SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

FYVE/PHD zinc finger alignments in Gasterosteus aculeatus 76_1

These alignments are sequences aligned to the 0050496 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1wfka_               gssgss........................................................................
ENSGACP00000024062  kkeqspndeicdvcev..............................................................
ENSGACP00000015154  gy............................................................................
ENSGACP00000014941  dltdeekeiinnviaraekmeameqerigrlinrlddmkktvcg..................................
ENSGACP00000023919  shlteeerkiimavmarqkeeedkeqamlktlhqqfesykqevrrigadtrrqptql.....................
ENSGACP00000020542  eltdeekeiinsvlaraavmeatehqriqrlssrledirrtar...................................
ENSGACP00000020537  eltdeekeiinsvlaraavmeatehqriqrlssrledirrtar...................................
ENSGACP00000022920  lsdserqlildvlqrdaelrqaeeqrvrslkselldvkrkgakrgsgkyse...........................
ENSGACP00000004384  sflleherdmilkvlqkdeklrkreekrirklknelleikrkgsrrsqep............................
ENSGACP00000003339  gltddeaehvlkvvqrdmklrkkeeerlsfsemkqelaeegsrcsilskqhrfn........................
ENSGACP00000022478  gltedeaehvlqvvqrdmklrekeeqrlselkqeleeegsrclllsrrscfn..........................
ENSGACP00000001097  ppprekksksakkkkrkakqerdaspvdfaidpneptyclceqvsygemigcdndqcpiewfhfscvgltykpk....
ENSGACP00000000841  peaeansqvdwtydpneprycicnqvsygemvgcdntdcpiewfhygcvglteapk......................
ENSGACP00000014629  lsdallpmqpsdvldmpvdpneptyclchqvsygemigcdnpdctiewfhfacvdlaskpk.................
ENSGACP00000007838  rlldgvnlvaqsvselsvkpakavsswltdqiapa...........................................
ENSGACP00000017070  perdasweleanaysellevyt........................................................
ENSGACP00000013626  ptnnfgnvhpsdvldmpvdpneptyclchqvsygemigcdntdcsiewfhfacvglttkp..................
ENSGACP00000006381  shltederkiilgvmdrqkkeeakeqtmlkrrrreragsgqwpypwsgrllgwpalmqpdqrknqrlqpaqklhqqfe
ENSGACP00000013239  leresvldvlrrdkqlraieearirrmkselqelrrrgaksfsrqyge..............................
ENSGACP00000004599  skkkkrskgkserevsppdlpidpdeptyclceqvsygemigcdndecpiewfhfscvglhhkpk.............
ENSGACP00000018041  wikafqetieifqqknesfknalkdveevsnaelgkra........................................
ENSGACP00000021274  ..............................................................................
ENSGACP00000010944  d.............................................................................
ENSGACP00000021273  ..............................................................................
ENSGACP00000023448  ..............................................................................
ENSGACP00000017175  ldgvkyisqsvselsvtpakavtswltdqiapt.............................................
ENSGACP00000024268  a.............................................................................
ENSGACP00000023917  shlteeerkiimavmarqkeeedkeqamlkkkvvsgqnppccckteeessakrhqesgtlhqqfesykqevrrigadt
ENSGACP00000021908  ..............................................................................
ENSGACP00000013976  dwv...........................................................................
ENSGACP00000015502  amqelgrenqslqikqcqsltrk.......................................................
ENSGACP00000017883  ..............................................................................
ENSGACP00000006350  ..............................................................................
ENSGACP00000007838  lmkdgalpa.....................................................................
ENSGACP00000018905  ..............................................................................
ENSGACP00000010464  lpspssgdgdihe.................................................................
ENSGACP00000025262  drdewikviqeaidvflkkhetfkltcnepdveesteelgrra...................................
ENSGACP00000011630  ..............................................................................
ENSGACP00000017175  glvkdaarpa....................................................................
ENSGACP00000011590  vplyc.........................................................................
ENSGACP00000011699  sdlrslvdedavccvcmdgdgad.......................................................
ENSGACP00000000108  adpstlideda...................................................................
ENSGACP00000005477  lersvlwsrsvln.................................................................
ENSGACP00000020092  lekaiawersvt..................................................................
ENSGACP00000016270  ..............................................................................
ENSGACP00000026721  ifnyqvatkqllfrlldmlskep.......................................................
ENSGACP00000010109  ldacikwdmsaenarckvcrrkg.......................................................
ENSGACP00000026720  ifnyqvatkqllfrlldmlskep.......................................................
ENSGACP00000007778  aavrtyrwqci...................................................................
ENSGACP00000025128  qapvdeda......................................................................
ENSGACP00000025131  qapvdeda......................................................................
ENSGACP00000026741  ..............................................................................
ENSGACP00000000293  ld............................................................................
ENSGACP00000016095  rrnlgnpqsvds..................................................................
ENSGACP00000005831  tpvrsvvtetvstyvirdew..........................................................
ENSGACP00000009463  ..............................................................................
ENSGACP00000006044  eglgieyded....................................................................
ENSGACP00000016061  ssmegenaplycicrkpdincf........................................................
ENSGACP00000002833  nvkrlrwqci....................................................................
ENSGACP00000018281  veglgieydedv..................................................................
ENSGACP00000020042  lqksiawersimkv................................................................
ENSGACP00000025092  levnfidlylclvcgrgdeedrl.......................................................
ENSGACP00000013214  sdeggydpnalyc.................................................................
ENSGACP00000024472  eskkeiklyc....................................................................
ENSGACP00000015547  ..............................................................................
ENSGACP00000023173  etnaddfamemg..................................................................
ENSGACP00000023303  mmaavktyrwqci.................................................................
ENSGACP00000023170  etnaddfamemg..................................................................
ENSGACP00000020052  egsdsnalycicrqkqdkrf..........................................................
ENSGACP00000005279  aagh..........................................................................
ENSGACP00000017218  rtyqwqci......................................................................
ENSGACP00000017301  arvkal........................................................................
ENSGACP00000006514  taidddafccvclddeclnsnvi.......................................................
ENSGACP00000024472  steelyc.......................................................................
ENSGACP00000001615  savdedafccvclddeclnsn.........................................................
ENSGACP00000009172  tskdpkkdtklyc.................................................................
ENSGACP00000003894  ..............................................................................
ENSGACP00000000323  d.............................................................................
ENSGACP00000024469  skkeiklyc.....................................................................
ENSGACP00000015717  vdlvvclvcgsggdeer.............................................................
ENSGACP00000026389  lyc...........................................................................
ENSGACP00000005811  etdhqdycevc...................................................................
ENSGACP00000027580  tssdddlppnddp.................................................................
ENSGACP00000015027  dvdleqtrcevcrgsdredrlllc......................................................
ENSGACP00000013235  rmkselqelrrrgaksfsrqyge.......................................................
ENSGACP00000000735  edfswkkedveh..................................................................
ENSGACP00000025482  etdhqdfcevc...................................................................
ENSGACP00000000654  idqy..........................................................................
ENSGACP00000011950  iqragwqcp.....................................................................
ENSGACP00000019137  t.............................................................................
ENSGACP00000007576  lqksiawersi...................................................................
ENSGACP00000025078  gppvaaqpecekravpeed...........................................................
ENSGACP00000025482  ddddhme.......................................................................
ENSGACP00000027499  rrgvknhehv....................................................................
ENSGACP00000026973  mmaavktyrwqci.................................................................
ENSGACP00000020043  crkgdnedllllcdg...............................................................
ENSGACP00000001497  kgplycvcrkpei.................................................................
ENSGACP00000001499  kgplycvcrkpei.................................................................
ENSGACP00000006025  kgyshhshv.....................................................................
ENSGACP00000018107  ldpnglvplp....................................................................
ENSGACP00000013248  vdvvpqdgr.....................................................................
ENSGACP00000013240  vdvvpqdgr.....................................................................
ENSGACP00000025092  qkeveaihslraanlakmamadrieevkfclcrktasgfm......................................
ENSGACP00000020067  vdvvpqdgr.....................................................................
ENSGACP00000020064  vdvvpqdgr.....................................................................
ENSGACP00000003887  ..............................................................................
ENSGACP00000009172  qydd..........................................................................
ENSGACP00000018107  atnhdtcdscregg................................................................
ENSGACP00000008447  n.............................................................................
ENSGACP00000013318  vdsgavdtsdqeivrciceveeendfmiq.................................................
ENSGACP00000023975  prkgcknhehin..................................................................
ENSGACP00000021324  tyrwqcm.......................................................................
ENSGACP00000024469  egvvayd.......................................................................
ENSGACP00000025644  sgddswdlitc...................................................................
ENSGACP00000021322  tyrwqcm.......................................................................
ENSGACP00000006576  gnsggkeedp....................................................................
ENSGACP00000004363  phdkdddvircicgmykdeglm........................................................
ENSGACP00000010812  vrnhynhnfngcyc................................................................
ENSGACP00000014875  eeeeeeeeg.....................................................................
ENSGACP00000010801  vrnhynhnfngcyc................................................................
ENSGACP00000010820  vrnhynhnfngcyc................................................................
ENSGACP00000025648  sgddswdlitc...................................................................
ENSGACP00000017361  dwdpqhlt......................................................................
ENSGACP00000019138  c.............................................................................
ENSGACP00000017696  kgwrcl........................................................................
ENSGACP00000020648  esedfcavcliggd................................................................
ENSGACP00000017212  vrtyqwqc......................................................................
ENSGACP00000022692  r.............................................................................
ENSGACP00000015673  psgsgtpg......................................................................
ENSGACP00000000098  ek............................................................................
ENSGACP00000011071  knd...........................................................................
ENSGACP00000015670  psgsgtpg......................................................................
ENSGACP00000020670  yi............................................................................
ENSGACP00000014147  dwdsq.........................................................................
ENSGACP00000015669  ppsgsgtpg.....................................................................
ENSGACP00000022498  ypptsag.......................................................................
ENSGACP00000010520  sdddswdlvtcfcmkpfagrami.......................................................
ENSGACP00000022225  fcs...........................................................................
ENSGACP00000017974  kyshnfsglyctcsrpypdpddqvedemiqcvvcedwlhgrhlgrvvp..............................
ENSGACP00000018002  kyshnfsglyctcsrpypdpddqvedemiqcvvcedwlhgrhlgrvvp..............................
ENSGACP00000017984  kyshnfsglyctcsrpypdpddqvedemiqcvvcedwlhgrhlgrvvp..............................
ENSGACP00000017361  vee...........................................................................
ENSGACP00000003271  ggccvcsdergwaenplvycdghgcnvavhqacygivqvpt.....................................
ENSGACP00000020670  wdqahe........................................................................
ENSGACP00000026393  sedgsygaditrcicgfthddgym......................................................
ENSGACP00000011950  gwrcle........................................................................
ENSGACP00000015717  sdfsqsddsde...................................................................
ENSGACP00000014147  pgeeprcsvcqeaepnadnqs.........................................................
ENSGACP00000017696  ck............................................................................
ENSGACP00000023950  gccvcsdergwaenplvycdghgcsvavhqacygivqvpt......................................
ENSGACP00000011559  wc............................................................................
ENSGACP00000000643  hdameteecelvrcvcevdeendfmiq...................................................
ENSGACP00000008022  n.............................................................................
ENSGACP00000016773  atsnatn.......................................................................
ENSGACP00000000096  qtwntq........................................................................
ENSGACP00000004788  ddptggw.......................................................................
ENSGACP00000000654  esrlvpaenccalsvcicqkapsg......................................................
ENSGACP00000000096  dt............................................................................
ENSGACP00000025018  nepirskvsklteklrkr............................................................
ENSGACP00000004795  ddptggw.......................................................................
ENSGACP00000015717  lrtaneskllptadcmdlkvcvcqkapm..................................................
ENSGACP00000000654  dptasdseedyslcaa..............................................................
ENSGACP00000001522  gwrcle........................................................................
ENSGACP00000015330  fntpdyrfecicgelglvdy..........................................................
ENSGACP00000023975  qpsaeklkegkrkvpmkkktkqevtke...................................................
ENSGACP00000027499  grkmkrrghgkrknkavvtk..........................................................
ENSGACP00000007442  pepvkp........................................................................
ENSGACP00000001522  sdlftlrq......................................................................
ENSGACP00000002045  rahaqqqqqnapmdstkpk...........................................................
ENSGACP00000017696  nytqcapc......................................................................
ENSGACP00000007451  pkkrklrpegkqthe...............................................................
ENSGACP00000010144  nkenwccr......................................................................
ENSGACP00000026147  apts..........................................................................
ENSGACP00000005914  fpcglcmaevhddqdailcea.........................................................
ENSGACP00000006025  knsssqtaeakakrskrkyrrrkaegqkksd...............................................
ENSGACP00000019076  s.............................................................................
ENSGACP00000005969  spppe.........................................................................
ENSGACP00000011913  nf............................................................................
ENSGACP00000011913  eqfenwccr.....................................................................
ENSGACP00000007451  ggkllc........................................................................
ENSGACP00000017696  dnftlk........................................................................
ENSGACP00000006814  ltveevmhirqvlvkaelekfqqykeiyis................................................
ENSGACP00000011950  hidkaeelag....................................................................
ENSGACP00000026887  dgm...........................................................................
ENSGACP00000011950  casl..........................................................................
ENSGACP00000005612  kenwccr.......................................................................
ENSGACP00000010144  sklnelg.......................................................................
ENSGACP00000007451  sagkr.........................................................................
ENSGACP00000006810  ltveevmhirqvlvkaelekfqqykeiyis................................................
ENSGACP00000005612  kg............................................................................
ENSGACP00000002045  pss...........................................................................
ENSGACP00000026886  dgm...........................................................................
ENSGACP00000021682  lsa...........................................................................
ENSGACP00000007442  ss............................................................................
ENSGACP00000011950  lqd...........................................................................
ENSGACP00000017696  lhkfvddv......................................................................
ENSGACP00000023440  alpnt.........................................................................
ENSGACP00000006081  sltveevmhirqvlvkaelekfqqykdiynamk.............................................
ENSGACP00000022493  pvlphtavclvcgeagkedtvedeeekfnl................................................
ENSGACP00000015690  pvlphtavcvvckeagkedtleeeedkfnfm...............................................
ENSGACP00000021324  pkvipnai......................................................................
ENSGACP00000024087  sd............................................................................
ENSGACP00000021322  pkvipnai......................................................................
ENSGACP00000006076  sltveevmhirqvlvkaelekfqqykdiynamk.............................................
ENSGACP00000022489  pvlphtavclvcgeagkedtvedeeekfnl................................................
ENSGACP00000006064  sltveevmhirqvlvkaelekfqqykdiynamk.............................................
ENSGACP00000016095  eetkeepvcvctgqp...............................................................
ENSGACP00000026147  ggl...........................................................................
ENSGACP00000019496  phtavcfacgeagkedtvdseeekfs....................................................
ENSGACP00000005612  pstpqpvcllcaskgr..............................................................
ENSGACP00000020574  gtsrl.........................................................................
ENSGACP00000003950  dgtslli.......................................................................
ENSGACP00000000644  lq............................................................................
ENSGACP00000017218  iipndycdfclgdqeanrktgqaee.....................................................
ENSGACP00000010144  pptppsvcflcaskg...............................................................
ENSGACP00000006025  kkefvcqtceqagddlvpcegqc.......................................................
ENSGACP00000017212  iipndycdfclgdqeanrktgqaee.....................................................
ENSGACP00000016773  ks............................................................................
ENSGACP00000011913  rvlcflcassgnve................................................................
ENSGACP00000011572  higedgtspll...................................................................
ENSGACP00000021016  gtspl.........................................................................
ENSGACP00000026973  alpnkycdfclgdsktnlktgqseel....................................................
ENSGACP00000017070  spprs.........................................................................
ENSGACP00000011950  r.............................................................................
ENSGACP00000024645  gnkl..........................................................................
ENSGACP00000009407  d.............................................................................
ENSGACP00000013579  d.............................................................................
ENSGACP00000007778  angycd........................................................................
ENSGACP00000023303  mpndycdfclgdstlnqktgqs........................................................

                                                  10           20                               30  
                                                   |            |                                |  
d1wfka_               ....................------GMESRC..YGCAVK.FT.....LF............KK.....EYGCK.NC.
ENSGACP00000024062  ....................------------..------.-W.....TA............DD.....LYPCR.IC.
ENSGACP00000015154  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000014941  ....................------DGQSRC..LLCGEQ.FGs....PG............VS.....SVVCE.DC.
ENSGACP00000023919  ....................-----KDDAPTC..GICRKT.KF.....AD............GC.....GHLCS.YC.
ENSGACP00000020542  ....................-----GDGRSHC..LLCGAS.LGp....QG............VT.....AALCV.RC.
ENSGACP00000020537  ....................-----GDGRSHC..LLCGAS.LGp....QG............VT.....AALCV.RC.
ENSGACP00000022920  ....................---------RSC..GRCLQP.LSr....LT............AS.....SSQCK.IC.
ENSGACP00000004384  ....................-------EERQC..ARCMKS.LGl....IF............GR.....GDLCK.EC.
ENSGACP00000003339  ....................--------EHCC..IRCCAP.FTf....LL............NP.....KRLCL.DC.
ENSGACP00000022478  ....................--------QRCC..IRCCSP.FTf....LL............NP.....GRRCR.DC.
ENSGACP00000001097  ....................------------..------.--.....--............-G.....KWYCP.KC.
ENSGACP00000000841  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000014629  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000007838  ....................-YWKPNSLISVC..HKCHAV.FQ.....DN............DT.....KHHCR.AC.
ENSGACP00000017070  ....................------------..------.--.....--............--.....-----.RC.
ENSGACP00000013626  ....................------------..------.--.....--............RG.....KWYCP.RC.
ENSGACP00000006381  sykdqvkkmgeetkptqelk------SEAPTC..GICHKT.KF.....AD............GC.....GHLCS.YC.
ENSGACP00000013239  ....................---------RTC..ARCQRP.LGk....FW............NS.....GAVCD.GC.
ENSGACP00000004599  ....................------------..------.--.....--............-G.....KWYCP.KC.
ENSGACP00000018041  ....................PRWIRDNEVTMC..MKCKES.FNa....LT............RR.....RHHCR.AC.
ENSGACP00000021274  ....................-VWLKDKDASHC..KLCEKE.FS.....IS............RR.....KHHCR.NC.
ENSGACP00000010944  ....................--WVPDEACNSC..IACKAP.FT.....VI............RR.....KHHCR.SC.
ENSGACP00000021273  ....................-VWLKDKDASHC..KLCEKE.FS.....IS............RR.....KHHCR.NC.
ENSGACP00000023448  ....................-VWVPDSEATVC..MRCQKVkFT.....PV............SR.....RHHCR.KC.
ENSGACP00000017175  ....................-YWKPNSLILKC..HKCAEE.FQ.....PN............DA.....KHHCR.AC.
ENSGACP00000024268  ....................--WLKDDEATQC..KQCEKE.FS.....IA............RR.....KHHCR.NC.
ENSGACP00000023917  .............rrqptql-----KDDAPTC..GICRKT.KF.....AD............GC.....GHLCS.YC.
ENSGACP00000021908  ....................PVWVPDCQAPVC..MKCDVR.FT.....FT............KR.....RHHCR.AC.
ENSGACP00000013976  ....................-------DAEEC..HRCRVQ.FG.....VM............TR.....KHHCR.AC.
ENSGACP00000015502  ....................--WAEDHEVQNC..MACGKG.FS.....VT............VR.....KHHCR.HC.
ENSGACP00000017883  ....................-RWYPDHLAAQC..YGCESR.FW.....LV............AR.....KHHCR.NC.
ENSGACP00000006350  ....................PQWVPDKECPRC..MQCDTK.FD.....FI............RR.....KHHCR.RC.
ENSGACP00000007838  ....................-YWVPDQDILSC..HNCQRE.FT.....AK............LS.....KHHCR.AC.
ENSGACP00000018905  ....................DHWVKDEVVDSC..SGCAVR.FS.....LT............ER.....RHHCR.NC.
ENSGACP00000010464  ....................---------DFC..TVCRRS.GQ.....LL............--.....--MCD.TC.
ENSGACP00000025262  ....................PRWIRDNEVTVC..MKCEEP.FNa....IT............RR.....RHHCR.AC.
ENSGACP00000011630  ....................-YWMPDSQCKEC..YDCNEK.FT.....TF............RR.....RHHCR.LC.
ENSGACP00000017175  ....................-YWVPDQDIRSC..SECQRE.FS.....PR............LH.....IHHCR.AC.
ENSGACP00000011590  ....................------------..-LCRLP.YD.....VT............RF.....MIECD.IC.
ENSGACP00000011699  ....................------------..------.--.....-S............NV.....ILFCD.SC.
ENSGACP00000000108  ....................----------VC..CICNDGeCQ.....NS............NV.....ILFCD.MC.
ENSGACP00000005477  ....................---------ARC..RICRRK.GD.....AD............N-.....MLLCD.SC.
ENSGACP00000020092  ....................--------KVNC..QVCRKG.DNdd...LL............--.....-----.--.
ENSGACP00000016270  ....................--WVPDTKQDVC..MICRRErFT.....MF............NR.....RHHCR.RC.
ENSGACP00000026721  ....................----PWCDGSNC..YECLAK.FG.....VT............TR.....KHHCR.HC.
ENSGACP00000010109  ....................----DDEKLILC..DECNKA.FH.....LFclrpalygip..TG.....EWLCP.AC.
ENSGACP00000026720  ....................----PWCDGSNC..YECLAK.FG.....VT............TR.....KHHCR.HC.
ENSGACP00000007778  ....................------------..-ECK--.--.....--............--.....--SCS.LC.
ENSGACP00000025128  ....................----------VC..CICGDGeCH.....NG............NA.....ILFCD.LC.
ENSGACP00000025131  ....................----------VC..CICGDGeCH.....NG............NA.....ILFCD.LC.
ENSGACP00000026741  ....................-RWVPDHMASHC..FNCDCE.FW.....IA............KR.....RHHCR.NC.
ENSGACP00000000293  ....................--------SDSC..QKCEQP.FF.....WNikqmwdtktmg.LR.....QHHCR.KC.
ENSGACP00000016095  ....................------------..------.--.....--............--.....-FVCR.MC.
ENSGACP00000005831  ....................-----GNQIWIC..PGCNKP.DD.....GS............-P.....MIGCD.DC.
ENSGACP00000009463  ....................-VWIPDQAAYKC..MRCFDK.FT.....PT............KR.....RHHCR.KC.
ENSGACP00000006044  ....................---------VVC..DVCRSP.DGe....DN............NE.....MVFCD.KC.
ENSGACP00000016061  ....................------------..------.--.....--............--.....MIGCD.KC.
ENSGACP00000002833  ....................-------ECKTC..SSCRRQ.GK.....NA............DE.....MLFCD.SC.
ENSGACP00000018281  ....................----------IC..DVCRSP.DSe....EG............ND.....MVFCD.KC.
ENSGACP00000020042  ....................----------YC..QMCRKG.DNed...LL............--.....-LLCD.GC.
ENSGACP00000025092  ....................---------LLC..DGCDDS.YH.....TF............--.....-----.--.
ENSGACP00000013214  ....................------------..-ICRQK.HN.....KR............F-.....MICCD.RC.
ENSGACP00000024472  ....................------------..-VCKTP.YD.....ET............KF.....YIGCD.LC.
ENSGACP00000015547  ....................-WWLVDKETTQC..LGCQGQ.FT.....WW............LR.....RHHCR.LC.
ENSGACP00000023173  ....................---------LAC..VVCRQMtVT.....MG............NQ.....LVECQ.EC.
ENSGACP00000023303  ....................------------..-ECKC-.--.....--............--.....---CN.VC.
ENSGACP00000023170  ....................---------LAC..VVCRQMtVT.....MG............NQ.....LVECQ.EC.
ENSGACP00000020052  ....................------------..------.--.....--............--.....MICCD.KC.
ENSGACP00000005279  ....................-----RDDAPTC..GICHKT.KF.....AD............GC.....GNLCS.YC.
ENSGACP00000017218  ....................------------..-ECK--.--.....--............--.....--SCS.LC.
ENSGACP00000017301  ....................--WWQCIECKTC..SSCQDQ.GK.....NA............DN.....MLFCD.SC.
ENSGACP00000006514  ....................------------..------.--.....--............--.....-LFCD.SC.
ENSGACP00000024472  ....................------------..-ICQTP.YD.....ES............QF.....YIGCD.RC.
ENSGACP00000001615  ....................------------..------.--.....--............-V.....ILFCD.IC.
ENSGACP00000009172  ....................------------..-VCKTA.YD.....ES............KF.....YIGCD.RC.
ENSGACP00000003894  ....................--WVSDSDVPFC..PDCGNK.FN.....IR............NR.....RHHCR.LC.
ENSGACP00000000323  ....................--------SDSC..QKCEQP.FF.....WNfkqmwdskkig.LR.....QHHCR.KC.
ENSGACP00000024469  ....................------------..-VCKTP.YD.....ET............KF.....YIGCD.RC.
ENSGACP00000015717  ....................--------LLLC..DGCDDS.YH.....TFclipplpdip..KG.....DWRCP.KC.
ENSGACP00000026389  ....................------------..-VCRQS.YD.....VS............RF.....MIECD.IC.
ENSGACP00000005811  ....................---QQGGEIILC..DTCPRA.YH.....LVcldpelekap..EG.....KWSCP.HC.
ENSGACP00000027580  ....................------------..------.--.....--............--.....---CK.HC.
ENSGACP00000015027  ....................------------..------.--.....--............--.....----D.G-.
ENSGACP00000013235  ....................---------RTC..ARCQRP.LGk....FW............NS.....GAVCD.GC.
ENSGACP00000000735  ....................--------DDLC..AVCKED.GE.....L-............--.....-QPCH.NC.
ENSGACP00000025482  ....................---QQGGEIILC..DTCPRA.YH.....LVclepelekap..EG.....KWSCP.HC.
ENSGACP00000000654  ....................------------..------.--.....--............--.....--MCL.VC.
ENSGACP00000011950  ....................-------ECKVC..QTCRQP.GE.....-D............SK.....MLVCD.AC.
ENSGACP00000019137  ....................--WIPDSASAIC..MRCFDR.FS.....VT............QR.....RHHCR.KC.
ENSGACP00000007576  ....................------------..------.--.....--............-M.....KVHCQ.LC.
ENSGACP00000025078  ....................------PNEDWC..AVCQNG.GE.....LL............--.....--CCD.KC.
ENSGACP00000025482  ....................------------..------.--.....--............--.....--FCR.VC.
ENSGACP00000027499  ....................-------NVSWC..FVCTEG.GS.....LL............--.....--CCE.SC.
ENSGACP00000026973  ....................------------..-ECKC-.--.....--............--.....---CN.MC.
ENSGACP00000020043  ....................------------..------.--.....--............--.....-----.-C.
ENSGACP00000001497  ....................------------..------.--.....--............--.....-----.NC.
ENSGACP00000001499  ....................------------..------.--.....--............--.....-----.NC.
ENSGACP00000006025  ....................-------NVSWC..FVCSKG.GQ.....LL............--.....--CCE.SC.
ENSGACP00000018107  ....................--------VKVC..FSCNRS.CR.....LA............-P.....LIQCD.YC.
ENSGACP00000013248  ....................-------NDFYC..WLCHRE.GQ.....VL............--.....--CCE.LC.
ENSGACP00000013240  ....................-------NDFYC..WLCHRE.GQ.....VL............--.....--CCE.LC.
ENSGACP00000025092  ....................------------..------.--.....--............--.....-LQCD.LC.
ENSGACP00000020067  ....................-------NDFYC..WLCHRE.GQ.....VL............--.....--CCE.LC.
ENSGACP00000020064  ....................-------NDFYC..WLCHRE.GQ.....VL............--.....--CCE.LC.
ENSGACP00000003887  ....................--WVSDSDVPFC..PDCGNK.FN.....IR............NR.....RHHCR.LC.
ENSGACP00000009172  ....................------------..------.--.....--............--.....--HCR.VC.
ENSGACP00000018107  ....................-------DLLCC..DHCPAA.FH.....LQ............--.....-----.--.
ENSGACP00000008447  ....................----------RC..YCCASK.FS.....LF............KK.....ELGCK.SC.
ENSGACP00000013318  ....................------------..------.--.....--............--.....-----.-C.
ENSGACP00000023975  ....................--------VSWC..FVCSEG.GS.....LL............--.....--CCE.AC.
ENSGACP00000021324  ....................-------ECKTC..IVCQQP.HH.....ED............--.....-----.--.
ENSGACP00000024469  ....................------------..------.--.....--............--.....-DHCR.VC.
ENSGACP00000025644  ....................------------..-YCGKP.FA.....G-............RP.....MIECN.QC.
ENSGACP00000021322  ....................-------ECKTC..IVCQQP.HH.....ED............--.....-----.--.
ENSGACP00000006576  ....................-------NEDWC..AVCING.GD.....LL............--.....--CCD.RC.
ENSGACP00000004363  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000010812  ....................------------..-TCDRP.YP.....DTddqad.......DE.....MIQCV.IC.
ENSGACP00000014875  ....................------NNTVIC..EECGRG.-D.....RR............HR.....LLVCT.RC.
ENSGACP00000010801  ....................------------..-TCDRP.YP.....DTddqad.......DE.....MIQCV.IC.
ENSGACP00000010820  ....................------------..-TCDRP.YP.....DTddqad.......DE.....MIQCV.IC.
ENSGACP00000025648  ....................------------..-YCGKP.FA.....G-............RP.....MIECN.QC.
ENSGACP00000017361  ....................-------NQQQCy.CYCAGP.GE.....WN............LK.....MLQCG.SC.
ENSGACP00000019138  ....................---IPDSASAIC..MRCFDR.FS.....VT............QR.....RHHCR.KC.
ENSGACP00000017696  ....................-------ECTVC..EACGQA.TD.....P-............GR.....LLLCD.DC.
ENSGACP00000020648  ....................------------..------.--.....LL............--.....--CCD.RC.
ENSGACP00000017212  ....................------------..IECK--.--.....--............--.....--SCS.LC.
ENSGACP00000022692  ....................-------DVNYC..LGCHSQ.FS.....WW............LR.....KHNCR.LC.
ENSGACP00000015673  ....................---------LVC..KSCGQA.FS.....VF............RR.....KYICR.DC.
ENSGACP00000000098  ....................-------EKQTC..KGCNES.FN.....FT............KR.....KHHCK.SC.
ENSGACP00000011071  ....................---------DEC..CICRRE.GD.....LV............--.....--MCD.NC.
ENSGACP00000015670  ....................---------LVC..KSCGQA.FS.....VF............RR.....KYICR.DC.
ENSGACP00000020670  ....................----------VC..SICQDE.TSd....EP............NE.....IVICD.KC.
ENSGACP00000014147  ....................----HRTNHQQCy.CYCGGP.GE.....WY............LK.....MLQCF.RC.
ENSGACP00000015669  ....................---------LVC..KSCGQA.FS.....VF............RR.....KYICR.DC.
ENSGACP00000022498  ....................------SAGQLC..KACGLA.FS.....VF............RR.....KHICC.DC.
ENSGACP00000010520  ....................------------..------.--.....--............--.....--ECN.QC.
ENSGACP00000022225  ....................-----------C..CVCGGK.QD.....AH............M-.....QLLCD.EC.
ENSGACP00000017974  ....................------------..------.--.....--............--.....--DCV.EL.
ENSGACP00000018002  ....................------------..------.--.....--............--.....--DCV.EL.
ENSGACP00000017984  ....................------------..------.--.....--............--.....--DCV.EL.
ENSGACP00000017361  ....................----------VC..CICDAP.-P.....LK............EP.....LVNCL.KC.
ENSGACP00000003271  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000020670  ....................------TNIQQCy.CYCGGP.GD.....WY............LK.....MLQCN.GC.
ENSGACP00000026393  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000011950  ....................--------CIVC..EMCGKA.SD.....P-............SR.....LLLCD.DC.
ENSGACP00000015717  ....................-------EMAVCpaERCQLP.EG.....DE............VD.....WVQCDgSC.
ENSGACP00000014147  ....................------------..------.-N.....PN............NQ.....ILICG.KC.
ENSGACP00000017696  ....................----------IC..QTCKNP.GE.....-D............TK.....MLVCD.MC.
ENSGACP00000023950  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000011559  ....................----------NC..HICGIK.QD.....PD............-K.....QLLCD.EC.
ENSGACP00000000643  ....................------------..------.--.....--............--.....-----.-C.
ENSGACP00000008022  ....................---------NCC..GLCKKH.HN.....NM............F-.....MVGCG.RC.
ENSGACP00000016773  ....................-----KTSHSTC..PLCKLE.LN.....MGskdp........PN.....YNTCT.EC.
ENSGACP00000000096  ....................-------HILIC..CVCLGD.NSe....DA............DE.....IIQCD.NC.
ENSGACP00000004788  ....................-----------C..AACHTG.GQ.....LL............--.....--CCH.KC.
ENSGACP00000000654  ....................------------..------.--.....--............-A.....MMQCE.LC.
ENSGACP00000000096  ....................--------RTEC..TTCSGP.GDne...NL............VR.....CDECR.LC.
ENSGACP00000025018  ....................---YPTTSTGNC..SSCNAV.FS.....VL............KK.....RRNCS.NC.
ENSGACP00000004795  ....................-----------C..AACHTG.GQ.....LL............--.....--CCH.KC.
ENSGACP00000015717  ....................------GAMLQC..ELCRNA.FH.....SV............CV.....REPSD.SC.
ENSGACP00000000654  ....................------------..PWCREP.EG.....DE............VN.....WVQC-.--.
ENSGACP00000001522  ....................------------..------.--.....--............--.....-----.-C.
ENSGACP00000015330  ....................------------..------.--.....--............KA.....RVQCM.NC.
ENSGACP00000023975  ....................-------REDEC..FSCGDG.GQ.....--............--.....-----.--.
ENSGACP00000027499  ....................------EREDEC..FSCGDG.GQ.....--............--.....-----.--.
ENSGACP00000007442  ....................--------KVNC..PLCKTE.LN.....IGnsdp........PN.....YNTCT.QC.
ENSGACP00000001522  ....................---------DMC..VVCGSF.GRg....AE............GR.....LLACS.QC.
ENSGACP00000002045  ....................---------ACC..PLCKTD.LN.....IGntaeq.......PN.....YNTCT.QC.
ENSGACP00000017696  ....................------ASLATC..PICLLD.YS.....EG............TV.....IVQCR.QC.
ENSGACP00000007451  ....................---------YCC..FCCGEG.GE.....LV............--.....-----.MC.
ENSGACP00000010144  ....................-------RCKFC..HVCGRK.NK.....PS............KP.....LLECE.RC.
ENSGACP00000026147  ....................--------KESC..PLCNVE.LNagsv.DT............PN.....YSLCT.NC.
ENSGACP00000005914  ....................------------..------.--.....--............--.....-----.SC.
ENSGACP00000006025  ....................---------DDC..FRCGDG.GQ.....LV............--.....-----.LC.
ENSGACP00000019076  ....................----------IC..SMCERD.DS.....LT............KT.....KRRCK.NC.
ENSGACP00000005969  ....................---------HTC..KACGGR.LD.....TP............AT.....KHVCV.DC.
ENSGACP00000011913  ....................-----------C..PLCDKC.YDddd..YD............SK.....MMECG.RC.
ENSGACP00000011913  ....................-------RCRFC..QACGHQ.HQk....TK............QQ.....LLECD.KC.
ENSGACP00000007451  ....................-----------C..DTCPAS.FH.....--............--.....-----.--.
ENSGACP00000017696  ....................--------QDMC..VVCGSFgLG.....AE............GR.....LLACA.QC.
ENSGACP00000006814  ....................-----LKKGKVC..FSCRTKrFS.....LF............TW.....SYTCQ.FC.
ENSGACP00000011950  ....................-------EESWC..AVCDSA.GE.....LT............-D.....LLFCT.GC.
ENSGACP00000026887  ....................--------DEQC..RWCAEG.GN.....LI............--.....--CCD.FC.
ENSGACP00000011950  ....................---------VTC..PVCREN.FM.....EE............EL.....LLQCQ.YC.
ENSGACP00000005612  ....................-------RCKFC..HVCGRR.SK.....ST............KP.....VLQCR.RC.
ENSGACP00000010144  ....................------NYCPIC..FKCYED.ND.....YD............SQ.....MMQCG.TC.
ENSGACP00000007451  ....................------------..------.--.....--............--.....DTVCQ.VCe
ENSGACP00000006810  ....................-----LKKGKVC..FSCRTKrFS.....LF............TW.....SYTCQ.FC.
ENSGACP00000005612  ....................------NFCKVC..HKCYND.NN.....QH............TQ.....MIQCS.AC.
ENSGACP00000002045  ....................---------KLC..PVCKTT.DL.....MGtgddk.......PT.....FNTCT.QC.
ENSGACP00000026886  ....................--------DEQC..RWCAEG.GN.....LI............--.....--CCD.FC.
ENSGACP00000021682  ....................----------VC..EICKEP.NQeesgdPS............LT.....LMECS.NC.
ENSGACP00000007442  ....................---------KLC..PVCSST.QLsnpp.AP............PN.....YNTCT.QC.
ENSGACP00000011950  ....................----------MC..VVCGSF.GKgaeg.QL............LA.....CAQCA.QC.
ENSGACP00000017696  ....................----------NC..ALCDSP.GE.....L-............LD.....QLFCT.SC.
ENSGACP00000023440  ....................---------ARC..AVCGEGeFDesnp.ST............YS.....LMECS.VC.
ENSGACP00000006081  ....................-------KGKLC..FCCRSKrFS.....FF............TW.....SYICQ.FC.
ENSGACP00000022493  ....................------------..------.--.....--............-M.....LMECS.IC.
ENSGACP00000015690  ....................------------..------.--.....--............--.....LMECS.IC.
ENSGACP00000021324  ....................-----------C..GICQKG.KE.....AN............KRgrpeaLIHCS.QC.
ENSGACP00000024087  ....................------GMDEQC..RWCAEG.GK.....LI............--.....--CCD.YC.
ENSGACP00000021322  ....................-----------C..GICQKG.KE.....AN............KRgrpeaLIHCS.QC.
ENSGACP00000006076  ....................-------KGKLC..FCCRSKrFS.....FF............TW.....SYICQ.FC.
ENSGACP00000022489  ....................------------..------.--.....--............-M.....LMECS.IC.
ENSGACP00000006064  ....................-------KGKLC..FCCRSKrFS.....FF............TW.....SYICQ.FC.
ENSGACP00000016095  ....................------------..------.--.....-R............AP.....QLRCH.LC.
ENSGACP00000026147  ....................-----------C..PLCKTTqLNigsk.DT............PN.....YSNCT.EC.
ENSGACP00000019496  ....................------------..------.--.....--............LS.....LMECT.IC.
ENSGACP00000005612  ....................------HEMIFC..QICCEP.FH.....SFclspderp....Q-.....-----.--.
ENSGACP00000020574  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000003950  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000000644  ....................------------..------.--.....--............--.....-----.-C.
ENSGACP00000017218  ....................------------..------.--.....--............--.....LVSCS.DC.
ENSGACP00000010144  ....................-----QHEMLYC..QVCCEP.FH.....EFcldpa.......D-.....-----.--.
ENSGACP00000006025  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000017212  ....................------------..------.--.....--............--.....LVSCS.DC.
ENSGACP00000016773  ....................----------LC..PVCKTTeLN.....VHskdl........PN.....HKTCS.HC.
ENSGACP00000011913  ....................--------FVFC..QVCCEP.FH.....LFclgelerplqeqFE.....NWCCR.RC.
ENSGACP00000011572  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000021016  ....................------------..------.--.....--............--.....-----.--.
ENSGACP00000026973  ....................------------..------.--.....--............--.....-VSCS.DC.
ENSGACP00000017070  ....................-----------C..SVCLDP.LDpv...LS............FS.....VLKCP.SC.
ENSGACP00000011950  ....................--------SSVC..GVCSKA.AD.....PS............VT.....LLSCS.VC.
ENSGACP00000024645  ....................----------MC..SSCHRP.GAt....IG............CD.....VKTCR.RT.
ENSGACP00000009407  ....................----DDGYQSYC..TICCGG.REv....LM............CG.....NNNCC.RC.
ENSGACP00000013579  ....................----DDGYQSYC..TVCCGG.REv....LL............CG.....NANC-.-C.
ENSGACP00000007778  ....................----------FC..LGGSKK.TG.....CP............ED.....LISCA.DC.
ENSGACP00000023303  ....................------------..------.--.....--............EG.....LVSCS.DC.

d1wfka_               ....GR.......A....FCNGC......LSFSALVP....R....................................
ENSGACP00000024062  ....TR.......M....FHDGC......LRELGYLR....Eealqemkdt...........................
ENSGACP00000015154  ....--.......-....-----......--------....-....................................
ENSGACP00000014941  ....KK.......N....MCTKC......GTQCGSRP....-....................................
ENSGACP00000023919  ....QT.......K....FCARC......GGRVSLRS....N....................................
ENSGACP00000020542  ....NK.......H....MCSQC......GINGSS--....-....................................
ENSGACP00000020537  ....NK.......H....MCSQC......GINGSS--....-....................................
ENSGACP00000022920  ....NH.......H....VCSKC......RTVL----....-....................................
ENSGACP00000004384  ....QL.......R....VCDEC......RVTT----....-....................................
ENSGACP00000003339  ....QY.......N....VCKTC......CTYN----....-....................................
ENSGACP00000022478  ....GY.......N....VCKAC......RVYN----....-....................................
ENSGACP00000001097  ....--.......-....-----......--------....-....................................
ENSGACP00000000841  ....GK.......W....FCPQC......T-------....-....................................
ENSGACP00000014629  ....GK.......W....FCPRC......TQ------....-....................................
ENSGACP00000007838  ....GE.......G....FCDRC......SSKAAPVP....E....................................
ENSGACP00000017070  ....DA.......L....VCL-C......SDGRTHSA....K....................................
ENSGACP00000013626  ....S-.......-....-----......--------....-....................................
ENSGACP00000006381  ....QT.......K....FCARC......GGRVS---....L....................................
ENSGACP00000013239  ....SH.......R....ICRKC......RVGV----....-....................................
ENSGACP00000004599  ....--.......-....-----......--------....-....................................
ENSGACP00000018041  ....GY.......V....VCWKC......SDNKVALQ....Y....................................
ENSGACP00000021274  ....GE.......I....FCNSC......SDNELPLP....A....................................
ENSGACP00000010944  ....GK.......I....FCSRC......SSHSAPLP....R....................................
ENSGACP00000021273  ....GE.......I....FCNSC......SDNELPLP....A....................................
ENSGACP00000023448  ....GF.......V....VCGPC......SERKHLLP....S....................................
ENSGACP00000017175  ....GE.......G....FCESC......SSKTRPVP....E....................................
ENSGACP00000024268  ....GD.......I....YCNSC......SSNELALP....S....................................
ENSGACP00000023917  ....QT.......K....FCARC......GGRVSLRS....N....................................
ENSGACP00000021908  ....GK.......V....FCATC......CSLKCRLE....Y....................................
ENSGACP00000013976  ....GQ.......I....FCGKC......SSKYSTIP....K....................................
ENSGACP00000015502  ....GN.......I....FCAEC......SMRNAFTP....S....................................
ENSGACP00000017883  ....GN.......V....FCASC......CDQKLPVP....S....................................
ENSGACP00000006350  ....GR.......C....FCDKC......CSKKVALP....R....................................
ENSGACP00000007838  ....GQ.......G....VCDDC......SPERRSVP....S....................................
ENSGACP00000018905  ....GQ.......L....FCQKC......SRFQSEIK....R....................................
ENSGACP00000010464  ....SR.......V....YHLDC......LDPPLKTI....P....................................
ENSGACP00000025262  ....GC.......V....VCWKC......SDNKVALA....Y....................................
ENSGACP00000011630  ....GQ.......I....FCSRC......CNQEIPGK....F....................................
ENSGACP00000017175  ....GQ.......G....VCDDC......SQGRRAVP....S....................................
ENSGACP00000011590  ....QD.......W....FHGSC......VGVEED--....K....................................
ENSGACP00000011699  ....NI.......A....VHQEC......YG--VPYV....P....................................
ENSGACP00000000108  ....NL.......A....VHQEC......YGVPYI--....-....................................
ENSGACP00000005477  ....DR.......G....HHTHC......LRPRLKAV....P....................................
ENSGACP00000020092  ....--.......L....LCDGCdrg...CHMYCLRP....K....................................
ENSGACP00000016270  ....GR.......L....VCQSC......SEHKMSVE....G....................................
ENSGACP00000026721  ....GR.......L....LCHKC......SIKEIPII....K....................................
ENSGACP00000010109  ....--.......-....-----......--------....-....................................
ENSGACP00000026720  ....GR.......L....LCHKC......SIKEIPII....K....................................
ENSGACP00000007778  ....GTsenddqlL....FCDDC......DRGYHMYClsp.P....................................
ENSGACP00000025128  ....NA.......A....VHQEC......YGVPYI--....-....................................
ENSGACP00000025131  ....NA.......A....VHQEC......YGVPYI--....-....................................
ENSGACP00000026741  ....GN.......V....FCKDC......CHLKLPIP....D....................................
ENSGACP00000000293  ....GK.......A....VCGKC......SSKRTAFP....V....................................
ENSGACP00000016095  ....GRgdddeklL....LCDGC......DDNYHTYC....L....................................
ENSGACP00000005831  ....DD.......W....YHWPC......VGITAEPP....E....................................
ENSGACP00000009463  ....GF.......L....VCNAC......STKRAVIS....H....................................
ENSGACP00000006044  ....NI.......C....VHQAC......YGIQ----....-....................................
ENSGACP00000016061  ....NE.......W....FHGHC......INITEKT-....-....................................
ENSGACP00000002833  ....DR.......G....FHMEC......CDPPLSRM....P....................................
ENSGACP00000018281  ....NI.......C....VHQAC......YGIV--KV....P....................................
ENSGACP00000020042  ....DK.......G....CHTYC......HKPKIT--....-....................................
ENSGACP00000025092  ....--.......-....-----......----CLIP....P....................................
ENSGACP00000013214  ....EE.......W....FHGDC......VGITEAR-....-....................................
ENSGACP00000024472  ....TN.......W....YHGDC......VGITEKEA....K....................................
ENSGACP00000015547  ....GR.......I....FCYYC......SNNFVMTK....H....................................
ENSGACP00000023173  ....HN.......L....YHQDC......HKPQVTDK....E....................................
ENSGACP00000023303  ....GTsenddqlL....FCDDC......DRGYHMYC....L....................................
ENSGACP00000023170  ....HN.......L....YHQDC......HKPQVTDK....E....................................
ENSGACP00000020052  ....QD.......W....FHGDC......VGITASKGr...K....................................
ENSGACP00000005279  ....QT.......K....FCARC......GGRVSLRS....N....................................
ENSGACP00000017218  ....GTsenddqlL....FCDDC......DRGYHMYC....L....................................
ENSGACP00000017301  ....DR.......G....FHMEC......CDPPLTRM....P....................................
ENSGACP00000006514  ....NL.......A....VHQEC......YGVP--YI....-....................................
ENSGACP00000024472  ....QN.......W....YHGRC......VGIL--QS....E....................................
ENSGACP00000001615  ....NL.......A....VHQEC......YGV--PYV....P....................................
ENSGACP00000009172  ....QN.......W....YHGRC......VGILQ--S....E....................................
ENSGACP00000003894  ....GS.......I....MCRRC......MEFV-PIP....Lartrgsisslssvtsmlee.................
ENSGACP00000000323  ....GR.......A....VCAKC......SSRRSAIP....L....................................
ENSGACP00000024469  ....QN.......W....YHGRC......VGIL--QS....E....................................
ENSGACP00000015717  ....LA.......Q....ECN--......--------....-....................................
ENSGACP00000026389  ....KD.......W....FHGGC......VQVEEHHA....V....................................
ENSGACP00000005811  ....--.......-....-----......--------....-....................................
ENSGACP00000027580  ....GLpnqpeliL....LCDSC......DSGYHTAC....L....................................
ENSGACP00000015027  ....--.......-....-CDAG......YHMECLTP....P....................................
ENSGACP00000013235  ....SH.......R....ICRKC......RVGV----....-....................................
ENSGACP00000000735  ....PR.......A....FHPDC......LHPPLKTP....P....................................
ENSGACP00000025482  ....--.......-....-----......--------....-....................................
ENSGACP00000000654  ....GKgtaedrlL....LCDGCdds...YHIFCLIP....P....................................
ENSGACP00000011950  ....DK.......Gyht.FCLQP......AMDSLPSD....P....................................
ENSGACP00000019137  ....GF.......L....VCAAC......SKTRAVIQ....H....................................
ENSGACP00000007576  ....QKgdneellL....LCDGCdkg...CHTYCQIP....R....................................
ENSGACP00000025078  ....PK.......V....FHLAC......---HIPAL....N....................................
ENSGACP00000025482  ....KDggel...L....CCDAC......TSSYHIHC....L....................................
ENSGACP00000027499  ....PA.......A....FHREC......LNIEMP--....-....................................
ENSGACP00000026973  ....GTsenddqlL....FCDDC......DRGYHMYC....L....................................
ENSGACP00000020043  ....DK.......-....----G......CHTYCHKP....K....................................
ENSGACP00000001497  ....FM.......I....GCDCC......TEWFHGRC....Vgvseka..............................
ENSGACP00000001499  ....FM.......I....GCDCC......TEWFHGRC....Vgvseka..............................
ENSGACP00000006025  ....PA.......A....FHPDC......LNIAMPD-....-....................................
ENSGACP00000018107  ....PL.......L....F----......--------....-....................................
ENSGACP00000013248  ....PR.......V....YHAKC......LKLPA---....-....................................
ENSGACP00000013240  ....PR.......V....YHAKC......LKLPA---....-....................................
ENSGACP00000025092  ....KD.......W....FHGAC......VP------....-....................................
ENSGACP00000020067  ....PR.......V....YHAKC......LKLPA---....-....................................
ENSGACP00000020064  ....PR.......V....YHAKC......LKLPA---....-....................................
ENSGACP00000003887  ....GS.......I....MCRRC......MEFV-PIP....Lahklingtrealcvpgspvqsqsppagvvcvggggm
ENSGACP00000009172  ....HR.......LgellCCETC......FAVYHLEC....V....................................
ENSGACP00000018107  ....--.......-....CCNPP......LSEEMLPP....-....................................
ENSGACP00000008447  ....GR.......S....FCSGC......LTLSAVVP....R....................................
ENSGACP00000013318  ....ED.......C....LCWQH......GTCMGLLE....-....................................
ENSGACP00000023975  ....PA.......A....FHQEC......LNIEMPQ-....-....................................
ENSGACP00000021324  ....EM.......M....FCDKC......DRGYHTFCv...G....................................
ENSGACP00000024469  ....HR.......LgdllCCETC......SAVYHLEC....V....................................
ENSGACP00000025644  ....GI.......W....VHLSC......AKIKKS--....-....................................
ENSGACP00000021322  ....EM.......M....FCDKC......DRGYHTFCv...G....................................
ENSGACP00000006576  ....PK.......V....FHMKC......HVPTIKIF....P....................................
ENSGACP00000004363  ....--.......I....QCEKC......MVWQHFDCm...R....................................
ENSGACP00000010812  ....ED.......W....FHSRH......LGCTTADP....E....................................
ENSGACP00000014875  ....DS.......G....YHTDC......LTP---SS....D....................................
ENSGACP00000010801  ....ED.......W....FHSRH......LGCTTADP....E....................................
ENSGACP00000010820  ....ED.......W....FHSRH......LGCTTADP....E....................................
ENSGACP00000025648  ....GI.......W....VHLSC......AKIKKS--....-....................................
ENSGACP00000017361  ....GQ.......W....FHEAC......TQCLTKPL....L....................................
ENSGACP00000019138  ....GF.......L....VCAAC......SKTRAVIQ....H....................................
ENSGACP00000017696  ....DI.......S....YHTYC......LDPPLQNV....P....................................
ENSGACP00000020648  ....PK.......V....FHLSC......HIPSLLSF....P....................................
ENSGACP00000017212  ....G-.......-....-----......-------T....S....................................
ENSGACP00000022692  ....GR.......P....FCYYC......CSNAVSTQ....Q....................................
ENSGACP00000015673  ....KK.......S....FCSLC......SVLQ----....-....................................
ENSGACP00000000098  ....GA.......S....ICAKC......SKNL----....-....................................
ENSGACP00000011071  ....PR.......S....FHKKC......HL---PHV....E....................................
ENSGACP00000015670  ....KK.......S....FCSLC......SVLQ----....-....................................
ENSGACP00000020670  ....GK.......G....YHQLC......HSPTIDAS....V....................................
ENSGACP00000014147  ....QQ.......W....FHEAC......TQCLQESM....M....................................
ENSGACP00000015669  ....KK.......S....FCSLC......SVLQ----....-....................................
ENSGACP00000022498  ....KK.......S....FCALC......SVLQ----....-....................................
ENSGACP00000010520  ....NT.......W....IHLSC......AKIR----....-....................................
ENSGACP00000022225  ....NM.......A....FHIYC......LNPP--LA....T....................................
ENSGACP00000017974  ....--.......-....-----......--------....-....................................
ENSGACP00000018002  ....--.......-....-----......--------....-....................................
ENSGACP00000017984  ....--.......-....-----......--------....-....................................
ENSGACP00000017361  ....RH.......G....YHAEC......HTPA--IE....P....................................
ENSGACP00000003271  ....GP.......W....FCRKC......ESQ-----....-....................................
ENSGACP00000020670  ....LQ.......W....FHEAC......LHCLQIPM....F....................................
ENSGACP00000026393  ....--.......I....CCDKC......SAWQL---....-....................................
ENSGACP00000011950  ....DV.......S....YHTYC......LDPPLHNV....P....................................
ENSGACP00000015717  ....NQ.......W....FHQVC......VGVTAEM-....-....................................
ENSGACP00000014147  ....GI.......G....FHQQC......HL-----P....P....................................
ENSGACP00000017696  ....DKgyh....T....FCLQP......AIDSLPTN....G....................................
ENSGACP00000023950  ....GP.......W....FCRKC......ESQ-----....-....................................
ENSGACP00000011559  ....DM.......A....FHTYC......LNPPLTTI....P....................................
ENSGACP00000000643  ....ES.......C....LCWQH......GTC-MGLY....E....................................
ENSGACP00000008022  ....ED.......W....FHGDC......VGLDLTKVr...E....................................
ENSGACP00000016773  ....KN.......T....VCNQC......GFNPMPNV....S....................................
ENSGACP00000000096  ....GV.......T....VHEGCygvdgeSDSIMSSA....S....................................
ENSGACP00000004788  ....AR.......L....FHLWC......HVPTLL--....-....................................
ENSGACP00000000654  ....RE.......V....FHCDC......VTTTADL-....-....................................
ENSGACP00000000096  ....YH.......F....GCLDP......PLKKSPKQ....T....................................
ENSGACP00000025018  ....GN.......S....FCSRC......CSFKVLRS....C....................................
ENSGACP00000004795  ....AR.......L....FHLWC......HVPTLL--....-....................................
ENSGACP00000015717  ....G-.......-....-----......--------....-....................................
ENSGACP00000000654  ....--.......-....--DGS......CNQWFHQI....-....................................
ENSGACP00000001522  ....--.......T....VCEAC......GE------....A....................................
ENSGACP00000015330  ....QL.......W....QHADC......VNYKEESR....E....................................
ENSGACP00000023975  ....--.......-....-----......--------....-....................................
ENSGACP00000027499  ....--.......-....-----......--------....-....................................
ENSGACP00000007442  ....NG.......Q....VCNLC......GFNPTPHL....V....................................
ENSGACP00000001522  ....GQ.......C....YHPYC......VSVKVTRV....V....................................
ENSGACP00000002045  ....HH.......Q....VCNMC......GFNPTPHL....V....................................
ENSGACP00000017696  ....DR.......W....FHASC......QALHSDED....V....................................
ENSGACP00000007451  ....DR.......K....DCP--......--------....-....................................
ENSGACP00000010144  ....QN.......C....FHTSC......LGPNYPKQ....N....................................
ENSGACP00000026147  ....KK.......T....VCNLC......GFNPTPHL....V....................................
ENSGACP00000005914  ....QR.......W....FHRDC......TGLTEPAYgll.T....................................
ENSGACP00000006025  ....GK.......K....TCSKA......YHLYCLNL....-....................................
ENSGACP00000019076  ....EG.......V....FCEGC......VSNELPLA....S....................................
ENSGACP00000005969  ....QK.......D....YCCRC......SAQLEP--....-....................................
ENSGACP00000011913  ....KH.......W....VHAKC......ESLTDEMYellsK....................................
ENSGACP00000011913  ....RN.......S....YHPEC......LGPNHPTR....P....................................
ENSGACP00000007451  ....--.......-....--PEC......LEMETPA-....-....................................
ENSGACP00000017696  ....GQ.......C....YHPFC......VGIKITKV....V....................................
ENSGACP00000006814  ....KR.......P....VCSPC......SRKM----....-....................................
ENSGACP00000011950  ....GQ.......H....YHAAC......LEIGATPI....Q....................................
ENSGACP00000026887  ....SN.......A....FCKKC......ILRNLGRK....E....................................
ENSGACP00000011950  ....DR.......W....VHAVC......ESLYTEDE....V....................................
ENSGACP00000005612  ....QT.......S....YHPSC......LGPTYPKP....M....................................
ENSGACP00000010144  ....NH.......W....VHAKC......EDLTDELYeilsS....................................
ENSGACP00000007451  vygeGL.......L....VCEGD......CGRQFHLD....C....................................
ENSGACP00000006810  ....KR.......P....VCSPC......SRKM----....-....................................
ENSGACP00000005612  ....SH.......Wihy.TCEGL......SDELFGLL....S....................................
ENSGACP00000002045  ....CS.......M....VCTQC......GFN--PNP....H....................................
ENSGACP00000026886  ....SN.......A....FCKKC......ILRNLGRK....E....................................
ENSGACP00000021682  ....AQ.......I....VHPAC......LTVQGEGV....V....................................
ENSGACP00000007442  ....KS.......T....VCNQC......GFN--PNP....H....................................
ENSGACP00000011950  ....YH.......P....YCVNS......KITKTMLR....-....................................
ENSGACP00000017696  ....GQ.......H....YHGMC......LDMAVTPL....R....................................
ENSGACP00000023440  ....SQ.......I....VHHQC......IKEPGDGK....I....................................
ENSGACP00000006081  ....KK.......P....VCAQC......CKKM----....-....................................
ENSGACP00000022493  ....NE.......I....VHPNC......LKVKDSNG....V....................................
ENSGACP00000015690  ....NE.......I....VHPNC......LKVSDASG....V....................................
ENSGACP00000021324  ....DN.......S....GHPSC......LDMSKELV....G....................................
ENSGACP00000024087  ....NN.......A....FCKKC......ILRNLGRK....E....................................
ENSGACP00000021322  ....DN.......S....GHPSC......LDMSKELV....G....................................
ENSGACP00000006076  ....KK.......P....VCAQC......CKKM----....-....................................
ENSGACP00000022489  ....NE.......I....VHPNC......LKVKDSNG....V....................................
ENSGACP00000006064  ....KK.......P....VCAQC......CKKM----....-....................................
ENSGACP00000016095  ....KD.......W....FHGGC......VPSPALLP....Ssgpagnplcw..........................
ENSGACP00000026147  ....KN.......Q....VCSLC......GFS--PPD....S....................................
ENSGACP00000019496  ....NE.......I....IHPSC......LKMGKAEGii..I....................................
ENSGACP00000005612  ....--.......-....-----......--------....-....................................
ENSGACP00000020574  ....--.......V....SCAQC......CVRVHTSC....Ygvpe................................
ENSGACP00000003950  ....--.......-....SCSQC......SIRVHTSCygvdP....................................
ENSGACP00000000644  ....ES.......C....LCWQH......GTCM-GLY....E....................................
ENSGACP00000017218  ....GR.......S....GHPTC......LQFTDNMM....Q....................................
ENSGACP00000010144  ....--.......-....-----......------RP....S....................................
ENSGACP00000006025  ....--.......-....-C---......--------....-....................................
ENSGACP00000017212  ....GR.......S....GHPTC......LQFTDNMM....Q....................................
ENSGACP00000016773  ....KT.......E....VCNLC......GFS---PP....D....................................
ENSGACP00000011913  ....R-.......-....FCQAC......G-------....-....................................
ENSGACP00000011572  ....--.......-....CCSSC......HMQ-VHAS....C....................................
ENSGACP00000021016  ....--.......L....YCQGC......CLQVHASC....Ygvaa................................
ENSGACP00000026973  ....GR.......S....GHPSC......LQFTPVMM....A....................................
ENSGACP00000017070  ....HS.......S....-----......--------....-....................................
ENSGACP00000011950  ....HR.......W....VHSEC......ALPEE---....-....................................
ENSGACP00000024645  ....Y-.......-....-----......--------....-....................................
ENSGACP00000009407  ....--.......-....FCVEC......VDLLV---....-....................................
ENSGACP00000013579  ....RS.......C....FCVDC......LDILVDPG....A....................................
ENSGACP00000007778  ....GR.......S....GHLSC......LQFTVNMT....A....................................
ENSGACP00000023303  ....GR.......S....GHPTC......LQFTPVMM....A....................................

                                         50                    60        70        80               
                                          |                     |         |         |               
d1wfka_               ...................AG........NT....QQKVCKQCHTILTRGSSDNASKWSPPQ---------nyksgps
ENSGACP00000024062  ...................AH........TV....TGWSCYYCDN--------------------------lnlllte
ENSGACP00000015154  ...................--........--....WIKCCLGCQVDPNIWEPYYS----------------telhrpa
ENSGACP00000014941  ...................--........-R....AVWLCKICREQREVWKRSGAWFF-------------kgfpkqf
ENSGACP00000023919  ...................NE........DKv...VMWVCNLCRKQQEILTKSG-----------------ewfsesg
ENSGACP00000020542  ...................-R........TS....PVWLCRICNEQQEVQKRS------------------gawffkg
ENSGACP00000020537  ...................-R........TS....PVWLCRICNEQQEVQKRS------------------gawffkg
ENSGACP00000022920  ...................--........PE....GSWLCTVCAKESDLK---------------------krtgdwf
ENSGACP00000004384  ...................-P........KR....HQWRCNVCAKIS------------------------elkevtg
ENSGACP00000003339  ...................-K........KD....KAWLCSACQKGRVLRTQSLEWYYNNVKS--------rfkrfg.
ENSGACP00000022478  ...................-Q........RD....KAWLCSACQKSRLLKTQSLEWFYTNVKT--------rfkrfg.
ENSGACP00000001097  ...................--........--....------------------------------------r......
ENSGACP00000000841  ...................--........--....------------------------------------vamk...
ENSGACP00000014629  ...................--........--....------------------------------------dkkk...
ENSGACP00000007838  ...................RG........WGla..PVRVCDGCFEQRAAYAELLE----------------aepee..
ENSGACP00000017070  ...................TG........WF....QVIRCQLCGSR-------------------------gthrkcw
ENSGACP00000013626  ...................--........--....------------------------------------qdr....
ENSGACP00000006381  ...................RS........NK....VMWVCNLCRKQQEILTKS------------------gawffdp
ENSGACP00000013239  ...................--........-Ga...TGWKCTVCHAYRDVKFRS------------------gewfleq
ENSGACP00000004599  ...................--........--....------------------------------------r......
ENSGACP00000018041  ...................DG........NK....TNKVCRDCFSI-------------------------l......
ENSGACP00000021274  ...................-S........PK....PVRVCDTCHALLLQR---------------------cs.....
ENSGACP00000010944  ...................YG........QVk...PVRVCTHCYMF-------------------------hv.....
ENSGACP00000021273  ...................-S........PK....PVRVCDTCHALLLQR---------------------cs.....
ENSGACP00000023448  ...................QS........SK....PVRVCEFCFVQL------------------------t......
ENSGACP00000017175  ...................RG........WGla..PVRVCDACFHNRGI----------------------ptellda
ENSGACP00000024268  ...................Y-........PR....PVRVCDACHALLLQR---------------------ss.....
ENSGACP00000023917  ...................NE........DKv...VMWVCNLCRKQQEILTKSG-----------------ewfsesg
ENSGACP00000021908  ...................MD........RK....EARVCVTCHPALTSDRNLVSS---------------vsls...
ENSGACP00000013976  ...................FG........IEk...EVRVCEPCFELLN-----------------------k......
ENSGACP00000015502  ...................-S........KK....PVRVCETCFDE-------------------------l......
ENSGACP00000017883  ...................QQ........LFe...PSRVCKTCYGSL------------------------kl.....
ENSGACP00000006350  ...................MC........FVd...PVRQCAECSLNSQKEAE-------------------fyd....
ENSGACP00000007838  ...................RG........WDh...PVRVCTGCNQ--------------------------k......
ENSGACP00000018905  ...................LK........ISs...PVRVCQNCHYNLQH----------------------ers....
ENSGACP00000010464  ...................--........-K....GMWICPKCQDQILKKEE-------------------aipw...
ENSGACP00000025262  ...................DC........NK....LNKVCKSCFSI-------------------------l......
ENSGACP00000011630  ...................MG........YTg...DLRACTYCRKIALSYAHS------------------tds....
ENSGACP00000017175  ...................RG........WDh...PVRVCSGCSQ--------------------------k......
ENSGACP00000011590  ...................AT........-Ei...DLYHCPNCQ---------------------------vthgpsv
ENSGACP00000011699  ...................EG........QW....LCRHCLQCP---------------------------arpadcv
ENSGACP00000000108  ...................--........PE....GQWLCRRCLQSPS-----------------------ravdcal
ENSGACP00000005477  ...................EG........D-....--WFCPDC----------------------------rpkqr..
ENSGACP00000020092  ...................IT........QVpe..GDWFCPTCVAK-------------------------trtrv..
ENSGACP00000016270  ...................CP........GDe...EVRVCNECYAYF------------------------hp.....
ENSGACP00000026721  ...................FD........LNk...PVRVCDICFDV-------------------------l......
ENSGACP00000010109  ...................--........--....------------------------------------qptva..
ENSGACP00000026720  ...................FD........LNk...PVRVCDICFDV-------------------------l......
ENSGACP00000007778  ...................MS........EPpe..GSWSCHLCLRHLK-----------------------ek.....
ENSGACP00000025128  ...................--........PE....GQWLCRHCL---------------------------qaparpa
ENSGACP00000025131  ...................--........PE....GQWLCRHCL---------------------------qaparpa
ENSGACP00000026741  ...................QQ........LYd...AVLVCNSCHDLL------------------------lv.....
ENSGACP00000000293  ...................MG........FEf...PVRVCDACFDTVKEEDRTPLA---------------tfhegkh
ENSGACP00000016095  ...................LPpltdp...PK....GNWRCPKCV---------------------------aaeckkp
ENSGACP00000005831  ...................--........-D....QQWFCVKCAS--------------------------rkkd...
ENSGACP00000009463  ...................IH........PTk...LLRVCRLCDQ--------------------------rr.....
ENSGACP00000006044  ...................-K........VPk...GSWLCRICAL--------------------------gilpkcq
ENSGACP00000016061  ...................AK........AI....REWYCMRCRDK-------------------------nptleik
ENSGACP00000002833  ...................KG........TW....ICQVCR------------------------------pkengkk
ENSGACP00000018281  ...................VG........NW....L---CRTCV---------------------------lgidpqc
ENSGACP00000020042  ...................-S........IPe...GDWYCPACIS--------------------------klk....
ENSGACP00000025092  ...................LQ........DVpk..GDWRCPKCV---------------------------aeecskp
ENSGACP00000013214  ...................--........--....------------------------------------grlmern
ENSGACP00000024472  ...................--........KM....DDYICVECK---------------------------rgq....
ENSGACP00000015547  ...................-S........GK....KERCCRECYTQHSVVVERFT----------------qaelsp.
ENSGACP00000023173  ...................VN........DPr...LVWYCARCTRQMKRM---------------------aqk....
ENSGACP00000023303  ...................SPpmtep...PE....GSWSCHLCL---------------------------lll....
ENSGACP00000023170  ...................VN........DPr...LVWYCARCTRQMKRM---------------------aqk....
ENSGACP00000020052  ...................ME........RKg...EEYICPPCTT--------------------------kmr....
ENSGACP00000005279  ...................TE........DKv...VIWVCNNCRKQQELLTKP------------------gewftgp
ENSGACP00000017218  ...................KPpmtkp...PE....GSWSCHVCLDL-------------------------l......
ENSGACP00000017301  ...................KG........--....-MWICQICQ---------------------------prkkgkr
ENSGACP00000006514  ...................--........PE....GQWLCRCCLQSPQ-----------------------kpvdcvl
ENSGACP00000024472  ...................AN........HI....DQYVCPQCQS--------------------------t......
ENSGACP00000001615  ...................E-........--....GQWLCRCCL---------------------------qspsrpv
ENSGACP00000009172  ...................AT........HI....DVYVCPQCQS--------------------------t......
ENSGACP00000003894  ...................KD........DE....KIRCCRHCMDTLLKRQQKL-----------------eekd...
ENSGACP00000000323  ...................MG........FEf...EVRVCDGCHESISDEDRAPTVTFHD-----------skhg...
ENSGACP00000024469  ...................AN........HI....DQYVCPQCQS--------------------------t......
ENSGACP00000015717  ...................--........--....------------------------------------kph....
ENSGACP00000026389  ...................--........-Di...DVYHCPNCD---------------------------vvhgpsl
ENSGACP00000005811  ...................--........--....------------------------------------eke....
ENSGACP00000027580  ...................RPplm.....IIpd..GEWFCPPCQH--------------------------kllc...
ENSGACP00000015027  ...................LD........SVpv..EEWFCPGC----------------------------eas....
ENSGACP00000013235  ...................--........-Ga...TGWKCTVCHAYRDVKFRS------------------gewfleq
ENSGACP00000000735  ...................RG........PW....---YCPKCQKK-------------------------vln....
ENSGACP00000025482  ...................--........--....------------------------------------eke....
ENSGACP00000000654  ...................LH........DVpk..GDWRCPKCL---------------------------aqecgkp
ENSGACP00000011950  ...................WK........CR....RCRVCMEC----------------------------gvrg...
ENSGACP00000019137  ...................IH........PTk...CWRICIGCHSN-------------------------sst....
ENSGACP00000007576  ...................IT........TVpd..GDWFCPTC----------------------------vakg...
ENSGACP00000025078  ...................ES........PS....GEWFCSLC----------------------------rd.....
ENSGACP00000025482  ...................NPplp.....EIpn..GEWLCPRCTCQLI-----------------------kgrvqki
ENSGACP00000027499  ...................--........-K....GSWYCNDCKAGKKPR---------------------fkdilwv
ENSGACP00000026973  ...................NPpmaeppevWQq...GSWSCHLCLEL-------------------------lk.....
ENSGACP00000020043  ...................IT........SIpe..GDWYCPACIS--------------------------kasgp..
ENSGACP00000001497  ...................AK........SI....RVWFCPLCR---------------------------gqtk...
ENSGACP00000001499  ...................AK........SI....RVWFCPLCR---------------------------gqtk...
ENSGACP00000006025  ...................--........--....GSWFCNDCRA--------------------------gkkpkyr
ENSGACP00000018107  ...................--........--....------------------------------------hmdclnp
ENSGACP00000013248  ...................-E........PE....GDWFCPEC----------------------------ek.....
ENSGACP00000013240  ...................-E........PE....GDWFCPEC----------------------------ek.....
ENSGACP00000025092  ...................--........--....------------------------------------lpktgtq
ENSGACP00000020067  ...................-E........PE....GDWFCPEC----------------------------ek.....
ENSGACP00000020064  ...................-E........PE....GDWFCPEC----------------------------ek.....
ENSGACP00000003887  gsrrgsisslssvtsmleeKD........DE....KIRCCRHCMDTLLKRQQKL-----------------eekd...
ENSGACP00000009172  ...................KPple.....EVpe..DEWQCEICVA--------------------------hkvpgvt
ENSGACP00000018107  ...................--........--....GEWMCHRCN---------------------------vrkkkre
ENSGACP00000008447  ...................CG........NT....QQKVCKQCHGNLTGGESPN-----------------dagkwsp
ENSGACP00000013318  ...................DN........VP....DRYTCHIC----------------------------rd.....
ENSGACP00000023975  ...................--........--....GSWFCNDCKAG-------------------------krprikd
ENSGACP00000021324  ...................MD........SIpt..GLWVCEVCEK--------------------------dcp....
ENSGACP00000024469  ...................KPplq.....EVpe..DEWQCEVCV---------------------------ahk....
ENSGACP00000025644  ...................-N........VP....DIFYCHKCR---------------------------dl.....
ENSGACP00000021322  ...................MD........SIpt..GLWVCEVCEK--------------------------dcp....
ENSGACP00000006576  ...................TG........DF....LCTFCR------------------------------s......
ENSGACP00000004363  ...................LE........SEv...EHYLCELC----------------------------dprpvdr
ENSGACP00000010812  ...................--........-El...QEMVCETCMNKAP-----------------------vlwtyaa
ENSGACP00000014875  ...................SG........PG....GDWICAQC----------------------------avt....
ENSGACP00000010801  ...................--........-El...QEMVCETCMNKAP-----------------------vlwtyaa
ENSGACP00000010820  ...................--........-El...QEMVCETCMNKAP-----------------------vlwtyaa
ENSGACP00000025648  ...................-N........VP....DIFYCHKC----------------------------r......
ENSGACP00000017361  ...................YG........DRf...YQFQCSVCTKGPETI---------------------qrlpmtw
ENSGACP00000019138  ...................IH........PTk...CWRICTGCHTNSSTR---------------------tteeaqr
ENSGACP00000017696  ...................KD........SW....KCKWCVSCTQ--------------------------cg.....
ENSGACP00000020648  ...................SG........D-....--WLCSLC----------------------------rdv....
ENSGACP00000017212  ...................EN........DD....QLLFCDDCDR--------------------------gyhmycl
ENSGACP00000022692  ...................-G........GH....RERCCSDCYNQHSAVTE-------------------rh.....
ENSGACP00000015673  ...................--........-E....NLRICATCHLLNATAFQRPLLMRLRVRDLRQYL---ll.....
ENSGACP00000000098  ...................-D........NK....TSRMCPECFEA-------------------------svs....
ENSGACP00000011071  ...................NG........LL....RPWFCTFCVFR-------------------------snehy..
ENSGACP00000015670  ...................--........-E....NLRICATCHLLNATAFQRPLLMRLRVRDLRQYL---ll.....
ENSGACP00000020670  ...................ID........SD....DKWLCSDCELT-------------------------crpk...
ENSGACP00000014147  ...................FG........DRf...YLFLCSVCNKGSEYV---------------------rrlslrw
ENSGACP00000015669  ...................--........-E....NLRICATCHLLNATAFQRPLLMRLRVRDLRQYL---ll.....
ENSGACP00000022498  ...................--........-E....NLRCCMTCHLLRGTAFQRPRLMRLRVKDLRQYL---llrn...
ENSGACP00000010520  ...................KS........HVp...ETYVCQSCRE--------------------------shgt...
ENSGACP00000022225  ...................IP........DD....EDWYCPTCK---------------------------ndtn...
ENSGACP00000017974  ...................--........--....QEMICESCM---------------------------nknpflw
ENSGACP00000018002  ...................--........--....QEMICESCM---------------------------nknpflw
ENSGACP00000017984  ...................--........--....QEMICESCM---------------------------nknpflw
ENSGACP00000017361  ...................EA........DS....DSWICRQCVFA-------------------------vatkrgg
ENSGACP00000003271  ...................--........--....------------------------------------eraarvr
ENSGACP00000020670  ...................YG........DRf...YLFICSVCN---------------------------ggpeyls
ENSGACP00000026393  ...................--........--....------------------------------------idcmgid
ENSGACP00000011950  ...................KG........GW....KCKWCVCCVQ--------------------------c......
ENSGACP00000015717  ...................-A........EK....EDYICVRC----------------------------tln....
ENSGACP00000014147  ...................VE........SSvsl.SPWFCRRCVF--------------------------alavrkg
ENSGACP00000017696  ...................WR........CK....SCRVCIQC----------------------------gtrt...
ENSGACP00000023950  ...................--........--....------------------------------------eraarvr
ENSGACP00000011559  ...................ED........--....EDWYCPGC----------------------------rnda...
ENSGACP00000000643  ...................HN........VP....HNYTCYYCRH--------------------------ta.....
ENSGACP00000008022  ...................ME........EEd...QMYVCLKCCE--------------------------e......
ENSGACP00000016773  ...................EG........--....KEWLCLNCQMQ-------------------------ra.....
ENSGACP00000000096  ...................EN........ST....EPWFCDACKNGV------------------------tpscelc
ENSGACP00000004788  ...................KY........PS....GEWLCSLC----------------------------rdp....
ENSGACP00000000654  ...................-E........YG....QAWLCPLCQRS-------------------------rkp....
ENSGACP00000000096  ...................--........-G....YGWICQDC----------------------------dt.....
ENSGACP00000025018  ...................MGatapeaq.RE....TVFVCAACN---------------------------ss.....
ENSGACP00000004795  ...................KY........PS....GEWLCSLC----------------------------rdp....
ENSGACP00000015717  ...................--........-T....QPWLCPLC----------------------------hr.....
ENSGACP00000000654  ...................--........--....------------------------------------cvglsad
ENSGACP00000001522  ...................SD........PG....RLLLCDDCDISYHTY---------------------cldppll
ENSGACP00000015330  ...................--........-T....TPFYCPHCLVAM------------------------kpvstg.
ENSGACP00000023975  ...................--........--....------------------------------------ivsckkp
ENSGACP00000027499  ...................--........--....------------------------------------mvsckrp
ENSGACP00000007442  ...................--........EK....KEWLCLNCQTQ-------------------------rl.....
ENSGACP00000001522  ...................LT........--....KGWRCLEC----------------------------t......
ENSGACP00000002045  ...................--........EK....KEWLCLNCQTQR------------------------alsgslg
ENSGACP00000017696  ...................EK........AAd...NNFDCTMCR---------------------------afkstkv
ENSGACP00000007451  ...................--........--....------------------------------------kayhllc
ENSGACP00000010144  ...................--........KKr...KAWVCMTCIR--------------------------ckscgvt
ENSGACP00000026147  ...................LQ........--....KEWLCLNCQTQRA-----------------------mtgqlad
ENSGACP00000005914  ...................RE........SA....AVWACDFCIKT-------------------------kdiq...
ENSGACP00000006025  ...................--........--....------------------------------------nkrpfgr
ENSGACP00000019076  ...................-S........IL....PETVCTACYSLLLQQ---------------------ya.....
ENSGACP00000005969  ...................--........--....RPRLCHTCQRFYGNLLERAELMKLKVKELRDYLHL-h......
ENSGACP00000011913  ...................LP........ES....VAYTCTKCTERH------------------------paewrta
ENSGACP00000011913  ...................TK........KK....RVWVCTKCVR--------------------------ckscga.
ENSGACP00000007451  ...................--........--....GPWSCSDC----------------------------ragkkph
ENSGACP00000017696  ...................LS........K-....-GWRCLEC----------------------------tv.....
ENSGACP00000006814  ...................--........--....------------------------------------rlpskp.
ENSGACP00000011950  ...................RA........GW....------------------------------------qcpeck.
ENSGACP00000026887  ...................LS........GIle..SKWYCYVCS---------------------------petlf..
ENSGACP00000011950  ...................EQ........ASd...EGFACTSCS---------------------------ayvpk..
ENSGACP00000005612  ...................-N........CN....MPWVCMTCIR--------------------------ckscgvt
ENSGACP00000010144  ...................LP........ES....VVYSCRPCSVTQ------------------------psawr..
ENSGACP00000007451  ...................LS........LTappeGRFTCLEC----------------------------m......
ENSGACP00000006810  ...................--........--....------------------------------------rlpsk..
ENSGACP00000005612  ...................SQ........PE....DSFTCSLCSEH-------------------------qte....
ENSGACP00000002045  ...................LT........EV....QEWLCLNCQMQR------------------------algmdm.
ENSGACP00000026886  ...................LS........GIle..SKWYCYVCS---------------------------petlf..
ENSGACP00000021682  ...................NK........DLp...SCWECPKC----------------------------vlgi...
ENSGACP00000007442  ...................LT........EV....QEWLCLNCQMQRA-----------------------lgidmtt
ENSGACP00000011950  ...................--........--....KGWRCLEC----------------------------iv.....
ENSGACP00000017696  ...................KA........GW....QCPECKIC----------------------------q......
ENSGACP00000023440  ...................ND........DLp...SCWECPKCYQ--------------------------gkd....
ENSGACP00000006081  ...................--........--....------------------------------------rlps...
ENSGACP00000022493  ...................VN........DElp..NCWECPKCNH--------------------------agktgkq
ENSGACP00000015690  ...................VN........DElp..NCWECPKCN---------------------------hagks..
ENSGACP00000021324  ...................VI........QT....YRWQCMEC----------------------------k......
ENSGACP00000024087  ...................LSvitd....EN....SKWHCYVCR---------------------------peplqdl
ENSGACP00000021322  ...................VI........QT....YRWQCMEC----------------------------k......
ENSGACP00000006076  ...................--........--....------------------------------------rlps...
ENSGACP00000022489  ...................VN........DElp..NCWECPKCN---------------------------hagkt..
ENSGACP00000006064  ...................--........--....------------------------------------rlps...
ENSGACP00000016095  ...................WD........WD....SRFLCPRCQR--------------------------srrpr..
ENSGACP00000026147  ...................AT........KG....KEWLCLNCQMQ-------------------------ra.....
ENSGACP00000019496  ...................DE........IP....NCWECPKCHK--------------------------egkpvry
ENSGACP00000005612  ...................KE........NK....ENWCCRRC----------------------------k......
ENSGACP00000020574  ...................DE........GEl...DDWLCTRC----------------------------ea.....
ENSGACP00000003950  ...................AS........VS....KEWKCVRCK---------------------------an.....
ENSGACP00000000644  ...................HN........VP....HNYTCYYCRHT-------------------------agwr...
ENSGACP00000017218  ...................AV........RT....YQWQCIEC----------------------------k......
ENSGACP00000010144  ...................EE........NK....ENWCCRRC----------------------------k......
ENSGACP00000006025  ...................--........--....------------------------------------gmfhlrc
ENSGACP00000017212  ...................AV........RT....YQWQCIECK---------------------------s......
ENSGACP00000016773  ...................SD........QG....REWLCLPCQ---------------------------iqr....
ENSGACP00000011913  ...................--........--....------------------------------------hqh....
ENSGACP00000011572  ...................YG........VK....PDSVCD------------------------------swmcsrc
ENSGACP00000021016  ...................AD........LS....EQWSCDRCAEG-------------------------sftaecc
ENSGACP00000026973  ...................AV........KT....YRWQCIEC----------------------------k......
ENSGACP00000017070  ...................--........--....-----------W------------------------fhrdcvq
ENSGACP00000011950  ...................-L........SE....AKCICQLCK---------------------------ege....
ENSGACP00000024645  ...................--........--....------------------------------------hyycal.
ENSGACP00000009407  ...................--........--....------------------------------------gpgsaat
ENSGACP00000013579  ...................SN........NAryl.DPWRCYMCQPTLQ-----------------------ygalkrr
ENSGACP00000007778  ...................AV........RT....YRWQCIEC----------------------------k......
ENSGACP00000023303  ...................AV........KT....YRWQCIEC----------------------------k......

d1wfka_               sg.........................................
ENSGACP00000024062  eemysl.....................................
ENSGACP00000015154  mifcsrgegghwvhaqcmdlsetlllrlsqgskryfcldhggl
ENSGACP00000014941  lps........................................
ENSGACP00000023919  v..........................................
ENSGACP00000020542  rvqqal.....................................
ENSGACP00000020537  rvqqal.....................................
ENSGACP00000022920  ydqrvnrfs..................................
ENSGACP00000004384  ewfleerskrf................................
ENSGACP00000003339  ...........................................
ENSGACP00000022478  ...........................................
ENSGACP00000001097  ...........................................
ENSGACP00000000841  ...........................................
ENSGACP00000014629  ...........................................
ENSGACP00000007838  ...........................................
ENSGACP00000017070  glkldardwacsdcte...........................
ENSGACP00000013626  ...........................................
ENSGACP00000006381  gp.........................................
ENSGACP00000013239  rakkfp.....................................
ENSGACP00000004599  ...........................................
ENSGACP00000018041  ...........................................
ENSGACP00000021274  ...........................................
ENSGACP00000010944  ...........................................
ENSGACP00000021273  ...........................................
ENSGACP00000023448  ...........................................
ENSGACP00000017175  alee.......................................
ENSGACP00000024268  ...........................................
ENSGACP00000023917  v..........................................
ENSGACP00000021908  ...........................................
ENSGACP00000013976  ...........................................
ENSGACP00000015502  ...........................................
ENSGACP00000017883  ...........................................
ENSGACP00000006350  ...........................................
ENSGACP00000007838  ...........................................
ENSGACP00000018905  ...........................................
ENSGACP00000010464  ...........................................
ENSGACP00000025262  ...........................................
ENSGACP00000011630  ...........................................
ENSGACP00000017175  ...........................................
ENSGACP00000011590  mrk........................................
ENSGACP00000011699  fcpnrgg....................................
ENSGACP00000000108  cpnkgg.....................................
ENSGACP00000005477  ...........................................
ENSGACP00000020092  ...........................................
ENSGACP00000016270  ...........................................
ENSGACP00000026721  ...........................................
ENSGACP00000010109  ...........................................
ENSGACP00000026720  ...........................................
ENSGACP00000007778  ...........................................
ENSGACP00000025128  dcilcpnkgg.................................
ENSGACP00000025131  dcilcpnkgg.................................
ENSGACP00000026741  ...........................................
ENSGACP00000000293  ni.........................................
ENSGACP00000016095  ...........................................
ENSGACP00000005831  ...........................................
ENSGACP00000009463  ...........................................
ENSGACP00000006044  lcpkkg.....................................
ENSGACP00000016061  y..........................................
ENSGACP00000002833  llh........................................
ENSGACP00000018281  llcpqkg....................................
ENSGACP00000020042  ...........................................
ENSGACP00000025092  r..........................................
ENSGACP00000013214  gedyicpnctakk..............................
ENSGACP00000024472  ...........................................
ENSGACP00000015547  ...........................................
ENSGACP00000023173  ...........................................
ENSGACP00000023303  ...........................................
ENSGACP00000023170  ...........................................
ENSGACP00000020052  ...........................................
ENSGACP00000005279  a..........................................
ENSGACP00000017218  ...........................................
ENSGACP00000017301  ll.........................................
ENSGACP00000006514  cpnrgg.....................................
ENSGACP00000024472  ...........................................
ENSGACP00000001615  dcvlcpnqgg.................................
ENSGACP00000009172  ...........................................
ENSGACP00000003894  ...........................................
ENSGACP00000000323  ...........................................
ENSGACP00000024469  ...........................................
ENSGACP00000015717  ...........................................
ENSGACP00000026389  mkrr.......................................
ENSGACP00000005811  ...........................................
ENSGACP00000027580  ...........................................
ENSGACP00000015027  ...........................................
ENSGACP00000013235  rakkfp.....................................
ENSGACP00000000735  ...........................................
ENSGACP00000025482  ...........................................
ENSGACP00000000654  ...........................................
ENSGACP00000011950  ...........................................
ENSGACP00000019137  ...........................................
ENSGACP00000007576  ...........................................
ENSGACP00000025078  ...........................................
ENSGACP00000025482  lhwr.......................................
ENSGACP00000027499  kv.........................................
ENSGACP00000026973  ...........................................
ENSGACP00000020043  ...........................................
ENSGACP00000001497  ...........................................
ENSGACP00000001499  ...........................................
ENSGACP00000006025  diiwvk.....................................
ENSGACP00000018107  pltalpagkwmcpnhieh.........................
ENSGACP00000013248  ...........................................
ENSGACP00000013240  ...........................................
ENSGACP00000025092  kkagggwqsnskdskflcplcqrsrrpr...............
ENSGACP00000020067  ...........................................
ENSGACP00000020064  ...........................................
ENSGACP00000003887  ...........................................
ENSGACP00000009172  ...........................................
ENSGACP00000018107  ...........................................
ENSGACP00000008447  ...........................................
ENSGACP00000013318  ...........................................
ENSGACP00000023975  ilwvkw.....................................
ENSGACP00000021324  ...........................................
ENSGACP00000024469  ...........................................
ENSGACP00000025644  ...........................................
ENSGACP00000021322  ...........................................
ENSGACP00000006576  ...........................................
ENSGACP00000004363  evpmi......................................
ENSGACP00000010812  h..........................................
ENSGACP00000014875  ...........................................
ENSGACP00000010801  h..........................................
ENSGACP00000010820  h..........................................
ENSGACP00000025648  ...........................................
ENSGACP00000017361  md.........................................
ENSGACP00000019138  v..........................................
ENSGACP00000017696  ...........................................
ENSGACP00000020648  ...........................................
ENSGACP00000017212  kppmtkppeg.................................
ENSGACP00000022692  ...........................................
ENSGACP00000015673  ...........................................
ENSGACP00000000098  ...........................................
ENSGACP00000011071  ...........................................
ENSGACP00000015670  ...........................................
ENSGACP00000020670  ...........................................
ENSGACP00000014147  vdl........................................
ENSGACP00000015669  ...........................................
ENSGACP00000022498  ...........................................
ENSGACP00000010520  ...........................................
ENSGACP00000022225  ...........................................
ENSGACP00000017974  tyaah......................................
ENSGACP00000018002  tyaa.......................................
ENSGACP00000017984  tyaa.......................................
ENSGACP00000017361  a..........................................
ENSGACP00000003271  celcphk....................................
ENSGACP00000020670  rlpltw.....................................
ENSGACP00000026393  rqnipetylyercqprhldrera....................
ENSGACP00000011950  ...........................................
ENSGACP00000015717  ...........................................
ENSGACP00000014147  gal........................................
ENSGACP00000017696  ...........................................
ENSGACP00000023950  celcphk....................................
ENSGACP00000011559  ...........................................
ENSGACP00000000643  ...........................................
ENSGACP00000008022  ...........................................
ENSGACP00000016773  ...........................................
ENSGACP00000000096  ...........................................
ENSGACP00000004788  ...........................................
ENSGACP00000000654  ...........................................
ENSGACP00000000096  ...........................................
ENSGACP00000025018  ...........................................
ENSGACP00000004795  ...........................................
ENSGACP00000015717  ...........................................
ENSGACP00000000654  raekedyicisct..............................
ENSGACP00000001522  tvpkgawkckwwvtr............................
ENSGACP00000015330  ...........................................
ENSGACP00000023975  gcpkvyhadclnlakrpagrwecpwhq................
ENSGACP00000027499  gcpkvyhadclnltkrpagrwecpwhq................
ENSGACP00000007442  ...........................................
ENSGACP00000001522  ...........................................
ENSGACP00000002045  d..........................................
ENSGACP00000017696  v..........................................
ENSGACP00000007451  lnltkppygrwecpwh...........................
ENSGACP00000010144  ...........................................
ENSGACP00000026147  v..........................................
ENSGACP00000005914  ...........................................
ENSGACP00000006025  wdcpwhh....................................
ENSGACP00000019076  ...........................................
ENSGACP00000005969  ...........................................
ENSGACP00000011913  ...........................................
ENSGACP00000011913  ...........................................
ENSGACP00000007451  ykqivw.....................................
ENSGACP00000017696  ...........................................
ENSGACP00000006814  ...........................................
ENSGACP00000011950  ...........................................
ENSGACP00000026887  ...........................................
ENSGACP00000011950  ...........................................
ENSGACP00000005612  p..........................................
ENSGACP00000010144  ...........................................
ENSGACP00000007451  ...........................................
ENSGACP00000006810  ...........................................
ENSGACP00000005612  ...........................................
ENSGACP00000002045  ...........................................
ENSGACP00000026886  ...........................................
ENSGACP00000021682  ...........................................
ENSGACP00000007442  ...........................................
ENSGACP00000011950  ...........................................
ENSGACP00000017696  ...........................................
ENSGACP00000023440  ...........................................
ENSGACP00000006081  ...........................................
ENSGACP00000022493  k..........................................
ENSGACP00000015690  ...........................................
ENSGACP00000021324  ...........................................
ENSGACP00000024087  vsk........................................
ENSGACP00000021322  ...........................................
ENSGACP00000006076  ...........................................
ENSGACP00000022489  ...........................................
ENSGACP00000006064  ...........................................
ENSGACP00000016095  ...........................................
ENSGACP00000026147  ...........................................
ENSGACP00000019496  ar.........................................
ENSGACP00000005612  ...........................................
ENSGACP00000020574  ...........................................
ENSGACP00000003950  ...........................................
ENSGACP00000000644  ...........................................
ENSGACP00000017218  ...........................................
ENSGACP00000010144  ...........................................
ENSGACP00000006025  lglslkpdekllcqecssgv.......................
ENSGACP00000017212  ...........................................
ENSGACP00000016773  ...........................................
ENSGACP00000011913  ...........................................
ENSGACP00000011572  aag........................................
ENSGACP00000021016  lc.........................................
ENSGACP00000026973  ...........................................
ENSGACP00000017070  rqahsaglfffrctlcsnqkdf.....................
ENSGACP00000011950  ...........................................
ENSGACP00000024645  ...........................................
ENSGACP00000009407  aikedpwncfmcgprssfgllr.....................
ENSGACP00000013579  hdw........................................
ENSGACP00000007778  ...........................................
ENSGACP00000023303  ...........................................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0050496 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Drosophila melanogaster 58 (pseudogenes) - Fruit fly
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Rattus norvegicus 58 (pseudogenes) - Norway rat
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Acaryochloris marina MBIC11017
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Thermaerobacter marianensis DSM 12885
NoYes   butyrate-producing bacterium SM4/1
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Candidatus Nitrospira defluvii
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Thermogladius cellulolyticus 1633
NoYes   Ignisphaera aggregans DSM 17230
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Desulfurococcus fermentans DSM 16532
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   Thermofilum pendens Hrk 5
NoYes   Pyrobaculum sp. 1860
NoYes   Pyrobaculum calidifontis JCM 11548
NoYes   Pyrobaculum arsenaticum DSM 13514
NoYes   Thermoproteus uzoniensis 768-20
NoYes   Thermoproteus tenax Kra 1
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella paludicola SANAE
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanospirillum hungatei JF-1
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Thermococcus sp. 4557
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus gammatolerans EJ3
NoYes   Methanobacterium sp. AL-21
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Methanotorris igneus Kol 5
NoYes   Methanosphaera stadtmanae DSM 3091
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB382
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae M22
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Arthrospira platensis NIES-39
NoYes   Ruminococcus champanellensis 18P13
NoYes   Clostridium saccharolyticum Clostridium cf. saccharolyticum K10
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Melissococcus plutonius ATCC 35311
NoYes   Desulfocapsa sulfexigens DSM 10523
NoYes   Myxococcus stipitatus DSM 14675
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Pseudomonas fluorescens F113
NoYes   Caldisphaera lagunensis DSM 15908
NoYes   Sulfolobus islandicus Y.G.57.14
NoYes   Sulfolobus acidocaldarius SUSAZ
NoYes   Sulfolobus acidocaldarius Ron12/I
NoYes   Methanomethylovorans hollandica DSM 15978
NoYes   Methanolobus psychrophilus R15
NoYes   Methanosarcina mazei Tuc01
NoYes   Methanoregula formicica Methanoregula formicicum SMSP
NoYes   Thermococcus sp. AM4
NoYes   Thermococcus sp. CL1
NoYes   Natronococcus occultus SP4
NoYes   Methanococcus maripaludis X1
NoYes   Methanococcus maripaludis C6
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Sorex araneus 69_1 - European shrew
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 69_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   2_050719S (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, filamentous community (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]