SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Virus ectodomain alignments

These alignments are sequences aligned to the 0053406 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

d1eboc_ qiedkieeilskiyhien..........................................................................
d1enva_ qiedkieeilskiyhieneiarikkligearqllsgivqqqnnllra.............................................
d1g2c.1 legevnkiksallstnkavvslsngvsvltskvldlknyidkqll...............................................
d1g5gd2 pnmpkdkeacakapleaynrtlttlltplgdsirriqesvttsgggkqgrligaiiggvalgvataaqitaasaliqanqnaanilrlkesi
d1jek.1 qslanataaqqevleasyamvqhiakg.................................................................
d1mg1a2 am..........................................................................................
d1qbzc_ qsrtllagivqqqqqlldvvkrqqellrltvwgtknlqtrvtaiekylkdqaqln.....................................
d1svfb_ qilsidpl....................................................................................
d1y4ma1 ni..........................................................................................
d2fyz.1 savslvqaqtnaraiaamknsiqatnravfevkegtqrlaiav.................................................

                  10        20        30        40        50        60        70        80        90
                   |         |         |         |         |         |         |         |         |
d1enva_ ..-------------------------------------------------------------I----------------------------
d1g2c.1 ..------------------P-----------------------------------------------------------------------
d1g5gd2 aa------------------------------------T-----------------------------------------------------
d1jek.1 ..-------------------IRILEARVARVEAXWQQWEEEIEQHEGNLSLLL--------------------------------------
d1qbzc_ ..----AWGAAFRQVAHTTVPWPNASLTPKWNNETWQEWERKVDFLEENITALLE-------------------------------------
d1svfb_ ..-------------------------------DISQNLAAVNKSLSDALQHLAQSDTYLS-------------------------------
d1y4ma1 ..-----------------------------------------DTMAKALTTMQEQIDSLAAVVLQNRRGLDMLTAAQGGICLALDEKCCFW
d2fyz.1 ..----------------QAIQDHINTIMNTQXDISTELSKVNASLQNTVKYIKESNHQLQ-------------------------------

               100       110                                                                        
                 |         |                                                                        
d1eboc_ PHDWTKNITDKIDQIIHDFVD.......................................................................
d1enva_ ---------------------eaqqhllqltvwgikqlqarilaverylkdqnnmtwmewdreinnytslihslieesqnqqekneqellel
d1g2c.1 ---------------------ivnkxplvfpsdefdasisqvnekinqslafirksdellhnvnag..........................
d1g5gd2 ---------------------neavhevtnglsqlavavgkmqqfvndqfnktaqeldcikitqqvgvelnlyltelttvfgp.........
d1jek.1 ---------------------reaalqvhiaqrdar........................................................
d1mg1a2 ---------------------nitnshvsilqerpplen.....................................................
d1qbzc_ ---------------------eaqiqqeknmyelqklns.....................................................
d1svfb_ ---------------------ai.....................................................................
d1y4ma1 VN-------------------.......................................................................
d2fyz.1 ---------------------sviv...................................................................

d1eboc_ ..
d1enva_ dk
d1g2c.1 ..
d1g5gd2 ..
d1jek.1 ..
d1mg1a2 ..
d1qbzc_ ..
d1svfb_ ..
d1y4ma1 ..
d2fyz.1 ..

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0053406 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Trypanosoma congolense 2.4
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Mus musculus 69_38 - House mouse
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Lotus japonicus
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   STRING v9.0.5 (STRING)
NoYes   Uniprot 2018_03 genome
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]