....----.............................
ENSCPOP00000005525  Q..NTK..GSFYC---.......-----...-.......-.....QARQ.............................
ENSCPOP00000011665  E..DGI..NSFTC---.......-----...-.......-.....----.............................
ENSCPOP00000002335  I..NLR..GSFAC-QClp.....GYQKL...G.......E.....QCVDidecavpevydfemvptnvkln.......
ENSCPOP00000014192  V..DLV..NHFKC---.......-----...-.......-.....----.............................
ENSCPOP00000010099  H..GPG..-PDNCTKC.......SHFKD...G.......P.....NCVE.............................
ENSCPOP00000013776  Q..ERE..GQLSCDLCpgsdah.GPLGA...T.......Nit...TCAG.............................
ENSCPOP00000016148  L..DRI..GQFTC---.......-----...-.......-.....----.............................
ENSCPOP00000007568  V..DGV..NWFRC---.......-----...-.......-.....----.............................
ENSCPOP00000006323  V..NTM..GAFRCE--.......-----...-.......-.....----.............................
ENSCPOP00000005525  L..NVP..GSYQC---.......-----...-.......-.....----.............................
ENSCPOP00000016303  -..---..--------.......-----...-.......-.....----.............................
ENSCPOP00000010587  Q..DEE..GQLECKLCpagty..TEYLH...S.......Rsis..ECKA.............................
ENSCPOP00000013620  V..NTL..GSYTC---.......-----...-.......-.....----.............................
ENSCPOP00000003279  H..NLV..GGFSC---.......-----...-.......-.....----.............................
ENSCPOP00000005471  V..NQN..GGYLC---.......-----...-.......-.....--IPrtnpvyrgpypaaappvsaanyptisrpl
ENSCPOP00000007268  I..NHY..GGYLC---.......-----...-.......-.....--LPrsaavindlhgegppppvppaqhpn....
ENSCPOP00000014968  L..NTL..GSYKC---.......-----...-.......-.....----.............................
ENSCPOP00000000520  Q..DQL..NGFLC---.......-----...-.......-.....----.............................
ENSCPOP00000017876  S..QPE..DPRACVAC.......RHFYY...Q.......S.....ACHR.............................
ENSCPOP00000000697  I..NTE..GGYVC---.......-----...-.......-.....----.............................
ENSCPOP00000005525  V..NTL..GSFSC---.......----V...N.......H.....TV--.............................
ENSCPOP00000000875  V..NTP..GSFMC---.......-----...-.......-.....----.............................
ENSCPOP00000000520  S..TNPltGSTLC---.......-----...-.......-.....----.............................
ENSCPOP00000010233  H..DLE..NGIVC---.......-----...-.......-.....----.............................
ENSCPOP00000001031  V..NSP..GSYTCL--.......-----...-.......-.....----.............................
ENSCPOP00000007253  R..S--..-SQRC---.......-----...-.......-.....----.............................
ENSCPOP00000011665  Q..DSY..GTYKC---.......-----...-.......-.....----.............................
ENSCPOP00000000646  I..NTV..GSFEC---.......-----...-.......-.....----.............................
ENSCPOP00000005648  Q..DER..GSAVC---.......-----...-.......-.....----.............................
ENSCPOP00000014192  I..QEK..AESRC---.......-----...-.......-.....----.............................
ENSCPOP00000009046  H..DQV..NGFRC---.......-----...-.......-.....----.............................
ENSCPOP00000007268  V..NEP..GRFSC---.......-----...-.......-.....----.............................
ENSCPOP00000006033  M..NTF..GSYKC---.......-----...-.......-.....----.............................
ENSCPOP00000002433  S..---..-RHECFWCe......QSFFL...L.......G.....RCSR.............................
ENSCPOP00000000646  I..PTV..SSYRC---.......-----...-.......-.....----.............................
ENSCPOP00000015957  Ep.GGP..QGYSC---.......-----...-.......-.....----.............................
ENSCPOP00000004271  Vk.DGP..GSHHC---.......-----...-.......-.....----.............................
ENSCPOP00000016148  V..DGV..NTYNC---.......-----...-.......-.....----.............................
ENSCPOP00000012510  V..NTF..GSYYC---.......-----...-.......-.....----.............................
ENSCPOP00000019055  V..---..AEGRCLTC.......EPGWN...G.......T.....KCDQ.............................
ENSCPOP00000005648  K..EAG..GEYHC-SC.......PYRFT...G.......K.....HCEI.............................
ENSCPOP00000001400  L..PVPg.GLFSC---.......-----...-.......-.....----.............................
ENSCPOP00000007117  N..NSL..GNYTC---.......-----...-.......-.....----.............................
ENSCPOP00000016677  IlgSQG..DSYTC---.......-----...-.......-.....----.............................
ENSCPOP00000001031  V..RVR..EGYTC---.......-----...-.......-.....----.............................
ENSCPOP00000014168  V..NLLv.GGFKC---.......-----...-.......-.....----.............................
ENSCPOP00000012510  V..NTH..GSYKC---.......-----...-.......-.....----.............................
ENSCPOP00000006033  V..NTF..GSYIC---.......-----...-.......-.....----.............................
ENSCPOP00000007039  E..D--..-GWNCISCp......GSLTA...E.......G.....KCY-.............................
ENSCPOP00000006323  V..RVQ..EGYTC---.......-----...-.......-.....----.............................
ENSCPOP00000014192  I..DRV..ASFSC---.......-----...-.......-.....----.............................
ENSCPOP00000006380  L..PSG..QNYTC---.......-----...-.......-.....----.............................
ENSCPOP00000005446  H..NTL..GGFYC-VCle.....GYRAT...N.......N.....NKT-.............................
ENSCPOP00000017174  T..NTGq.GSYTC---.......-----...-.......-.....----.............................
ENSCPOP00000009739  K..PNQ..GDEACTHCpin....S-RTTs..E.......Gat...NCV-.............................
ENSCPOP00000014075  V..NLK..HSYRC---.......-----...-.......-.....----.............................
ENSCPOP00000009997  Q..PEF..GKNSCVSCpg.....NTTTDfd.G.......S.....TN--.............................
ENSCPOP00000012721  I..NIE..GSYKC-VCdq.....NFQVQ...N.......N.....TCI-.............................
ENSCPOP00000014166  T..DKD..YFYTHTACdang...ETQLM...Y.......K.....WAQPkicdedaegavklpesgvktrcp......
ENSCPOP00000000520  S..PHP..RGYSC---.......-----...-.......-.....----.............................
ENSCPOP00000000520  L..QNG..ASFQC---.......-----...-.......-.....----.............................
ENSCPOP00000020809  Q..DLE..GQLSCTPCpssd...GVGLAga.H.......Nvs...QCGG.............................
ENSCPOP00000014227  H..NTL..GGFHC---.......-----...-.......-.....----.............................
ENSCPOP00000010877  D..GSG..-GLYCD--.......-----...-.......-.....----.............................
ENSCPOP00000008998  E..NLP..GNYSC---.......-----...-.......-.....----.............................
ENSCPOP00000013252  Q..DVQ..YSVECLQCr......GTAQD...G.......G.....PCQ-.............................
ENSCPOP00000002774  -..---..---QC-L-.......-----...-.......-.....----.............................
ENSCPOP00000013057  T..NTI..GSSVC---.......-----...-.......-.....----.............................
ENSCPOP00000001828  -..---..----C---.......-----...-.......-.....----.............................
ENSCPOP00000014166  H..QPY..GAQACMACgp.....GTKSNki.H.......S.....LCYN.............................
ENSCPOP00000014227  L..PTP..SSYRC---.......-----...-.......-.....----.............................
ENSCPOP00000004446  -..---..----C-SCda.....GYEER...G.......F.....VCQ-.............................
ENSCPOP00000012415  S..SKP..GAFSCQVCpr.....NTYSE...K.......Gat...ECM-.............................
ENSCPOP00000009033  -..---..---KC-MCqa.....GYEEK...N.......G.....TCQ-.............................
ENSCPOP00000019082  A..PDN..-RTRCGTCnt.....GYMLS...Q.......G.....LCK-.............................
ENSCPOP00000008922  -..---..-EYGC---.......DLTCN...H.......G.....GCQEvar..........................
ENSCPOP00000008698  -..---..-PLGCVMCpe.....GSYSL...D.......G.....QCV-.............................
ENSCPOP00000000875  V..NLP..GWYHC---.......-----...-.......-.....----.............................
ENSCPOP00000012415  -..---..---SCRTCal.....GSEQS...G.......S.....SCV-.............................
ENSCPOP00000010587  -..--G..GISTCIPCpde....NHTSP...P.......GstspeDCV-.............................
ENSCPOP00000006471  V..W--..-PGRC---.......-----...-.......-.....----.............................
ENSCPOP00000010723  S..K--..-NFRC-IS.......DRKLD...S.......T.....GCV-.............................


                                                      90                                            
                                                       |                                            
d2dtge6               ......................TCP.....PPYYHFQDWR.....C................................
ENSCPOP00000005160  ......................QCP.....AGFYADESQ-.....-................................
ENSCPOP00000002433  ......................ICK.....DGEYTDEH--.....-................................
ENSCPOP00000002433  ......................HCP.....DGSYQDTKK-.....-................................
ENSCPOP00000011550  ......................ECP.....GGYYADAT--.....-................................
ENSCPOP00000011550  ......................QCP.....EGYFNQA---.....-................................
ENSCPOP00000011550  ......................ECG.....KGYFPDHAK-.....-................................
ENSCPOP00000000034  ......................TCP.....AGVMGENNTLvwky.A................................
ENSCPOP00000009044  ......................---.....----------.....-................................
ENSCPOP00000012721  ......................LCT.....DGYKIQPDNPng...Ckslsdeepfliladhheirkistdgsnytllk
ENSCPOP00000019239  ......................---.....-----PGC--.....-................................
ENSCPOP00000011550  ......................SCF.....PGHYLDDN--.....-................................
ENSCPOP00000013382  ......................SCP.....HGVLGAKGPIfky..P................................
ENSCPOP00000005210  ......................ECHvlqglPREYVND---.....-................................
ENSCPOP00000007246  ......................---.....----------.....-................................
ENSCPOP00000001198  ......................ACA.....PGYQGDG--Rs....C................................
ENSCPOP00000000218  ......................---.....----------.....-................................
ENSCPOP00000013382  ......................LCP.....QPLVYNKLTF.....Q................................
ENSCPOP00000014227  ......................TCA.....VGFEPGPAAT.....C................................
ENSCPOP00000020809  ......................LCH.....RGYTLYGTTH.....C................................
ENSCPOP00000000034  ......................TCP.....PLMLYNPTTY.....Q................................
ENSCPOP00000000646  ......................NCN.....EGFEPGPMMN.....C................................
ENSCPOP00000003877  ......................RCN.....HGFILSHNND.....C................................
ENSCPOP00000002772  ......................QCY.....SGYSLAEDGKr....C................................
ENSCPOP00000011550  ......................SCG.....LAFYQAG---.....-................................
ENSCPOP00000000646  ......................ICK.....PGFVLAPNGRy....C................................
ENSCPOP00000008922  ......................SCH.....AGFHLHRDRHs....C................................
ENSCPOP00000005525  ......................SCA.....MGFRLAEDGKh....C................................
ENSCPOP00000012721  ......................SCY.....EGWKLDADGEs....Ctsvdpfeafiifsirheirridlhkrdysllv
ENSCPOP00000005471  ......................TCN.....PGFTLNEDGRs....C................................
ENSCPOP00000000646  ......................TCP.....PGYVFRTETEt....C................................
ENSCPOP00000002433  ......................SCP.....AGHAPAQG--.....-................................
ENSCPOP00000014227  ......................SCD.....AGFRASPDRQr....C................................
ENSCPOP00000009997  ......................ACD.....PGFTLYGFTH.....C................................
ENSCPOP00000014227  ......................LCS.....PGFTATRSGN.....C................................
ENSCPOP00000009997  ......................TCF.....DGFMLAHDGHn....C................................
ENSCPOP00000003877  ......................HCR.....AGYQSTLTRTe....C................................
ENSCPOP00000013776  ......................TCY.....DGFHLAHDGHn....C................................
ENSCPOP00000000646  ......................LCY.....PGFELTHNND.....C................................
ENSCPOP00000020809  ......................TCF.....DGFMLAHDGHn....C................................
ENSCPOP00000010019  ......................GCY.....AGYRLSADGCg....C................................
ENSCPOP00000003877  ......................LCK.....EGYTGDGFTCt....A................................
ENSCPOP00000004859  ......................ACP.....PGTYRFEGWR.....C................................
ENSCPOP00000007268  ......................QCE.....PGFQLGPNNRs....C................................
ENSCPOP00000000646  ......................KCP.....PGFTQHHT-A.....C................................
ENSCPOP00000000264  ......................SCP.....SGYYGTR---.....Y................................
ENSCPOP00000001031  ......................LCA.....PGFASEEGGTs....C................................
ENSCPOP00000003877  ......................TCP.....KGFVYKPDLKt....C................................
ENSCPOP00000003877  ......................KCP.....PGFTQHHT-A.....C................................
ENSCPOP00000003570  ......................ACP.....EGSTPTNGTM.....-................................
ENSCPOP00000003877  ......................KCE.....EGYESGFMMMkn...C................................
ENSCPOP00000013776  ......................LCH.....RGYLLYGVTH.....C................................
ENSCPOP00000003877  ......................LCY.....DGFMASEDMKt....C................................
ENSCPOP00000006876  ......................HCG.....IGFRRTSDGLs....C................................
ENSCPOP00000007897  ......................SCS.....VGFRLSVDGRs....C................................
ENSCPOP00000000646  ......................ACA.....EGFTGDGF-T.....C................................
ENSCPOP00000002772  ......................QCS.....EGFLINEDLKt....C................................
ENSCPOP00000000646  ......................ECF.....EGYESGFMMMkn...C................................
ENSCPOP00000000697  ......................GCF.....PGYDLQLDGKs....Caasgpqplllfansqdirhmhfdgtdyrvlls
ENSCPOP00000005210  ......................HCP.....ALVTYNTDT-.....-................................
ENSCPOP00000006323  ......................TCP.....DGFQLNDHKG.....C................................
ENSCPOP00000006040  ......................KCS.....PGYQQVGS-K.....C................................
ENSCPOP00000007782  ......................HCP.....PGFTPEVLDT.....H................................
ENSCPOP00000011692  ......................TCP.....PPYYHFQDWR.....C................................
ENSCPOP00000008828  ......................DCP.....LGFFGIRGQ-.....-................................
ENSCPOP00000017054  ......................---.....----------.....-................................
ENSCPOP00000010587  ......................TCV.....KGYIGLH--C.....E................................
ENSCPOP00000000645  ......................SCR.....SGFDLLSNKKd....C................................
ENSCPOP00000013204  ......................ECS.....IGFRGDGR-T.....C................................
ENSCPOP00000014227  ......................ACA.....DGYALDRGGGn....C................................
ENSCPOP00000006144  ......................ECE.....DGFHMDASTKt....Ckavgsvayllftnrhevrrmtpdrseytslvs
ENSCPOP00000001400  ......................GCE.....EGYVLERERH.....Crantsfneasvifsngrdlvigdihgrsfqil
ENSCPOP00000010019  ......................GCH.....AGFQLAADRKa....C................................
ENSCPOP00000002393  ......................ACP.....AGYYGHR---.....A................................
ENSCPOP00000017907  ......................GCP.....LGETRDACGC.....C................................
ENSCPOP00000000646  ......................LCY.....DGFMASMDMKt....C................................
ENSCPOP00000014227  ......................ECY.....QGFTLDSSGHg....C................................
ENSCPOP00000016431  ......................ECV.....PGYLKENG-Q.....C................................
ENSCPOP00000005160  ......................ACS.....EGYYPEE--Mp....G................................
ENSCPOP00000005059  ......................---.....----------.....-................................
ENSCPOP00000014573  ......................LCP.....TGFSGNL--C.....Q................................
ENSCPOP00000001031  ......................ACE.....SGYWVNEDGTa....C................................
ENSCPOP00000001400  ......................TCD.....SDYNLEDDGRt....Ckatasenllllvasqnkiiadnitshvhnifs
ENSCPOP00000013204  ................pglfvpECD.....EHGHYAPTQC.....Hgstgycwcvdrdgrelegtrtraglqppclst
ENSCPOP00000014227  ......................HCQ.....LGYITRKGATg....C................................
ENSCPOP00000016148  ......................SCL.....PGFAGPR--C.....A................................
ENSCPOP00000016148  ......................NCP.....PGYTGLH--C.....E................................
ENSCPOP00000003877  ......................MCP.....AGFQYEQFSGg....C................................
ENSCPOP00000013762  ......................---.....----------.....-................................
ENSCPOP00000004344  ......................SCP.....PGVSLVRDGC.....-................................
ENSCPOP00000014192  ......................VCS.....PGFTGQR--C.....N................................
ENSCPOP00000009997  ......................SCP.....VGFTLQLDGKt....C................................
ENSCPOP00000014192  ......................LCM.....PGFKGVH--C.....E................................
ENSCPOP00000014227  ......................ICP.....VGMRPQPGSGeg...C................................
ENSCPOP00000018258  ......................---.....----------.....-................................
ENSCPOP00000016148  ......................VCR.....PGFIGPL--C.....N................................
ENSCPOP00000011900  gsyhawvslrpgpgalssvsraWCP.....PGFIWQNG-A.....C................................
ENSCPOP00000006323  ......................SCH.....KGYSPTPDHRh....C................................
ENSCPOP00000006876  ......................VCP.....RGYRSQGLGRp....C................................
ENSCPOP00000001031  ......................GCQ.....PGFYMAPTGD.....C................................
ENSCPOP00000006612  ......................ACH.....SGYTLSQDDGri...C................................
ENSCPOP00000000646  ......................ACP.....SGFSFDQFSSa....C................................
ENSCPOP00000011665  ......................TCP.....PGFVGER--C.....E................................
ENSCPOP00000009088  ......................---.....----------.....-................................
ENSCPOP00000010393  ......................SCS.....PGFTGPT--C.....A................................
ENSCPOP00000007568  ......................HCP.....KGLSGLL--C.....E................................
ENSCPOP00000014192  ......................LCA.....PGWQGQR--C.....T................................
ENSCPOP00000011665  ......................DCL.....PGFQGAF--C.....E................................
ENSCPOP00000019462  ......................---.....----------.....-................................
ENSCPOP00000017174  ......................TCP.....PGYTGRN---.....-................................
ENSCPOP00000005525  ......................RCM.....EGFLQDPEGN.....C................................
ENSCPOP00000011665  ......................RCP.....EGYHDPT--C.....L................................
ENSCPOP00000002335  ......................GCS.....PMSFCKAKNSaf...L................................
ENSCPOP00000014192  ......................SCP.....PGTRGLF---.....-................................
ENSCPOP00000010099  ......................KCP.....DGLQGANSFIfky..A................................
ENSCPOP00000013776  ......................QCP.....PGQHSADGF-.....-................................
ENSCPOP00000016148  ......................ICM.....AGFTGTY--C.....E................................
ENSCPOP00000007568  ......................ECA.....PGFAGPD--C.....R................................
ENSCPOP00000006323  ......................YCD.....SGYRMTRRGR.....C................................
ENSCPOP00000005525  ......................ACPe....QGYAMMANGRs....C................................
ENSCPOP00000016303  ......................RCP.....LGVSLVLDGC.....-................................
ENSCPOP00000010587  ......................QCK.....QGTYSSNGL-.....-................................
ENSCPOP00000013620  ......................ACA.....DGFLLRPGLG.....C................................
ENSCPOP00000003279  ......................SCP.....EGFTGRA--C.....E................................
ENSCPOP00000005471  ......................VCR.....FGYQMDESNQ.....C................................
ENSCPOP00000007268  ......................TCP.....PGYELDQQES.....C................................
ENSCPOP00000014968  ......................SCD.....PGYELAPDKRr....Ceaacggfltklngsitspgwpkeyppnknciw
ENSCPOP00000000520  ......................VCQ.....PGYTGT--WC.....E................................
ENSCPOP00000017876  ......................ACP.....LGTYEHESWR.....C................................
ENSCPOP00000000697  ......................SCA.....AGYRGDGL-R.....C................................
ENSCPOP00000005525  ......................LCA.....EGYILNAHRK.....C................................
ENSCPOP00000000875  ......................ICK.....TGYIRIDDYS.....C................................
ENSCPOP00000000520  ......................LCQ.....PGYSGPT--C.....H................................
ENSCPOP00000010233  ......................TCP.....VGFSGMRCEV.....R................................
ENSCPOP00000001031  ......................ACE.....EGYRGQSG-S.....C................................
ENSCPOP00000007253  ......................---.....------KRTV.....L................................
ENSCPOP00000011665  ......................TCP.....QGYTGLNCQ-.....-................................
ENSCPOP00000000646  ......................RCP.....AGHKQSETTQk....C................................
ENSCPOP00000005648  ......................VCQ.....AGYTGAS--C.....E................................
ENSCPOP00000014192  ......................LCP.....SGWTGAY---.....-................................
ENSCPOP00000009046  ......................DCAg....TGYEGAR--C.....E................................
ENSCPOP00000007268  ......................QCP.....QGYQLLATRL.....C................................
ENSCPOP00000006033  ......................FCL.....NGHMLMPDGS.....C................................
ENSCPOP00000002433  ......................ECA.....AIEYWDEDT-.....-................................
ENSCPOP00000000646  ......................ECN.....MGYKQDANGD.....C................................
ENSCPOP00000015957  ......................HCL.....LGFRPAEEEPhr...C................................
ENSCPOP00000004271  ......................ECF.....EGYTLNADKKt....C................................
ENSCPOP00000016148  ......................QCP.....PEWTGQF--C.....T................................
ENSCPOP00000012510  ......................KCH.....IGFELKYSSGryd..C................................
ENSCPOP00000019055  ......................PCA.....AGFYGEGCG-.....-................................
ENSCPOP00000005648  ......................---.....----GKP---.....-................................
ENSCPOP00000001400  ......................ACA.....TGFKLNPDHQt....Cspyksfivvsmlsairgfslevsdhseamvpv
ENSCPOP00000007117  ......................HCL.....PGFMHVYS-M.....C................................
ENSCPOP00000016677  ......................HCS.....PGYQLDASQLk....C................................
ENSCPOP00000001031  ......................DCF.....EGFQLDAAHMa....C................................
ENSCPOP00000014168  ......................DCP.....SGDFEKPY--.....Cqvttrsfparsfitfrglrqrfhftlalsfat
ENSCPOP00000012510  ......................FCL.....SGHTLMPDAT.....C................................
ENSCPOP00000006033  ......................KCH.....KGFDLMYIGGkyqchG................................
ENSCPOP00000007039  ......................-CP.....TGHILVERHVngs..L................................
ENSCPOP00000006323  ......................DCF.....DGYHLDMARMt....C................................
ENSCPOP00000014192  ......................MCP.....EGKAGLL---.....C................................
ENSCPOP00000006380  ......................ACP.....TGFRKISSHA.....Caqsldkfllfarrmdirrisfdtedlsddvip
ENSCPOP00000005446  ......................---.....--FIPNDGTF.....C................................
ENSCPOP00000017174  ......................SCR.....PGYTGAN--C.....E................................
ENSCPOP00000009739  ......................-CR.....NGYYRADLDP.....-................................
ENSCPOP00000014075  ......................ECG.....VGRVLRSDGKt....C................................
ENSCPOP00000009997  ......................---.....----------.....-................................
ENSCPOP00000012721  ......................---.....----------.....-................................
ENSCPOP00000014166  ......................PCN.....PGFFKTSN--.....-................................
ENSCPOP00000000520  ......................TCP.....PSHTGPQ--C.....Q................................
ENSCPOP00000000520  ......................LCL.....QGWTGPL--C.....G................................
ENSCPOP00000020809  ......................QCS.....PGSFSADGF-.....-................................
ENSCPOP00000014227  ......................VCP.....SGFDFDETLGg....C................................
ENSCPOP00000010877  ......................---.....----------.....-................................
ENSCPOP00000008998  ......................HCPfdnl.SRTFYG----.....-................................
ENSCPOP00000013252  ......................PCG.....TGVH------.....-................................
ENSCPOP00000002774  ......................-CE.....EGYEKVE---.....-................................
ENSCPOP00000013057  ......................---.....----------.....-................................
ENSCPOP00000001828  ......................TCK.....PGYEPENS--.....-................................
ENSCPOP00000014166  ......................DC-.....----------.....-................................
ENSCPOP00000014227  ......................ECK.....PGYSLDGRGV.....C................................
ENSCPOP00000004446  ......................ACR.....PGFYKAADG-.....-................................
ENSCPOP00000012415  ......................RCD.....EDSQFSEEGSse...C................................
ENSCPOP00000009033  ......................VCA.....PGFFKASPH-.....-................................
ENSCPOP00000019082  ......................---.....----------.....-................................
ENSCPOP00000008922  ......................VCP.....VGFLMTETTVgvq..C................................
ENSCPOP00000008698  ......................PCP.....VGFYQEEAG-.....-................................
ENSCPOP00000000875  ......................ECR.....DGYHDNGMFSpggesC................................
ENSCPOP00000012415  ......................PCP.....PGHYIEKEA-.....-................................
ENSCPOP00000010587  ......................-CK.....EGYRASGQM-.....-................................
ENSCPOP00000006471  ......................HCP.....AGWRGNT--C.....H................................
ENSCPOP00000010723  ......................-CP.....SGLSPMKDSSg....C................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000009044  ..............................................................................
ENSCPOP00000012721  qglnnviaidfdyreefiywidssrpngsrinrmylngsdikvvhntavpnalavdwigknlywsdmekriievskvn
ENSCPOP00000019239  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  ..............................................................................
ENSCPOP00000001198  ..............................................................................
ENSCPOP00000000218  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  pglrntialdfhfnqsllywtdvvedriyrgklsesggvsaieivvehglatpegltvdwiagniywidsnldqieva
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003570  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000697  qqmgtvfaldhdpvenkmyfahtalkwieranmdgsqrerlieedvdipeglavdwigrrlywtdsgksviegsdlng
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  ..............................................................................
ENSCPOP00000011692  ..............................................................................
ENSCPOP00000008828  ..............................................................................
ENSCPOP00000017054  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000006144  nlknvvaldaevasnrlywsdvsqrkiystqidrtpgsahdtvisgdlqapdglavdwihgniywtdsvpgtvsvadt
ENSCPOP00000001400  vhsqnrglalgvdfhyqehkvfwtsfmenkvfsvdlnslriqeilnvsieapenmavdwvnnklyivetrikridmmn
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000002393  ..............................................................................
ENSCPOP00000017907  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  ..............................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000001400  lvengsyvialdfdsvsnrifwsdsvqgktwsafqngtdwriihesgvsiteaiavdwigrnlywidyaletievski
ENSCPOP00000013204  vppvidqrpalptsviplppgthllfaqtgkierlplegntmkkeeakaflhvpekiiiglaydcvdkmvywtditep
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013762  ..............................................................................
ENSCPOP00000004344  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000006612  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  ..............................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000010099  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000016303  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000013620  ..............................................................................
ENSCPOP00000003279  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000014968  qlvaptqyrislqfdffetegndvckydfvevrsgltadsklhgkfcgsekpevitsqynnmrvefksdntvskkgfk
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000017876  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000007253  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000015957  ..............................................................................
ENSCPOP00000004271  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000019055  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000001400  agqgrnalhvdvdvasgfiywcdfsssvtsynairrirpdgssftnivtsgiggngirgiavdwvagnlyftngfate
ENSCPOP00000007117  ..............................................................................
ENSCPOP00000016677  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000014168  kernglllyngrfnekhdfvaleviqeqvqltfsagestttvspfvpggvsdgqwhtvqlkyynkpllgqtglpqgps
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  ladvrsavaldwdsrddhvywtdvstdtisrakwdgtgqevvvdtslespaglaidwvtnklywtdagtdrievantd
ENSCPOP00000005446  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  ..............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000010877  ..............................................................................
ENSCPOP00000008998  ..............................................................................
ENSCPOP00000013252  ..............................................................................
ENSCPOP00000002774  ..............................................................................
ENSCPOP00000013057  ..............................................................................
ENSCPOP00000001828  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000004446  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000009033  ..............................................................................
ENSCPOP00000019082  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000006471  ..............................................................................
ENSCPOP00000010723  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000009044  ..............................................................................
ENSCPOP00000012721  glyptilvskrlkfprdlsldpragylywidcceyphigrvgmdgtnqsvvietkisrpmaltidyvnhrlywadenh
ENSCPOP00000019239  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  ..............................................................................
ENSCPOP00000001198  ..............................................................................
ENSCPOP00000000218  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  kldgslrttliagamehpraialdprfgilfwtdwdanfpriesasmsgagrktiykdmktgawpngltvdhfekriv
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003570  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000697  khrqiiikenisrprgiavhpmakrlfwtdvgmnpriesaslqgsgrlliagsdltepsgltidyltdtlywcdamrs
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  ..............................................................................
ENSCPOP00000011692  ..............................................................................
ENSCPOP00000008828  ..............................................................................
ENSCPOP00000017054  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000006144  rgvkrrtlfqkkgskpraivvdpvhgfmywtdwgtpariekgglngvdiyslvteniewpngitldlsssrlywvdsk
ENSCPOP00000001400  ldgshritliaenlghprgiavdptigylffsdwrslsgepklerafmdgsnrkdlvktklgwpagvtldlmakrvyw
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000002393  ..............................................................................
ENSCPOP00000017907  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  ..............................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000001400  dgshrmvlisknvtnprglaldprinehimfwsdwgrhprierasmdgtlrtviiqekiywpcgltidlpnrliyfmd
ENSCPOP00000013204  cigraslhggepailvqqglgspegiaidhlgrnmfwtdshldrievakldgtqrrvlfdtdlvnprsivtdpvrgnl
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013762  ..............................................................................
ENSCPOP00000004344  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000006612  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  ..............................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000010099  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000016303  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000013620  ..............................................................................
ENSCPOP00000003279  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000014968  ahff..........................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000017876  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000007253  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000015957  ..............................................................................
ENSCPOP00000004271  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000019055  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000001400  tlievlrinttyrrvllkvtvdmprhivvdpknrylfwadygqkpkiersfldctnrtilvsegivtprglavdhssg
ENSCPOP00000007117  ..............................................................................
ENSCPOP00000016677  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000014168  eqkvavvtvdgcdtgvalrfgavlgnyscaaqgtqggskksldltgplllggvpdlpenfpirmrhfvgcmrnlqvds
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  gsmrtvliwenldrprdivvepmggymywtdwgaspkieragmdasgrqviissnltwpnglaidygsqrlywadagm
ENSCPOP00000005446  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  ..............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000010877  ..............................................................................
ENSCPOP00000008998  ..............................................................................
ENSCPOP00000013252  ..............................................................................
ENSCPOP00000002774  ..............................................................................
ENSCPOP00000013057  ..............................................................................
ENSCPOP00000001828  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000004446  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000009033  ..............................................................................
ENSCPOP00000019082  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000006471  ..............................................................................
ENSCPOP00000010723  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000009044  ..............................................................................
ENSCPOP00000012721  iefsnmdgshrhkvpnqdipgvialtlfedyiywtdgktkslnrahktsgadrlslvsswhvitdvq...........
ENSCPOP00000019239  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  ..............................................................................
ENSCPOP00000001198  ..............................................................................
ENSCPOP00000000218  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  wtdarsdaiysalydgtnmieiirgheylshpfavslygsevywtdwrtntlskankwngqnvsviqktsaqpfdlqi
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003570  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000697  viemanldgsrrqrlgqgdvgrpfsvavfedhlwlsdwaapsvirvnkrtgqnrvrlrgsvlrpaslv..........
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  ..............................................................................
ENSCPOP00000011692  ..............................................................................
ENSCPOP00000008828  ..............................................................................
ENSCPOP00000017054  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000006144  lhsissidvngrdrktiledekrlahpfslaifedkifwtdimneaifsvnrltgldvhlvvenllspedivlfhnvt
ENSCPOP00000001400  vdsrfdcietvtydgiqrktvlhggsliphpfgislfeenvfytdwtkmavmkankfedthpqtyyqstlrpygvt..
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000002393  ..............................................................................
ENSCPOP00000017907  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  ..............................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000001400  ayldyldfcdyngqhrrqviagnlnvlhpyaltlfeesvfwtdratrqvmeankwhganqsvvmynvprplgivavhp
ENSCPOP00000013204  ywtdwnrdnpkietsymdgtnrrilaqdelvlpngltfdpfssqlcwvdagthraeclnpsqpsrrkvlpgleypfav
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013762  ..............................................................................
ENSCPOP00000004344  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000006612  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  ..............................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000010099  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000016303  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000013620  ..............................................................................
ENSCPOP00000003279  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000014968  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000017876  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000007253  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000015957  ..............................................................................
ENSCPOP00000004271  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000019055  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000001400  yiywvddsldiiarihrnggesevvrygshyptpfgitvfgnsiiwvdrnlkkifqaskepdntdaptvirdniywlr
ENSCPOP00000007117  ..............................................................................
ENSCPOP00000016677  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000014168  rrvdmadf......................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  ktiefagldgssrkvligsqlphpfgltlygeriywtdwqtksiqsadrltglgrktlqenlenlmdih.........
ENSCPOP00000005446  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  ..............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000010877  ..............................................................................
ENSCPOP00000008998  ..............................................................................
ENSCPOP00000013252  ..............................................................................
ENSCPOP00000002774  ..............................................................................
ENSCPOP00000013057  ..............................................................................
ENSCPOP00000001828  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000004446  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000009033  ..............................................................................
ENSCPOP00000019082  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000006471  ..............................................................................
ENSCPOP00000010723  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000009044  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000019239  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  ..............................................................................
ENSCPOP00000001198  ..............................................................................
ENSCPOP00000000218  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  yhpsrqpqacnkcssqkgdtkiyllcihnyslsthisclhasktsrdsttlfhkckyilyarrseirgvdidnpyfnf
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003570  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  ..............................................................................
ENSCPOP00000011692  ..............................................................................
ENSCPOP00000008828  ..............................................................................
ENSCPOP00000017054  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000006144  qp............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000002393  ..............................................................................
ENSCPOP00000017907  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  ..............................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000001400  akqp..........................................................................
ENSCPOP00000013204  tsfgknlyytdwkgnsvvaidltissvtdtfhphkqsrpygit...................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013762  ..............................................................................
ENSCPOP00000004344  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000006612  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  ..............................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000010099  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000016303  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000013620  ..............................................................................
ENSCPOP00000003279  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000014968  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000017876  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000007253  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000015957  ..............................................................................
ENSCPOP00000004271  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000019055  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000001400  dvtifdesvqprlpaevdnnpclennggcshfcfalpalntpkcgcafgtlqsdakscaistenflvytsesslrslh
ENSCPOP00000007117  ..............................................................................
ENSCPOP00000016677  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000014168  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  ..............................................................................
ENSCPOP00000005446  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  ..............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000010877  ..............................................................................
ENSCPOP00000008998  ..............................................................................
ENSCPOP00000013252  ..............................................................................
ENSCPOP00000002774  ..............................................................................
ENSCPOP00000013057  ..............................................................................
ENSCPOP00000001828  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000004446  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000009033  ..............................................................................
ENSCPOP00000019082  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000006471  ..............................................................................
ENSCPOP00000010723  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000009044  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000019239  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  ..............................................................................
ENSCPOP00000001198  ..............................................................................
ENSCPOP00000000218  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  itaftvpdiddvtvidfdaseerlywtdiktqtikrafingtgletvisrdiqsirglavdwvsrnlywissefdetq
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003570  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  ..............................................................................
ENSCPOP00000011692  ..............................................................................
ENSCPOP00000008828  ..............................................................................
ENSCPOP00000017054  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000006144  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000002393  ..............................................................................
ENSCPOP00000017907  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  ..............................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013762  ..............................................................................
ENSCPOP00000004344  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000006612  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  ..............................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000010099  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000016303  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000013620  ..............................................................................
ENSCPOP00000003279  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000014968  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000017876  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000007253  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000015957  ..............................................................................
ENSCPOP00000004271  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000019055  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000001400  fdledhnppfqaisverpaialdydtvdnrlyftqaldsgrgqisyislysrthtptvivsdigtsngiafdwinrri
ENSCPOP00000007117  ..............................................................................
ENSCPOP00000016677  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000014168  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  ..............................................................................
ENSCPOP00000005446  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  ..............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000010877  ..............................................................................
ENSCPOP00000008998  ..............................................................................
ENSCPOP00000013252  ..............................................................................
ENSCPOP00000002774  ..............................................................................
ENSCPOP00000013057  ..............................................................................
ENSCPOP00000001828  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000004446  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000009033  ..............................................................................
ENSCPOP00000019082  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000006471  ..............................................................................
ENSCPOP00000010723  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000009044  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000019239  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  ..............................................................................
ENSCPOP00000001198  ..............................................................................
ENSCPOP00000000218  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  invarldgslktsiihgidkpqclaahpvrgklywtdgntinmanmdgsnskilfqnqkepvglsidyvenklywiss
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003570  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  ..............................................................................
ENSCPOP00000011692  ..............................................................................
ENSCPOP00000008828  ..............................................................................
ENSCPOP00000017054  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000006144  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000002393  ..............................................................................
ENSCPOP00000017907  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  ..............................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013762  ..............................................................................
ENSCPOP00000004344  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000006612  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  ..............................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000010099  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000016303  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000013620  ..............................................................................
ENSCPOP00000003279  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000014968  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000017876  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000007253  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000015957  ..............................................................................
ENSCPOP00000004271  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000019055  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000001400  yysdyvnetinsiaedgsmrtvvariskprsivldpchgymywsnwdtpaqiekatlggnfrvpivntslvwpsgltl
ENSCPOP00000007117  ..............................................................................
ENSCPOP00000016677  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000014168  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  ..............................................................................
ENSCPOP00000005446  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  ..............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000010877  ..............................................................................
ENSCPOP00000008998  ..............................................................................
ENSCPOP00000013252  ..............................................................................
ENSCPOP00000002774  ..............................................................................
ENSCPOP00000013057  ..............................................................................
ENSCPOP00000001828  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000004446  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000009033  ..............................................................................
ENSCPOP00000019082  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000006471  ..............................................................................
ENSCPOP00000010723  ..............................................................................


                                                                                                    
                                                                                                    
d2dtge6               ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000009044  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000019239  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000007246  ..............................................................................
ENSCPOP00000001198  ..............................................................................
ENSCPOP00000000218  ..............................................................................
ENSCPOP00000013382  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000000034  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000011550  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000012721  gngtinrcnldggnleviesmkeeltkataltimdkklwwadqnlaqlgtcskrdgrnptilrnktsgvvhmk.....
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000004859  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000264  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000003570  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000007897  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000002772  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005210  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006040  ..............................................................................
ENSCPOP00000007782  ..............................................................................
ENSCPOP00000011692  ..............................................................................
ENSCPOP00000008828  ..............................................................................
ENSCPOP00000017054  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000000645  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000006144  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000010019  ..............................................................................
ENSCPOP00000002393  ..............................................................................
ENSCPOP00000017907  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016431  ..............................................................................
ENSCPOP00000005160  ..............................................................................
ENSCPOP00000005059  ..............................................................................
ENSCPOP00000014573  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000001400  ..............................................................................
ENSCPOP00000013204  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000003877  ..............................................................................
ENSCPOP00000013762  ..............................................................................
ENSCPOP00000004344  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000018258  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000011900  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000006876  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000006612  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000009088  ..............................................................................
ENSCPOP00000010393  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000019462  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000002335  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000010099  ..............................................................................
ENSCPOP00000013776  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000007568  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000016303  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000013620  ..............................................................................
ENSCPOP00000003279  ..............................................................................
ENSCPOP00000005471  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000014968  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000017876  ..............................................................................
ENSCPOP00000000697  ..............................................................................
ENSCPOP00000005525  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000010233  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000007253  ..............................................................................
ENSCPOP00000011665  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000009046  ..............................................................................
ENSCPOP00000007268  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000002433  ..............................................................................
ENSCPOP00000000646  ..............................................................................
ENSCPOP00000015957  ..............................................................................
ENSCPOP00000004271  ..............................................................................
ENSCPOP00000016148  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000019055  ..............................................................................
ENSCPOP00000005648  ..............................................................................
ENSCPOP00000001400  dydlnllywvdtslqkierisvtgmnreviissafrsfgltlygqyiywtnfftkkvyrankydgsgqiamtttlpvr
ENSCPOP00000007117  ..............................................................................
ENSCPOP00000016677  ..............................................................................
ENSCPOP00000001031  ..............................................................................
ENSCPOP00000014168  ..............................................................................
ENSCPOP00000012510  ..............................................................................
ENSCPOP00000006033  ..............................................................................
ENSCPOP00000007039  ..............................................................................
ENSCPOP00000006323  ..............................................................................
ENSCPOP00000014192  ..............................................................................
ENSCPOP00000006380  ..............................................................................
ENSCPOP00000005446  ..............................................................................
ENSCPOP00000017174  ..............................................................................
ENSCPOP00000009739  ..............................................................................
ENSCPOP00000014075  ..............................................................................
ENSCPOP00000009997  ..............................................................................
ENSCPOP00000012721  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000000520  ..............................................................................
ENSCPOP00000020809  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000010877  ..............................................................................
ENSCPOP00000008998  ..............................................................................
ENSCPOP00000013252  ..............................................................................
ENSCPOP00000002774  ..............................................................................
ENSCPOP00000013057  ..............................................................................
ENSCPOP00000001828  ..............................................................................
ENSCPOP00000014166  ..............................................................................
ENSCPOP00000014227  ..............................................................................
ENSCPOP00000004446  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000009033  ..............................................................................
ENSCPOP00000019082  ..............................................................................
ENSCPOP00000008922  ..............................................................................
ENSCPOP00000008698  ..............................................................................
ENSCPOP00000000875  ..............................................................................
ENSCPOP00000012415  ..............................................................................
ENSCPOP00000010587  ..............................................................................
ENSCPOP00000006471  ..............................................................................
ENSCPOP00000010723  ..............................................................................


                                     100                              110                           
                                       |                                |                           
d2dtge6               ......VN.........FSFCQD..LHHK.....................CK......NSRRQ...............
ENSCPOP00000005160  ......--.........-KHCLK..CHPS.....................CK......ECMDEpek............
ENSCPOP00000002433  ......--.........-GRCQA..CDAS.....................CA......KCRGPsqee...........
ENSCPOP00000002433  ......--.........-NLCRK..CSEN.....................CK......TCTEPhn.............
ENSCPOP00000011550  ......--.........-TRCKV..CHNS.....................CA......SCTGPsssh...........
ENSCPOP00000011550  ......--.........-GSCTE..CHPA.....................CR......QCHGPlesd...........
ENSCPOP00000011550  ......--.........-HKCTV..CPQG.....................CL......QCSSRdwchl..........
ENSCPOP00000000034  ......-Da........GRVCRL..CHPN.....................CTy.....GCTGP...............
ENSCPOP00000009044  ......--.........-SMCPP..SPLG.....................CE......LVKEPgcgc...........
ENSCPOP00000012721  ......V-.........---YHS..YRQPdgvvpkhl.............CM......INNGG...............
ENSCPOP00000019239  ......--.........-GCCLT..CALRegqa.................CG......VYTER...............
ENSCPOP00000011550  ......--.........-RACQP..CNPR.....................CR......SCVSHas.............
ENSCPOP00000013382  ......DV.........RNECRP..CHEN.....................--......-----...............
ENSCPOP00000005210  ......--.........-RHCLL..CHPE.....................CQpqngsvTCFGSeadq...........
ENSCPOP00000007246  ......--.........-GCCAT..CALGlgmp.................CG......VYTPR...............
ENSCPOP00000001198  ......ED.........VNECAT..GYHR.....................--......-----...............
ENSCPOP00000000218  ......--.........------..----.....................--......-----...............
ENSCPOP00000013382  ......LE.........PNPHTK..YQYG.....................-G......VCVAS...............
ENSCPOP00000014227  ......KD.........IDECSL..NPLL.....................--......-----...............
ENSCPOP00000020809  ......GD.........VDECSI..SNGH.....................--......-----...............
ENSCPOP00000000034  ......MD.........VNPEGK..YSFG.....................-A......TCVKK...............
ENSCPOP00000000646  ......ED.........INECAQ..NPLL.....................--......-----...............
ENSCPOP00000003877  ......ID.........VDECAT..G---.....................--......----Ngnl............
ENSCPOP00000002772  ......VA.........VDYCGS..EDHG.....................--......-----...............
ENSCPOP00000011550  ......--.........-SLCLA..CQPQ.....................CS......TCTNGle.............
ENSCPOP00000000646  ......TD.........VDECQT..----.....................--......--PGI...............
ENSCPOP00000008922  ......VD.........VNECRR..P---.....................--......----Qerrv...........
ENSCPOP00000005525  ......ED.........VNECET..----.....................--......---QR...............
ENSCPOP00000012721  ......VY.........DKEAQQ..GSNS.....................CH......LNNGG...............
ENSCPOP00000005471  ......QD.........VNECAT..----.....................--......--ENP...............
ENSCPOP00000000646  ......ED.........INECES..----.....................--......---NP...............
ENSCPOP00000002433  ......--.........-HTCLP..CPDN.....................CE......LCHHPhi.............
ENSCPOP00000014227  ......VD.........ADECGV..RNGG.....................--......-----...............
ENSCPOP00000009997  ......GD.........TNECSD..NNGG.....................--......-----...............
ENSCPOP00000014227  ......VD.........IDECRT..MA--.....................--......----Gqv.............
ENSCPOP00000009997  ......LD.........VDECLE..NNGG.....................--......-----...............
ENSCPOP00000003877  ......RD.........IDECLQ..----.....................--......---NGri.............
ENSCPOP00000013776  ......LD.........VDECAE..GNGG.....................--......-----...............
ENSCPOP00000000646  ......LD.........VDECSS..FF--.....................--......---GQv..............
ENSCPOP00000020809  ......LD.........VDECQD..NNGG.....................--......-----...............
ENSCPOP00000010019  ......ED.........VDECAS..GRSG.....................--......-----...............
ENSCPOP00000003877  ......AD.........LDECSE..NLNL.....................--......-----...............
ENSCPOP00000004859  ......VH.........RDFCAN..IPNA.....................--......--ESS...............
ENSCPOP00000007268  ......VD.........VNECDM..----.....................--......---GAp..............
ENSCPOP00000000646  ......ID.........NNECGS..QPSL.....................--......-----...............
ENSCPOP00000000264  ......PD.........INKCTK..CKAD.....................CD......TCFNKnf.............
ENSCPOP00000001031  ......QD.........VDECAA..----.....................--......--ADP...............
ENSCPOP00000003877  ......ED.........IDECES..----.....................--......---SP...............
ENSCPOP00000003877  ......ID.........NNECTS..DINL.....................--......-----...............
ENSCPOP00000003570  ......--.........--EC--..----.....................--......-----...............
ENSCPOP00000003877  ......MD.........IDECQR..DPLL.....................--......-----...............
ENSCPOP00000013776  ......GD.........VDECSI..NRGG.....................--......-----...............
ENSCPOP00000003877  ......VD.........VNECDL..NPNI.....................--......-----...............
ENSCPOP00000006876  ......QD.........VNECQE..----.....................--......--FSP...............
ENSCPOP00000007897  ......ED.........VNECLS..----.....................--......---SP...............
ENSCPOP00000000646  ......SD.........VDECAE..NINL.....................--......-----...............
ENSCPOP00000002772  ......SR.........ADYCLL..SDHG.....................--......-----...............
ENSCPOP00000000646  ......MD.........IDECER..NPLL.....................--......-----...............
ENSCPOP00000000697  ......VV.........HPLAKP..GTDP.....................CL......HQNGG...............
ENSCPOP00000005210  ......--.........-FESVS..NPEGrytf.................GA......SCVTT...............
ENSCPOP00000006323  ......ED.........INECEQ..----.....................--......--PGL...............
ENSCPOP00000006040  ......LD.........VDECET..VV--.....................--......-----...............
ENSCPOP00000007782  ......YStendvetirASVCAP..CHPS.....................CA......TCQGPaptd...........
ENSCPOP00000011692  ......VN.........FSFCQD..LHNK.....................CK......NSRRQ...............
ENSCPOP00000008828  ......-E.........INRCKK..CGTT.....................CD......SCFSQdf.............
ENSCPOP00000017054  ......--.........------..----.....................--......-----...............
ENSCPOP00000010587  ......TE.........VDECQS..----.....................--......---SP...............
ENSCPOP00000000645  ......RD.........VDECSK..KPNV.....................--......-----...............
ENSCPOP00000013204  ......YD.........IDECSE..QPSV.....................--......-----...............
ENSCPOP00000014227  ......TD.........VNECAD..----.....................--......----Pvn.............
ENSCPOP00000006144  ......KG.........VNWCES..TALP.....................NG......GCQYL...............
ENSCPOP00000001400  ......VY.........HALRQP..NVSNp....................CG......DHNGG...............
ENSCPOP00000010019  ......ED.........VDECAP..GLAR.....................--......-----...............
ENSCPOP00000002393  ......PD.........MNRCAR..CRIEn....................CD......SCFSKdf.............
ENSCPOP00000017907  ......--.........-PECAR..AEGEp....................CG......---GAgagrgh.........
ENSCPOP00000000646  ......LD.........VNECDL..NSNI.....................--......-----...............
ENSCPOP00000014227  ......KD.........VDECDE..----.....................--......---PHr..............
ENSCPOP00000016431  ......TD.........IDECSL..AEKV.....................--......-----...............
ENSCPOP00000005160  ......FP.........HKVCRR..CEDN.....................CL......SCEGSsrn............
ENSCPOP00000005059  ......--.........------..----.....................--......-----...............
ENSCPOP00000014573  ......LD.........IDYCEP..----.....................--......---NP...............
ENSCPOP00000001031  ......ED.........LDECTF..----.....................--......--PGV...............
ENSCPOP00000001400  ......RS.........PNPCAS..----.....................--......----Vp..............
ENSCPOP00000013204  ......TT.........LAQCPQ..GHNY.....................CS......VNNGG...............
ENSCPOP00000014227  ......SD.........VDECEL..GGHN.....................--......-----...............
ENSCPOP00000016148  ......LD.........VDECAS..----.....................--......---SP...............
ENSCPOP00000016148  ......AD.........INECRPgaCHAA.....................--......----H...............
ENSCPOP00000003877  ......QD.........INECGS..SQAP.....................--......-----...............
ENSCPOP00000013762  ......--.........-----P..CRPGe....................CA......TPRGClagrvrda.......
ENSCPOP00000004344  ......--.........-GCCKI..CAKQ.....................--......--SGDi..............
ENSCPOP00000014192  ......VD.........IDECAS..----.....................--......---NP...............
ENSCPOP00000009997  ......KD.........IDECQT..RNGG.....................--......-----...............
ENSCPOP00000014192  ......IE.........INECQS..----.....................--......---NP...............
ENSCPOP00000014227  ......TD.........EDECHT..QPSI.....................--......-----...............
ENSCPOP00000018258  ......--.........------..----.....................--......-----...............
ENSCPOP00000016148  ......VE.........INECAS..----.....................--......---SP...............
ENSCPOP00000011900  ......VD.........LDECRV..----.....................--......--RSL...............
ENSCPOP00000006323  ......QD.........IDECQQ..----.....................--......---GNl..............
ENSCPOP00000006876  ......MD.........INECEQ..VPKP.....................--......-----...............
ENSCPOP00000001031  ......ID.........IDECAN..----.....................--......---DTv..............
ENSCPOP00000006612  ......QD.........IDECAD..----.....................--......---KEa..............
ENSCPOP00000000646  ......HD.........VNECSS..SKNP.....................--......-----...............
ENSCPOP00000011665  ......GD.........VNECLS..----.....................--......---NP...............
ENSCPOP00000009088  ......--.........------..----.....................--......-----...............
ENSCPOP00000010393  ......DL.........VDFCAL..----.....................--......---SP...............
ENSCPOP00000007568  ......VA.........VDFCEP..----.....................--......---SP...............
ENSCPOP00000014192  ......VD.........IDECVS..----.....................--......---KP...............
ENSCPOP00000011665  ......ED.........INECAS..----.....................--......---SP...............
ENSCPOP00000019462  ......--.........------..----.....................--......-----...............
ENSCPOP00000017174  ......--.........------..CSAP.....................VR......RCEHAp..............
ENSCPOP00000005525  ......VD.........INECTS..LPEP.....................--......-----...............
ENSCPOP00000011665  ......SE.........VNECSS..----.....................--......---NP...............
ENSCPOP00000002335  ......SD.........INECDA..----.....................--......--SNK...............
ENSCPOP00000014192  ......--.........------..CEEN.....................ID......DCAGGph.............
ENSCPOP00000010099  ......DQ.........DRECHP..CHPN.....................CTq.....GCNGP...............
ENSCPOP00000013776  ......--.........-RPCQP..CPRGtyqpeagrtl...........CF......PCGGGlttkhegalsfqdcd
ENSCPOP00000016148  ......VD.........IDECQS..----.....................--......---SP...............
ENSCPOP00000007568  ......IN.........IDECQS..----.....................--......---SP...............
ENSCPOP00000006323  ......ED.........IDECLT..----.....................--......--PST...............
ENSCPOP00000005525  ......KD.........LDECAL..GTHN.....................--......-----...............
ENSCPOP00000016303  ......--.........-GCCRV..CAKQ.....................--......--LGEl..............
ENSCPOP00000010587  ......--.........-ETCES..CPLGtyqpefgsrs...........CL......LCPEP...............
ENSCPOP00000013620  ......ID.........VDECAE..----.....................--......---PGlnh............
ENSCPOP00000003279  ......RD.........INECLP..----.....................--......---SP...............
ENSCPOP00000005471  ......VD.........VDECAT..DSHQ.....................--......-----...............
ENSCPOP00000007268  ......VD.........VDECAQ..ALHD.....................--......-----...............
ENSCPOP00000014968  ......SD.........KDECSK..DNGG.....................--......-----...............
ENSCPOP00000000520  ......ED.........VDECVS..----.....................--......---SP...............
ENSCPOP00000017876  ......VT.........AESCAN..LRSV.....................--......---PG...............
ENSCPOP00000000697  ......LD.........VDECQL..EVHS.....................--......-----...............
ENSCPOP00000005525  ......VD.........INECVT..DLHT.....................--......-----...............
ENSCPOP00000000875  ......TE.........HDECAT..NQHS.....................--......-----...............
ENSCPOP00000000520  ......QD.........LDECQI..AQQG.....................--......--PSP...............
ENSCPOP00000010233  ......MS.........SDACAS..----.....................--......---GP...............
ENSCPOP00000001031  ......VD.........VNECLT..----.....................--......--PGV...............
ENSCPOP00000007253  ......DD.........CGCCQV..CAAGlget.................CY......RTVSGmdgmk..........
ENSCPOP00000011665  ......--.........-NLVRW..CDS-.....................--......---SP...............
ENSCPOP00000000646  ......ED.........IDECSI..IPGI.....................--......-----...............
ENSCPOP00000005648  ......TN.........VDECSS..----.....................--......---DP...............
ENSCPOP00000014192  ......--.........---CDV..PNVS.....................CDva....A--LNkgvlaknl.......
ENSCPOP00000009046  ......LE.........VLECAS..----.....................--......---AP...............
ENSCPOP00000007268  ......QD.........IDECES..GAHQ.....................--......-----...............
ENSCPOP00000006033  ......AS.........TLTCSM..----.....................--......---AN...............
ENSCPOP00000002433  ......--.........-HRCKP..CHRR.....................CF......HCTGPaedq...........
ENSCPOP00000000646  ......ID.........VDECTS..----.....................--......---NP...............
ENSCPOP00000015957  ......VD.........IDECQI..----.....................--......--AGV...............
ENSCPOP00000004271  ......TV.........RNKCAL..GTHG.....................--......-----...............
ENSCPOP00000016148  ......ED.........VDECQL..QPNA.....................--......-----...............
ENSCPOP00000012510  ......VD.........INECVV..SIHA.....................--......-----...............
ENSCPOP00000019055  ......--.........-HRCPP..CRDGha...................CN......HVTGK...............
ENSCPOP00000005648  ......--.........-DSCAS..----.....................--......---GP...............
ENSCPOP00000001400  pkdicvAR.........KDQNQH..CTNP.....................CD......QINGG...............
ENSCPOP00000007117  ......KD.........IDECTY..----.....................--......----S...............
ENSCPOP00000016677  ......VD.........VDECQD..----.....................--......---AP...............
ENSCPOP00000001031  ......VD.........VNECDD..LNG-.....................--......----Paal............
ENSCPOP00000014168  ......IA.........NNGTMPg.CPTK.....................KN......VCDSNt..............
ENSCPOP00000012510  ......AN.........SRTCAK..----.....................--......---TN...............
ENSCPOP00000006033  ......TD.........IDECAL..GQHQ.....................--......-----...............
ENSCPOP00000007039  ......LS.........QAKCEL..CDGN.....................ET......SFTTAnalgnv.........
ENSCPOP00000006323  ......VD.........VNECDE..LNNR.....................--......--MSL...............
ENSCPOP00000014192  ......HL.........DDACIS..----.....................--......---NP...............
ENSCPOP00000006380  ......VF.........HRRRPP..VTTP.....................CA......AENGG...............
ENSCPOP00000005446  ......TD.........VDECEV..----.....................--......--SGL...............
ENSCPOP00000017174  ......LE.........TDECAP..----.....................--......---SP...............
ENSCPOP00000009739  ......--.........------..----.....................--......-----...............
ENSCPOP00000014075  ......ED.........IKGCHN..NNGG.....................--......-----...............
ENSCPOP00000009997  ......--.........------..----.....................--......-----...............
ENSCPOP00000012721  ......--.........------..----.....................--......-----...............
ENSCPOP00000014166  ......--.........-STCEP..CPY-.....................--......-----...............
ENSCPOP00000000520  ......TS.........ADHCAS..----.....................--......---AP...............
ENSCPOP00000000520  ......IP.........LSACQK..AALS.....................Q-......----Gvevsal.........
ENSCPOP00000020809  ......--.........-RPCQA..CALG.....................--......-----...............
ENSCPOP00000014227  ......QD.........VDECAG..QGSP.....................--......-----...............
ENSCPOP00000010877  ......--.........------..----.....................--......-----...............
ENSCPOP00000008998  ......--.........GQDCSD..ILLG.....................CThr....QCLNNgi.............
ENSCPOP00000013252  ......--.........------..----.....................--......-----...............
ENSCPOP00000002774  ......--.........-DTCQA..CSPG.....................FF......KSQASesp............
ENSCPOP00000013057  ......--.........------..----.....................--......-----...............
ENSCPOP00000001828  ......--.........-VACKA..CPAG.....................TF......KASQEaeg............
ENSCPOP00000014166  ......--.........------..----.....................--......-----...............
ENSCPOP00000014227  ......IV.........VGECTS..SSPQrpwycqghqgcpatlarlatrC-......--APPltarllppdvdecvg
ENSCPOP00000004446  ......--.........NMKCAK..----.....................--......-----...............
ENSCPOP00000012415  ......TE.........RPPCTT..KDYFqihtacdqegktqimykwie.PK......ICREDltdairlppsgekkd
ENSCPOP00000009033  ......--.........SQTCSK..----.....................--......-----...............
ENSCPOP00000019082  ......--.........------..----.....................--......-----...............
ENSCPOP00000008922  ......TD.........IDECLS..----.....................--......---AS...............
ENSCPOP00000008698  ......--.........SVACVP..CPAGrttaa................I-......-----...............
ENSCPOP00000000875  ......ED.........IDECGT..GRHS.....................--......-----...............
ENSCPOP00000012415  ......--.........-NQCQE..CPPD.....................TR......LST--...............
ENSCPOP00000010587  ......--.........---CEV..VHCP.....................AL......KPPENgy.............
ENSCPOP00000006471  ......TD.........VDECSS..GGAD.....................--......-----...............
ENSCPOP00000010723  ......YD.........RHIGVD..CSDG.....................--......--FNGg..............


                            120                                130              140                 
                              |                                  |                |                 
d2dtge6               .....GCHQ....YVIHNN......KC...............IPE.....CP..SGYTMNSSN..........LLCTP
ENSCPOP00000005160  .....CTMCkeg.FSLARG......SC...............IPD.....CE..PGTYFDSEL..........IQCME
ENSCPOP00000002433  .....CTSCfrt.RVLDDG......HC...............VLN.....CP..SWKFE--FQ..........NRCHP
ENSCPOP00000002433  .....CTECrdg.LSLQGA......RC...............SVT.....CE..DGWYF--NG..........QDCQP
ENSCPOP00000011550  .....CTACahp.KVLQQG......YC...............LSS.....CG..EGFYA--DH..........GVCTA
ENSCPOP00000011550  .....CTSChph.VALTSG......NC...............KTS.....CK..AEKFLN-LA..........GYCID
ENSCPOP00000011550  .....CDQG....FFLRNG......LC...............VAR.....CV..LGFSAHSSN..........ETC--
ENSCPOP00000000034  .....GLQG....------......--...............---.....--..---------..........-----
ENSCPOP00000009044  .....CMTCala.EGQTCG......VY...............TER.....CA..LG-------..........-----
ENSCPOP00000012721  .....CSHL....CLLAPGk.....TH...............TCA.....CP..TNFYLAADN..........RTCLS
ENSCPOP00000019239  .....CGSGlr..CQP---......--...............---.....--..---------..........-----
ENSCPOP00000011550  .....CTSCrdphKVLLFG......EC...............QYEn....CA..PQYYLNVST..........NTCRE
ENSCPOP00000013382  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000005210  .....CVACa...HYKDPP......LC...............VAR.....CP..SGVKLDLSYmpiwkfpdeeGTCQP
ENSCPOP00000007246  .....CGSG....------......--...............---.....--..---------..........-----
ENSCPOP00000001198  .....CGPNsv..CINLPG......SY...............RCE.....CR..SGYEFVEDQ..........RMCVL
ENSCPOP00000000218  .....-GCCpv..CALPLGa.....SCgva............TAR.....CA..QG-------..........-----
ENSCPOP00000013382  .....CPHN....FVVDQT......SC...............VRA.....CP..PDKMEVNKNgi........NMCEP
ENSCPOP00000014227  .....CAFR....CRNTEG......SY...............LCT.....CP..AGYALREDG..........ATCRD
ENSCPOP00000020809  .....CDQG....CVNTKG......SY...............ECV.....CP..PGRRLHWNR..........KDCVE
ENSCPOP00000000034  .....CPRN....YVVTDHg.....SC...............VRA.....CS..SDSYEIEEDgv........RKCKK
ENSCPOP00000000646  .....CAFR....CMNTFG......SY...............ECT.....CP..MGYALREDQ..........KMCKD
ENSCPOP00000003877  .....CRNGq...CINTVG......SF...............QCQ.....CN..EGYEVAPDG..........RTCVD
ENSCPOP00000002772  .....CEHM....CVNADG......SY...............LCK.....CR..EGFALNPDK..........KTCTK
ENSCPOP00000011550  .....CSSCrpp.LLMQQG......QC...............VTT.....CG..DGFYQ--DR..........NSCAA
ENSCPOP00000000646  .....CMNGh...CINNEG......SF...............RCD.....CP..PGLAVGVDG..........RVCV-
ENSCPOP00000008922  .....CHHS....CHNTVG......SF...............LCT.....CR..PGFRLRADR..........TSCE-
ENSCPOP00000005525  .....CSQE....CANIYG......SY...............QCY.....CR..QGYQLAEDG..........HTCTD
ENSCPOP00000012721  .....CSQL....CLPTSEn.....TR...............TCM.....CT..VGYYLQKNR..........MSCQ-
ENSCPOP00000005471  .....CVQT....CVNTYG......SF...............ICR.....CD..PGYELEDDG..........VHCSD
ENSCPOP00000000646  .....CVNGa...CRNNLG......SF...............NCE.....CS..PGSKLSSTG..........LICID
ENSCPOP00000002433  .....CTRCvsg.YVLGPT......NS...............TCEkle..CG..QGEVQDSDY..........EECLP
ENSCPOP00000014227  .....CAVH....CVNTEG......SF...............RCG.....CG..QGYALLPDG..........RACA-
ENSCPOP00000009997  .....CQQV....CVNTVG......DY...............ECQ.....CH..PGYKLHWNK..........KDCV-
ENSCPOP00000014227  .....CPMGq...CLNTAG......SF...............HCL.....CQ..GGFELAPDG..........KNCV-
ENSCPOP00000009997  .....CQHT....CVNAMG......SY...............ECR.....CK..EGFFLSDNQ..........HTCIH
ENSCPOP00000003877  .....CNNGr...CINTDG......SF...............HCV.....CN..AGFHVTRDG..........KNCED
ENSCPOP00000013776  .....CQQS....CVNMMG......SY...............ECH.....CR..EGFFLSDNQ..........HTCIQ
ENSCPOP00000000646  .....CRNGr...CFNEIG......SF...............KCL.....CN..EGYELTPDG..........KNCIE
ENSCPOP00000020809  .....CQQI....CVNAMG......SY...............ECQ.....CH..SGFFLSDNQ..........HTCIH
ENSCPOP00000010019  .....CEHR....CTNLAG......SF...............QCS.....CE..AGYRLDEDR..........RGCT-
ENSCPOP00000003877  .....CGNGq...CLNAPG......GY...............RCE.....CD..MGFVPSADG..........KACED
ENSCPOP00000004859  .....DSEG....FVIHDG......EC...............MQE.....CP..SGFIRNGSQs.........MYCIP
ENSCPOP00000007268  .....CEQR....CFNSYG......TF...............LCR.....CN..QGYELHRDG..........FSCS-
ENSCPOP00000000646  .....CGAKgi..CQNTPG......SF...............SCE.....CQ..RGFSLDATG..........LNCED
ENSCPOP00000000264  .....CTKCksg.FYLHLG......KC...............LDN.....CP..EGLEANNHT..........MECIS
ENSCPOP00000001031  .....CLGGh...CVNTEG......SF...............NCL.....CE..AGFRPSPES..........GQCVD
ENSCPOP00000003877  .....CINGv...CRNSPG......SF...............ICE.....CS..PESTLDPTK..........TICI-
ENSCPOP00000003877  .....CGSKgi..CQNTPG......SF...............TCE.....CQ..RGFSLDQSG..........ASCED
ENSCPOP00000003570  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000003877  .....CRGGt...CFNTDG......SY...............RCE.....CP..PGHQLSPNI..........SAC--
ENSCPOP00000013776  .....CRFG....CVNTPG......SY...............QCT.....CP..AGQGRLHWNg.........KDC--
ENSCPOP00000003877  .....CLSGt...CENTKG......SF...............ICH.....CD..MGYSGKKGK..........TGC--
ENSCPOP00000006876  .....CHQH....CFNVIG......SF...............HCG.....CE..PGYQL--KG..........RKCMD
ENSCPOP00000007897  .....CSQE....CANVYG......SY...............QCY.....CR..RGYQLSDLDg.........VTCE-
ENSCPOP00000000646  .....CENGq...CLNVPG......AY...............RCE.....CE..MGFTPAPDS..........RSCQD
ENSCPOP00000002772  .....CEYA....CVNTDR......SF...............ACQ.....CP..EGHVLRSDG..........KTCA-
ENSCPOP00000000646  .....CRGGt...CVNTEG......SF...............QCD.....CP..LGHELSPSR..........EDCV-
ENSCPOP00000000697  .....CEHV....CQERLG......TA...............QCS.....CH..EGFRSSADG..........KGCL-
ENSCPOP00000005210  .....CPYNy...LSTDVG......SC...............TLV.....CP..PNNQEVMKDgt........QRCEK
ENSCPOP00000006323  .....CGPHge..CLNTDG......SF...............HCV.....CE..QGFSISADG..........RTCED
ENSCPOP00000006040  .....CPGEnek.CQNTEG......SY...............RCV.....CA..EGYKQ--VE..........GICV-
ENSCPOP00000007782  .....CL--....------......--...............--S.....CP..SHASLDPVE..........QTC--
ENSCPOP00000011692  .....GCHQ....YVIHND......RC...............IPE.....CP..SGYTMNSSN..........LMCTP
ENSCPOP00000008828  .....CIRCkrr.FFLHKG......KC...............LRT.....CP..PGTLTQQNT..........RECQE
ENSCPOP00000017054  .....CAQGmr..CYPKPG......--...............---.....--..---------..........-----
ENSCPOP00000010587  .....CFNNaa..CEDQVG......GF...............LCK.....CP..PGY----LG..........TRCEI
ENSCPOP00000000645  .....CGKAv...CKNTPG......DY...............ICE.....CP..EGYRYEPKS..........GICTD
ENSCPOP00000013204  .....CGSQai..CNNLPG......TF...............RCE.....CS..EGYRFS-DQ..........GKCVA
ENSCPOP00000014227  .....CINGl...CVNTPG......SY...............LCR.....CP..RDFELNPSG..........VGCVD
ENSCPOP00000006144  .....CLPApq..INPHSP......KF...............TCA.....CP..DGMVLAQDM..........RSC--
ENSCPOP00000001400  .....CEQV....CVLSHRtdngglGY...............RCK.....CS..FGFELDADE..........HHC--
ENSCPOP00000010019  .....CAHG....CLNTQG......SF...............KCV.....CR..AGYELGADG..........RQCY-
ENSCPOP00000002393  .....CTKCkvg.FYLHRG......RC...............FEE.....CP..DGFAPSDDS..........MDCVE
ENSCPOP00000017907  .....CAQGme..CVKSRK......RRkgkagaaaggagvsgVCV.....CK..NRY------..........-----
ENSCPOP00000000646  .....CMFGe...CENTKG......SF...............ICH.....CQ..LGYSVKKGT..........TGCTD
ENSCPOP00000014227  .....CRHG....CQNEVG......GY...............RCS.....CP..QGFTQHSQW..........AQCVD
ENSCPOP00000016431  .....CTRKnen.CYNTLG......SF...............VCV.....CP..DGFEE--TE..........DACV-
ENSCPOP00000005160  .....CSKCkag.FMQLGT......SC...............I--.....--..-------SN..........LTC--
ENSCPOP00000005059  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000014573  .....CQNGaq..CYNRAS......DY...............FCK.....CP..QDY----EG..........KNCSH
ENSCPOP00000001031  .....CPAGv...CTNTVG......SF...............SCKd....CE..EGYRPSPLG..........RTCED
ENSCPOP00000001400  .....CSHL....CLLSSQgpr...FY...............SCA.....CP..SGWNLSHDS..........MSC--
ENSCPOP00000013204  .....CTHL....CLATPG......SR...............TCR.....CP..DNT----LG..........VDC--
ENSCPOP00000014227  .....CDGHas..CLNVPG......SY...............RCA.....CQ..QGFTG--DG..........FSCE-
ENSCPOP00000016148  .....CGPGt...CTDHVA......SF...............ACS.....CP..PGY----GG..........LHCEK
ENSCPOP00000016148  .....TQDC....LQEPGG......HF...............RCL.....CH..AGF----TG..........PRCQT
ENSCPOP00000003877  .....CSYG....CSNTEG......GY...............LCG.....CP..PGYFRI-GQ..........GHCV-
ENSCPOP00000013762  .....CGCCwe..CANLEG......QL...............CDL.....DP..SA-------..........-----
ENSCPOP00000004344  .....CNEAel..CDPHKG......LY...............CD-.....--..---------..........-----
ENSCPOP00000014192  .....CRKGat..CINDVN......GF...............RCI.....CP..EGP----HH..........PSCYS
ENSCPOP00000009997  .....CDHF....CKNTVG......SF...............DCS.....CK..KGFKLLTDE..........KSCQD
ENSCPOP00000014192  .....CVNNgq..CVDKVN......RF...............QCL.....CP..PGF----TG..........PVCQI
ENSCPOP00000014227  .....CTHGh...CVNTVG......SF...............RCD.....CH..KGFQPSPTL..........TECLD
ENSCPOP00000018258  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000016148  .....CGEGgs..CLDVEN......GF...............RCL.....CP..PGS----LP..........PLCLP
ENSCPOP00000011900  .....CQHA....CQNTEG......SY...............HCL.....CP..AGYRLLPSG..........KNCQD
ENSCPOP00000006323  .....CINGq...CKNTEG......SF...............RCT.....CG..QGYQLSAAK..........DQCED
ENSCPOP00000006876  .....CAHQ....CSNTPG......SF...............KCV.....CP..PGQHLLGDG..........KSC--
ENSCPOP00000001031  .....CGSHgf..CDNTDG......SF...............RCL.....CD..QGFETSPSG..........WDCI-
ENSCPOP00000006612  .....CGDAr...CQNLPG......SY...............TCL.....CD..EGFEYSTQD..........KACR-
ENSCPOP00000000646  .....CNYG....CSNTEG......GY...............LCG.....CP..PGYYRV-GQ..........GHCV-
ENSCPOP00000011665  .....CDARgtqnCVQRVN......DF...............HCE.....CR..AGH----TG..........RRCES
ENSCPOP00000009088  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000010393  .....CAHGt...CRSVGT......SY...............KCL.....CD..PGY----HG..........LYCEE
ENSCPOP00000007568  .....CLNGas..CYNLEG......DY...............YCA.....CP..EDF----SG..........KNCSV
ENSCPOP00000014192  .....CMNHgl..CHNTQG......SY...............MCE.....CP..PGF----SG..........MDCEE
ENSCPOP00000011665  .....CRNGan..CTDCVD......SY...............TCT.....CP..AGF----NG..........IHCEN
ENSCPOP00000019462  .....----....--PHRG......LY...............C--.....--..---------..........-----
ENSCPOP00000017174  .....CHNGat..CHERGL......RY...............ACE.....CA..RGY----GG..........PNCQ-
ENSCPOP00000005525  .....CRSGfs..CVNTVG......SY...............RCQrdplmCR..HGYHANEDG..........TQCVD
ENSCPOP00000011665  .....CIHGs...CQDSLN......GY...............WCD.....CD..SGW----SG..........TNCDI
ENSCPOP00000002335  .....CAQQ....CYNILG......SF...............ICQ.....CN..QGYELSSDR..........LNCE-
ENSCPOP00000014192  .....CLNGgq..CVDRIG......GY...............SCR.....CL..PGF----AG..........ERCEG
ENSCPOP00000010099  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000013776  .tkvqC---....------......--...............---.....-S..PGHYYNTSI..........HRCIR
ENSCPOP00000016148  .....CVNGgv..CKDRVN......GF...............SCT.....CP..SGF----SG..........STCQL
ENSCPOP00000007568  .....CAYGat..CVDEID......GY...............RCS.....CP..PGR----TG..........PRCQD
ENSCPOP00000006323  .....CPDEq...CVNSPG......SY...............QCVp....CT..EGFRG--WN..........GQCL-
ENSCPOP00000005525  .....CSEAet..CHNLQG......SF...............RCLrfe..CP..PNYVRV-SE..........MKCER
ENSCPOP00000016303  .....CTQLhp..CDPHKG......L-...............--S.....CD..---------..........-----
ENSCPOP00000010587  .....TSTVkr..GAVDIS......AC...............GVP.....CP..IGEFSRTGL..........MPCYP
ENSCPOP00000013620  .....CHALat..CVNVDG......NY...............SCV.....CP..QGYVG--SG..........LQCEC
ENSCPOP00000003279  .....CKNGav..CQNFPG......GF...............NCV.....CK..TGY----TG..........KMCES
ENSCPOP00000005471  .....CNPTqi..CINTEG......GY...............TCS.....CT..DGYWL--LE..........GQCL-
ENSCPOP00000007268  .....CRPSqd..CHNLPG......SY...............QCT.....CP..DGYRK--IG..........PECVD
ENSCPOP00000014968  .....CQQD....CVNTFG......SY...............ECQ.....CR..SGFVLHDNK..........HDCKE
ENSCPOP00000000520  .....CTNGgh..CQDQPG......AF...............LCK.....CP..AGF----EG..........PRCET
ENSCPOP00000017876  .....RAST....FGIHQG......KC...............LAQ.....CP..PGFTRNGSS..........IFCHK
ENSCPOP00000000697  .....CGPGan..CINTEG......GY...............TCL.....CA..---------..........-----
ENSCPOP00000005525  .....CSRGeh..CVNTLG......SF...............RC-.....--..---------..........-----
ENSCPOP00000000875  .....CDENal..CFNTVG......GH...............NCV.....CK..PGYTG--NG..........TTCRA
ENSCPOP00000000520  .....CEHGgs..CLNTPG......SF...............HCL.....CP..PGY----TG..........LRCET
ENSCPOP00000010233  .....CFNGatcyTGLSPD......NF...............VCN.....CP..YGF----VG..........SRC--
ENSCPOP00000001031  .....CAHGr...CINLEG......SF...............RCS.....CE..QGYEVTSDK..........KGCQ-
ENSCPOP00000007253  .....CGPGlr..CQ----......--...............---.....--..---------..........-----
ENSCPOP00000011665  .....CKNGgq..CWQTST......LY...............RCE.....CH..SGW----TG..........LYCDV
ENSCPOP00000000646  .....CETGe...CSNTVG......SY...............FCV.....CP..RGYVTSTDG..........ARCID
ENSCPOP00000005648  .....CLNGga..CVDLVG......NY...............SCV.....CV..EPF----TG..........PRCE-
ENSCPOP00000014192  .....CKNSga..CINAGN......TH...............HCQ.....CP..LGY----TG..........SYCEQ
ENSCPOP00000009046  .....CAHNat..CLEGLG......SF...............RCL.....CW..PGF----SG..........EWCEV
ENSCPOP00000007268  .....CSEAqt..CVNFHG......GY...............RCMdtnr.CV..EPYVQV-SD..........NRC--
ENSCPOP00000006033  .....CQYG....CDVIKG......QV...............RCQ.....CPs.PGLRLAPDG..........RTCVD
ENSCPOP00000002433  .....CRSC....------......--...............---.....--..---------..........-----
ENSCPOP00000000646  .....CTNGd...CVNTPG......SY...............YCK.....CH..AGFQRTPTK..........QACID
ENSCPOP00000015957  .....CQQM....CVNYAG......GF...............ECY.....CS..EGLELQEDG..........SNCIP
ENSCPOP00000004271  .....CQHI....CVSDGAa.....SY...............HCD.....CF..PGYSLNEDK..........KTC--
ENSCPOP00000016148  .....CHNGgt..CFNTLG......SH...............SCV.....CV..NGW----TG..........ESCSQ
ENSCPOP00000012510  .....CSPHan..CLNTQG......SF...............KCK.....CK..QGYKG--SG..........FQCS-
ENSCPOP00000019055  .....CTRCn...AGWIGD......RC...............ETK.....CS..NGTYGEDCA..........FVCAD
ENSCPOP00000005648  .....CHNGgt..CFHYIG......KY...............KCD.....CP..PGF----SG..........RHCEI
ENSCPOP00000001400  .....CSHI....CVPGPN......GA...............ECV.....CPheGQWYLANDN..........KFCVV
ENSCPOP00000007117  .....CPPNas..CTNTLG......SF...............FCT.....CK..AGF------..........-----
ENSCPOP00000016677  .....CAQD....CVNTDG......SF...............RCE.....CW..VGYTAG---..........-----
ENSCPOP00000001031  .....CAHGh...CENTEG......SY...............RCH.....CS..PGFVAKPDP..........PHC--
ENSCPOP00000014168  .....CHNGgt..CVNQWD......SF...............SCE.....CP..LGF----GG..........KSCA-
ENSCPOP00000012510  .....CQYG....CEDTEE......GP...............RCL.....CPs.SGLRLASNG..........RVCLD
ENSCPOP00000006033  .....CSGFar..CYNVHG......SY...............VCK.....CV..EGYQG--DG..........LSCV-
ENSCPOP00000007039  .....CVRCept.FINATR......SC...............EC-.....--..---------..........-----
ENSCPOP00000006323  .....CKNAk...CINTEG......SY...............KCL.....CL..PGYVPSDKP..........NYCTP
ENSCPOP00000014192  .....CHKGalcdTNPLNG......HY...............ICT.....CP..QGY----KG..........ADCTE
ENSCPOP00000006380  .....CSHL....CLRSPNps....GF...............SCT.....CP..TGINLLPDG..........KTCSP
ENSCPOP00000005446  .....CRPGgr..CVNTHG......SF...............ECY.....CM..DGY------..........-----
ENSCPOP00000017174  .....CRNGgs..CTDLEN......SY...............TCT.....CP..PGF----YG..........RVCEL
ENSCPOP00000009739  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000014075  .....CSHS....CLGSEK......GY...............QCE.....CP..RGLVLADDN..........HTCQV
ENSCPOP00000009997  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000012721  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000014166  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000000520  .....CLHGgt..CVDRPS......TF...............SCV.....CA..AGF----QG..........LRCER
ENSCPOP00000000520  .....CQNGgl..CMDNGA......SH...............FCH.....CP..PGF----QG..........SWCQH
ENSCPOP00000020809  .....----....------......--...............---.....--..--TYQPEPGr.........TSCFP
ENSCPOP00000014227  .....CSYS....CANMEG......GF...............LCG.....CP..QGYFRA-GQ..........GHCV-
ENSCPOP00000010877  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000008998  .....CIPH....FHNGHH......GF...............SCL.....CP..SGF----TG..........SLCE-
ENSCPOP00000013252  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000002774  .....CLQCpahtLPSLQG......AT...............SCE.....CE..EGYFRAP--..........-----
ENSCPOP00000013057  .....----....------......--...............--Q.....CR..IGYYRT---..........-----
ENSCPOP00000001828  .....CSHCpsnsRSPSEA......SP...............ICT.....CR..TGYYRAD--..........-----
ENSCPOP00000014166  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000014227  ggsglCRLGr...CVNTEG......SF...............RCV.....CS..VGFELSPDG..........KSCV-
ENSCPOP00000004446  .....CPPHs...STNEEG......SM...............NCR.....CE..NNYFRA---..........-----
ENSCPOP00000012415  .....CPPCnpg.FHNNGS......SS...............CHP.....CP..PGTYSD-GT..........KECRP
ENSCPOP00000009033  .....CPPHs...YTHEEA......ST...............SCV.....CE..KDYFRRESD..........-----
ENSCPOP00000019082  .....----....------......--...............---.....--..---------..........-----
ENSCPOP00000008922  .....CEGR....CMNTEG......GF...............VCE.....CG..PGMQLAADR..........HSCQD
ENSCPOP00000008698  .....----....GAFSQR......HC...............VTD.....CQ..RNE----AG..........LQC--
ENSCPOP00000000875  .....CANDti..CFNLDG......GY...............DCR.....CP..HGK------..........-----
ENSCPOP00000012415  .....----....HQVYGK......EA...............CIP.....CG..PGSRSSQDH..........SVCYS
ENSCPOP00000010587  .....FIQNt...CNNHFNa.....AC...............GVR.....CH..PGFDLVGSSi.........LLCLP
ENSCPOP00000006471  .....CPQA....CVNTAG......SY...............RCQ.....CW..EGHSPSADG..........THC--
ENSCPOP00000010723  .....CEQL....CLQQMA......PFpddpalynilm....FCG.....CI..EDYKLGVDG..........RSCQP


                                  150                                                               
                                    |                                                               
d2dtge6               ............CLGPC---pkv.......................................................
ENSCPOP00000005160  ............CHSTCRTCvg........................................................
ENSCPOP00000002433  ............CHHTCRGCrg........................................................
ENSCPOP00000002433  ............CHRFCATCv.........................................................
ENSCPOP00000011550  ............CHATCQACvg........................................................
ENSCPOP00000011550  ............CHPLCQHCt.........................................................
ENSCPOP00000011550  ............--------..........................................................
ENSCPOP00000000034  ............--------c.........................................................
ENSCPOP00000009044  ............--------lrclprqgeekplhallhgrgvclnekny.............................
ENSCPOP00000012721  ...........nCTASQFRC..........................................................
ENSCPOP00000019239  ............--------qpdeprplhallhgrgfcanas....................................
ENSCPOP00000011550  ............CDWSC---..........................................................
ENSCPOP00000013382  ............----CT--qgckgpqlqdc...............................................
ENSCPOP00000005210  ............CPINCT--hscvdlddrgc...............................................
ENSCPOP00000007246  ............--------lrcypprgverplrtlmhgqgvcmep................................
ENSCPOP00000001198  .....iapppnpCEDGSHNC..........................................................
ENSCPOP00000000218  ............--------lscraqpgeprplqaltrgqgicvke................................
ENSCPOP00000013382  ............CGGLC---pkace.....................................................
ENSCPOP00000014227  .........vdeCADTSQDC..........................................................
ENSCPOP00000020809  ............--------tgec......................................................
ENSCPOP00000000034  ............CP------t.........................................................
ENSCPOP00000000646  .........ldeCAEGLHDC..........................................................
ENSCPOP00000003877  .........ineCLLDPKKC..........................................................
ENSCPOP00000002772  .........idfCASPTHGC..........................................................
ENSCPOP00000011550  ............CHVSCAGCsgpt......................................................
ENSCPOP00000000646  ............--------d.........................................................
ENSCPOP00000008922  ............--------a.........................................................
ENSCPOP00000005525  ............--------i.........................................................
ENSCPOP00000012721  ............--------..........................................................
ENSCPOP00000005471  .........mdeCSFSEFLC..........................................................
ENSCPOP00000000646  ............--------sl........................................................
ENSCPOP00000002433  ............CEEGC---l.........................................................
ENSCPOP00000014227  ............--------d.........................................................
ENSCPOP00000009997  ............--------..........................................................
ENSCPOP00000014227  ............--------d.........................................................
ENSCPOP00000009997  ............RSEEGLSC..........................................................
ENSCPOP00000003877  ............--------m.........................................................
ENSCPOP00000013776  ............RPEEGMNC..........................................................
ENSCPOP00000000646  ............DTNEC---..........................................................
ENSCPOP00000020809  ............RSNEGMNC..........................................................
ENSCPOP00000010019  ............--------s.........................................................
ENSCPOP00000003877  ............I-------dec.......................................................
ENSCPOP00000004859  ............CEGPC---..........................................................
ENSCPOP00000007268  ............--------d.........................................................
ENSCPOP00000000646  .........vdeCDG-----n.........................................................
ENSCPOP00000000264  ............--------ivh.......................................................
ENSCPOP00000001031  ............V-------dec.......................................................
ENSCPOP00000003877  ............--------e.........................................................
ENSCPOP00000003877  ............V-------dec.......................................................
ENSCPOP00000003570  ............--------s.........................................................
ENSCPOP00000003877  ............--------..........................................................
ENSCPOP00000013776  ............--------te........................................................
ENSCPOP00000003877  ............--------t.........................................................
ENSCPOP00000006876  ............--------vnecrq....................................................
ENSCPOP00000007897  ............--------di........................................................
ENSCPOP00000000646  ............I-------dec.......................................................
ENSCPOP00000002772  ............--------k.........................................................
ENSCPOP00000000646  ............--------d.........................................................
ENSCPOP00000000697  ............--------a.........................................................
ENSCPOP00000005210  ............CSKPCA--rvcy......................................................
ENSCPOP00000006323  .........ideCV------nn........................................................
ENSCPOP00000006040  ............--------k.........................................................
ENSCPOP00000007782  ............--------s.........................................................
ENSCPOP00000011692  ............CLGPC---..........................................................
ENSCPOP00000008828  ecklgpwgswgpC-------mhggktc...................................................
ENSCPOP00000017054  ............--------selplhalvhgegtcek.........................................
ENSCPOP00000010587  ............NIDEC---l.........................................................
ENSCPOP00000000645  ............--------i.........................................................
ENSCPOP00000013204  ............--------iveqrp....................................................
ENSCPOP00000014227  ............--------prags.....................................................
ENSCPOP00000006144  ............--------v.........................................................
ENSCPOP00000001400  ............--------r.........................................................
ENSCPOP00000010019  ............--------r.........................................................
ENSCPOP00000002393  ............--------gce.......................................................
ENSCPOP00000017907  ............--------pvcgsdg...................................................
ENSCPOP00000000646  .........vdeCEIGAHNC..........................................................
ENSCPOP00000014227  ............--------enkcav....................................................
ENSCPOP00000016431  ............--------p.........................................................
ENSCPOP00000005160  ............--------snadet....................................................
ENSCPOP00000005059  ............--------rppegqeeplrallmgrgrcrpa...................................
ENSCPOP00000014573  ............LKDH----c.........................................................
ENSCPOP00000001031  .........vdeCEDPHSSC..........................................................
ENSCPOP00000001400  ............--------..........................................................
ENSCPOP00000013204  ............--------v.........................................................
ENSCPOP00000014227  ............--------g.........................................................
ENSCPOP00000016148  ............DLPDC---..........................................................
ENSCPOP00000016148  ............ALSPC---..........................................................
ENSCPOP00000003877  ............--------..........................................................
ENSCPOP00000013762  ............--------hfygrcgeqlecrldvgdalsrgevpeprcacrtqrplcgsdg...............
ENSCPOP00000004344  ............--------ysadrpryetgvcayl..........................................
ENSCPOP00000014192  ............QVNEC---l.........................................................
ENSCPOP00000009997  ...vdecsldrtCDHSC---l.........................................................
ENSCPOP00000014192  ............DIDDC---..........................................................
ENSCPOP00000014227  ............--------vrqglc....................................................
ENSCPOP00000018258  ............--------pgdgpgsrrtmclfgeddggcevng.................................
ENSCPOP00000016148  ............PSHPC---..........................................................
ENSCPOP00000011900  .........ineCEEDAVECgpgqmcfntrggfqcvdtpcpe....................................
ENSCPOP00000006323  ............I-------dec.......................................................
ENSCPOP00000006876  ............--------..........................................................
ENSCPOP00000001031  ............--------d.........................................................
ENSCPOP00000006612  ............--------d.........................................................
ENSCPOP00000000646  ............--------..........................................................
ENSCPOP00000011665  ............VIDGC---k.........................................................
ENSCPOP00000009088  ............--------qsegrpceyn................................................
ENSCPOP00000010393  ............EYNEC---l.........................................................
ENSCPOP00000007568  ............--------prvpcp....................................................
ENSCPOP00000014192  ............DINDC---..........................................................
ENSCPOP00000011665  ............NTPDC---..........................................................
ENSCPOP00000019462  ............--------dysrdrpryaigvcaqvv........................................
ENSCPOP00000017174  ............--------f.........................................................
ENSCPOP00000005525  .........vneCATGVHRC..........................................................
ENSCPOP00000011665  ............NNNEC---..........................................................
ENSCPOP00000002335  ............--------d.........................................................
ENSCPOP00000014192  ............DINE----c.........................................................
ENSCPOP00000010099  ............--------tihdc.....................................................
ENSCPOP00000013776  ............CA------mgsyqpdfrqnfctrcpg........................................
ENSCPOP00000016148  ............DVDEC---..........................................................
ENSCPOP00000007568  ............--------v.........................................................
ENSCPOP00000006323  ............--------di........................................................
ENSCPOP00000005525  ..........ttCH------d.........................................................
ENSCPOP00000016303  ............--------fgsasnrnigvctaqggapcvfg...................................
ENSCPOP00000010587  ............CPQD----yy........................................................
ENSCPOP00000013620  ............TPGSC---..........................................................
ENSCPOP00000003279  ............SVNYC---..........................................................
ENSCPOP00000005471  ............--------d.........................................................
ENSCPOP00000007268  ............--------i.........................................................
ENSCPOP00000014968  ............--------agcd......................................................
ENSCPOP00000000520  ............EVDEC---l.........................................................
ENSCPOP00000017876  ............CEGLC---pkec......................................................
ENSCPOP00000000697  ............--------gsp.......................................................
ENSCPOP00000005525  ............--------y.........................................................
ENSCPOP00000000875  ...........fCKDGCR--n.........................................................
ENSCPOP00000000520  ............DHNEC---l.........................................................
ENSCPOP00000010233  ............--------e.........................................................
ENSCPOP00000001031  ............--------d.........................................................
ENSCPOP00000007253  ............--------fyseeddfgdefgickd.........................................
ENSCPOP00000011665  ............PSVSC---k.........................................................
ENSCPOP00000000646  ............--------qrtgtc....................................................
ENSCPOP00000005648  ............--------t.........................................................
ENSCPOP00000014192  ............QLDEC---..........................................................
ENSCPOP00000009046  ............DEDEC---asspc.....................................................
ENSCPOP00000007268  ............--------lc........................................................
ENSCPOP00000006033  .........vdeCATGRVSC..........................................................
ENSCPOP00000002433  ............--------..........................................................
ENSCPOP00000000646  .........ideCIQNGVLC..........................................................
ENSCPOP00000015957  ............--------..........................................................
ENSCPOP00000004271  ............--------a.........................................................
ENSCPOP00000016148  ............NIDDC---a.........................................................
ENSCPOP00000012510  ............--------vipe......................................................
ENSCPOP00000019055  ............CA------s.........................................................
ENSCPOP00000005648  ............VPSPC---f.........................................................
ENSCPOP00000001400  .......dtgarCEHSQFTC..........................................................
ENSCPOP00000007117  ............--------ap........................................................
ENSCPOP00000016677  ............--------gpgeeacv..................................................
ENSCPOP00000001031  ............--------..........................................................
ENSCPOP00000014168  ............--------q.........................................................
ENSCPOP00000012510  .........ideCASGKAVC..........................................................
ENSCPOP00000006033  ............--------y.........................................................
ENSCPOP00000007039  ............--------sepni.....................................................
ENSCPOP00000006323  ............--------..........................................................
ENSCPOP00000014192  ............DVDEC---..........................................................
ENSCPOP00000006380  ............--------..........................................................
ENSCPOP00000005446  ............--------l.........................................................
ENSCPOP00000017174  ............--------samtc.....................................................
ENSCPOP00000009739  ............--------ldmpctrllpllsqavissvnetslvlewtpprdsggredlvyniickscgsgrgact
ENSCPOP00000014075  .........pvvC-------ksn.......................................................
ENSCPOP00000009997  ............--------itqcknrrc.................................................
ENSCPOP00000012721  ............--------a.........................................................
ENSCPOP00000014166  ............--------g.........................................................
ENSCPOP00000000520  ............--------kaepscad..................................................
ENSCPOP00000000520  ............RANPC---..........................................................
ENSCPOP00000020809  ............C-------gggll.....................................................
ENSCPOP00000014227  ............--------salgf.....................................................
ENSCPOP00000010877  ............--------rsadpsnqtgicmvldgdncvfdg..................................
ENSCPOP00000008998  ............--------a.........................................................
ENSCPOP00000013252  ............--------lspg......................................................
ENSCPOP00000002774  ............--------edalstpc..................................................
ENSCPOP00000013057  ............--------radsrsaacttppsaprsvihhlngsslhlewsaplesggrddltyalrcrecrpggs
ENSCPOP00000001828  ............--------fdppdvactsvpsgprnvisivnetsiilewhpprenggrddvtyniickkcradrrs
ENSCPOP00000014166  ............--------rf........................................................
ENSCPOP00000014227  ............--------gec.......................................................
ENSCPOP00000004446  ............--------dkdppsmactrppsaprnvisninetsvildwswpldtggrkditfnilckkcgwnvq
ENSCPOP00000012415  ............CPA-----g.........................................................
ENSCPOP00000009033  ............--------pptmactrppsaprnaisnvnetsvflewippadtggrrdvsyyiackkcnshagvce
ENSCPOP00000019082  ............--------p.........................................................
ENSCPOP00000008922  ............--------..........................................................
ENSCPOP00000008698  ............--------dqdgqyq...................................................
ENSCPOP00000000875  ............--------nc........................................................
ENSCPOP00000012415  ............--------dcf.......................................................
ENSCPOP00000010587  ............--------nglwsssessc...............................................
ENSCPOP00000006471  ............--------..........................................................
ENSCPOP00000010723  ............ITETC---..........................................................


                                 
                                 
d2dtge6               ...........
ENSCPOP00000005160  ...........
ENSCPOP00000002433  ...........
ENSCPOP00000002433  ...........
ENSCPOP00000011550  ...........
ENSCPOP00000011550  ...........
ENSCPOP00000011550  ...........
ENSCPOP00000000034  ...........
ENSCPOP00000009044  ...........
ENSCPOP00000012721  ...........
ENSCPOP00000019239  ...........
ENSCPOP00000011550  ...........
ENSCPOP00000013382  ...........
ENSCPOP00000005210  ...........
ENSCPOP00000007246  ...........
ENSCPOP00000001198  ...........
ENSCPOP00000000218  ...........
ENSCPOP00000013382  ...........
ENSCPOP00000014227  ...........
ENSCPOP00000020809  ...........
ENSCPOP00000000034  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000003877  ...........
ENSCPOP00000002772  ...........
ENSCPOP00000011550  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000008922  ...........
ENSCPOP00000005525  ...........
ENSCPOP00000012721  ...........
ENSCPOP00000005471  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000002433  ...........
ENSCPOP00000014227  ...........
ENSCPOP00000009997  ...........
ENSCPOP00000014227  ...........
ENSCPOP00000009997  ...........
ENSCPOP00000003877  ...........
ENSCPOP00000013776  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000020809  ...........
ENSCPOP00000010019  ...........
ENSCPOP00000003877  ...........
ENSCPOP00000004859  ...........
ENSCPOP00000007268  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000000264  ...........
ENSCPOP00000001031  ...........
ENSCPOP00000003877  ...........
ENSCPOP00000003877  ...........
ENSCPOP00000003570  ...........
ENSCPOP00000003877  ...........
ENSCPOP00000013776  ...........
ENSCPOP00000003877  ...........
ENSCPOP00000006876  ...........
ENSCPOP00000007897  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000002772  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000000697  ...........
ENSCPOP00000005210  ...........
ENSCPOP00000006323  ...........
ENSCPOP00000006040  ...........
ENSCPOP00000007782  ...........
ENSCPOP00000011692  ...........
ENSCPOP00000008828  ...........
ENSCPOP00000017054  ...........
ENSCPOP00000010587  ...........
ENSCPOP00000000645  ...........
ENSCPOP00000013204  ...........
ENSCPOP00000014227  ...........
ENSCPOP00000006144  ...........
ENSCPOP00000001400  ...........
ENSCPOP00000010019  ...........
ENSCPOP00000002393  ...........
ENSCPOP00000017907  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000014227  ...........
ENSCPOP00000016431  ...........
ENSCPOP00000005160  ...........
ENSCPOP00000005059  ...........
ENSCPOP00000014573  ...........
ENSCPOP00000001031  ...........
ENSCPOP00000001400  ...........
ENSCPOP00000013204  ...........
ENSCPOP00000014227  ...........
ENSCPOP00000016148  ...........
ENSCPOP00000016148  ...........
ENSCPOP00000003877  ...........
ENSCPOP00000013762  ...........
ENSCPOP00000004344  ...........
ENSCPOP00000014192  ...........
ENSCPOP00000009997  ...........
ENSCPOP00000014192  ...........
ENSCPOP00000014227  ...........
ENSCPOP00000018258  ...........
ENSCPOP00000016148  ...........
ENSCPOP00000011900  ...........
ENSCPOP00000006323  ...........
ENSCPOP00000006876  ...........
ENSCPOP00000001031  ...........
ENSCPOP00000006612  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000011665  ...........
ENSCPOP00000009088  ...........
ENSCPOP00000010393  ...........
ENSCPOP00000007568  ...........
ENSCPOP00000014192  ...........
ENSCPOP00000011665  ...........
ENSCPOP00000019462  ...........
ENSCPOP00000017174  ...........
ENSCPOP00000005525  ...........
ENSCPOP00000011665  ...........
ENSCPOP00000002335  ...........
ENSCPOP00000014192  ...........
ENSCPOP00000010099  ...........
ENSCPOP00000013776  ...........
ENSCPOP00000016148  ...........
ENSCPOP00000007568  ...........
ENSCPOP00000006323  ...........
ENSCPOP00000005525  ...........
ENSCPOP00000016303  ...........
ENSCPOP00000010587  ...........
ENSCPOP00000013620  ...........
ENSCPOP00000003279  ...........
ENSCPOP00000005471  ...........
ENSCPOP00000007268  ...........
ENSCPOP00000014968  ...........
ENSCPOP00000000520  ...........
ENSCPOP00000017876  ...........
ENSCPOP00000000697  ...........
ENSCPOP00000005525  ...........
ENSCPOP00000000875  ...........
ENSCPOP00000000520  ...........
ENSCPOP00000010233  ...........
ENSCPOP00000001031  ...........
ENSCPOP00000007253  ...........
ENSCPOP00000011665  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000005648  ...........
ENSCPOP00000014192  ...........
ENSCPOP00000009046  ...........
ENSCPOP00000007268  ...........
ENSCPOP00000006033  ...........
ENSCPOP00000002433  ...........
ENSCPOP00000000646  ...........
ENSCPOP00000015957  ...........
ENSCPOP00000004271  ...........
ENSCPOP00000016148  ...........
ENSCPOP00000012510  ...........
ENSCPOP00000019055  ...........
ENSCPOP00000005648  ...........
ENSCPOP00000001400  ...........
ENSCPOP00000007117  ...........
ENSCPOP00000016677  ...........
ENSCPOP00000001031  ...........
ENSCPOP00000014168  ...........
ENSCPOP00000012510  ...........
ENSCPOP00000006033  ...........
ENSCPOP00000007039  ...........
ENSCPOP00000006323  ...........
ENSCPOP00000014192  ...........
ENSCPOP00000006380  ...........
ENSCPOP00000005446  ...........
ENSCPOP00000017174  ...........
ENSCPOP00000009739  rcgdnvqy...
ENSCPOP00000014075  ...........
ENSCPOP00000009997  ...........
ENSCPOP00000012721  ...........
ENSCPOP00000014166  ...........
ENSCPOP00000000520  ...........
ENSCPOP00000000520  ...........
ENSCPOP00000020809  ...........
ENSCPOP00000014227  ...........
ENSCPOP00000010877  ...........
ENSCPOP00000008998  ...........
ENSCPOP00000013252  ...........
ENSCPOP00000002774  ...........
ENSCPOP00000013057  ctpcgg.....
ENSCPOP00000001828  csrcddnvefv
ENSCPOP00000014166  ...........
ENSCPOP00000014227  ...........
ENSCPOP00000004446  qcepcspn...
ENSCPOP00000012415  ...........
ENSCPOP00000009033  ec.........
ENSCPOP00000019082  ...........
ENSCPOP00000008922  ...........
ENSCPOP00000008698  ...........
ENSCPOP00000000875  ...........
ENSCPOP00000012415  ...........
ENSCPOP00000010587  ...........
ENSCPOP00000006471  ...........
ENSCPOP00000010723  ...........


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053854 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Rhizomucor miehei CAU432
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Chaetomium globosum CBS 148.51
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Candida albicans SC5314
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Glycine max v109 - Soybean
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Synechococcus elongatus PCC 7942
NoYes   Ilumatobacter coccineus
NoYes   Filifactor alocis ATCC 35896
NoYes   Runella slithyformis DSM 19594
NoYes   Treponema succinifaciens DSM 2489
NoYes   Desulfurispirillum indicum S5
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Burkholderia sp. CCGE1002
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Hahella chejuensis KCTC 2396
NoYes   Allochromatium vinosum DSM 180
NoYes   gamma proteobacterium HdN1
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Methanospirillum hungatei JF-1
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Coccidioides posadasii str. Silveira
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Synechococcus elongatus PCC 6301
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Phaeobacter gallaeciensis DSM 17395
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica OS117
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Methanoregula formicica Methanoregula formicicum SMSP
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   3_Below_base_of_euphotic (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   7_Oxygen_minimum_layer (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]