SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Tricorn protease domain 2 alignments in Setaria italica v164

These alignments are sequences aligned to the 0047732 model.

Sophisticated options are available for refining alignments:

Jump to [ Top of page · Refine alignments · Add alignments from genomes ]


The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                       10        20        30       
                                                                        |         |         |       
d1k32a3                     ..............................sipsk-----FAEDFSPLDGDLIAFVSRGQAFIQDVSGTYVL
Si000385m|PACid:19673497  .................................ll-------------------------------------
Si016156m|PACid:19688092  rlllavcpaslhlwsaaqhrvrlarfdrsadslaa-------------------------------------
Si016151m|PACid:19688091  rlllavcpaslhlwsaaqhrvrlarfdrsadslaa-------------------------------------
Si016152m|PACid:19688090  rlllavcpaslhlwsaaqhrvrlarfdrsadslaa-------------------------------------
Si021897m|PACid:19699193  ..............aafnrvtnkriaflnlspdev-------------------------------------
Si033919m|PACid:19679852  .....................pgdcivamdylmer-------------------------------------
Si017034m|PACid:19686242  ....................caafnrttnkricyl-------------------------------------
Si021998m|PACid:19700618  ...........................sqsgvcaa----------------------------FSRETNQRI
Si017337m|PACid:19686243  .....................caafnrttnkricy-------------------------------------
Si017123m|PACid:19689482  ...............................grap-------------------------------------
Si033873m|PACid:19683889  .................................fg-------------------------------------
Si032987m|PACid:19710893  ....................gdsllvtavynaadt-------------------------------------
Si002043m|PACid:19674224  ..................................n-------------------------------------
Si033947m|PACid:19681344  ..........................iavargstl------------------------DLLRPDPETGRLR
Si004597m|PACid:19677945  ........................llyssndndpn-------------------------------------
Si020952m|PACid:19701335  ...................irtiplneqarrichq-------------------------------------
Si030146m|PACid:19712346  ...lvvwdpvtdqrsdlpplqwapypyswnaavlc-------------------------------------
Si003789m|PACid:19676109  ...........................altlvfhe-------------------------------------

                             40            50            60                       70                
                              |             |             |                        |                
d1k32a3                     KVPE...PLR.IRYVRRGG....DTKVAFIHGTR.............EGD..FLGIYDYRTGKA........
Si000385m|PACid:19673497  ----...---.--------....-----------.............---..------------........
Si016156m|PACid:19688092  ----...HGQ.NAHAVWSP....DAKTVAV-LTS.............SFYl.HIYRVQLSGKPLivggkqlp
Si016151m|PACid:19688091  ----...HGQ.NAHAVWSP....DAKTVAV-LTS.............SFYl.HIYRVQLSGKPLivggkqlp
Si016152m|PACid:19688090  ----...HGQ.NAHAVWSP....DAKTVAV-LTS.............SFYl.HIYRVQLSGKPLivggkqlp
Si021897m|PACid:19699193  ----...---.IRSLFYNK....NNDSLIT-VSVyasdnfstlkcrtT-PieYIRRNQLDAGFP........
Si033919m|PACid:19679852  ----...---.--------....-----------.............---..------------........
Si017034m|PACid:19686242  ---Nis.PDEvIRSLFYNK....NNDSLIT-VSVyesdrfsslkcrtT-PieYIRRGQLNDGFP........
Si021998m|PACid:19700618  CFLNgs.PDEvIRSLFYNK....NNDSLIT-VSV.............YGSe.NFSALRCRTTRI........
Si017337m|PACid:19686243  --LNis.PDEvIRSLFYNK....NNDSLIT-VSVyesdrfsslkcrtT-PieYIRRGQLNDGFP........
Si017123m|PACid:19689482  ----...---.--------....-----------.............---..------------........
Si033873m|PACid:19683889  ----...---.-----FHP....TLEWIFV-GDR.............GG-..TLLAWDVSTERP........
Si032987m|PACid:19710893  ----...---.--------....-----------.............---..------------........
Si002043m|PACid:19674224  ----...---.--------....-----------.............---..------------........
Si033947m|PACid:19681344  TLLSvdvFGA.IRSLAQFRltgaTKDYLVV-GSD.............SGRl.VILEYSPDRNRF........
Si004597m|PACid:19677945  ----...---.--------....-----------.............---..TATLCRLTNKKL........
Si020952m|PACid:19701335  ----...---.--------....-----------.............---..------------........
Si030146m|PACid:19712346  ----...---.--------....-----------.............---..------------........
Si003789m|PACid:19676109  ----...---.--------....-----------.............---..------------........

d1k32a3                     ........................................................................
Si000385m|PACid:19673497  ........................................................................
Si016156m|PACid:19688092  glclasisqiitekvplangvaitsnfvcdsksmllglsnghvqvvswnaefsdsfklgcsvcssekptavi
Si016151m|PACid:19688091  glclasisqiitekvplangvaitsnfvcdsksmllglsnghvqvvswnaefsdsfklgcsvcssekptavi
Si016152m|PACid:19688090  glclasisqiitekvplangvaitsnfvcdsksmllglsnghvqvvswnaefsdsfklgcsvcssekptavi
Si021897m|PACid:19699193  ........................................................................
Si033919m|PACid:19679852  ........................................................................
Si017034m|PACid:19686242  ........................................................................
Si021998m|PACid:19700618  ........................................................................
Si017337m|PACid:19686243  ........................................................................
Si017123m|PACid:19689482  ........................................................................
Si033873m|PACid:19683889  ........................................................................
Si032987m|PACid:19710893  ........................................................................
Si002043m|PACid:19674224  ........................................................................
Si033947m|PACid:19681344  ........................................................................
Si004597m|PACid:19677945  ........................................................................
Si020952m|PACid:19701335  ........................................................................
Si030146m|PACid:19712346  ........................................................................
Si003789m|PACid:19676109  ........................................................................

d1k32a3                     ....................................................................EK..
Si000385m|PACid:19673497  ....................................................................--..
Si016156m|PACid:19688092  dalvfdppslrensdarpapcctgnssivhvelsvklrllvalysgchialctvgkkglkqpgsirveRW..
Si016151m|PACid:19688091  dalvfdppslrensdarpapcctgnssivhvelsvklrllvalysgchialctvgkkglkqpgsirveRW..
Si016152m|PACid:19688090  dalvfdppslrensdarpapcctgnssivhvelsvklrllvalysgchialctvgkkglkqpgsirveRW..
Si021897m|PACid:19699193  ....................................................................LF..
Si033919m|PACid:19679852  ....................................................................--..
Si017034m|PACid:19686242  ....................................................................LF..
Si021998m|PACid:19700618  ....................................................................EY..
Si017337m|PACid:19686243  ....................................................................LF..
Si017123m|PACid:19689482  ....................................................................--..
Si033873m|PACid:19683889  ....................................................................SMig
Si032987m|PACid:19710893  ....................................................................--..
Si002043m|PACid:19674224  ....................................................................--..
Si033947m|PACid:19681344  ....................................................................DK..
Si004597m|PACid:19677945  ....................................................................YRvm
Si020952m|PACid:19701335  ....................................................................--..
Si030146m|PACid:19712346  ....................................................................--..
Si003789m|PACid:19676109  ....................................................................--..

                                                  90        100                     110             
                                                   |          |                       |             
d1k32a3                     .FEENLG.............NVFAMGVDR.NGKFAVVANDR...........FE...IMTVDLE........
Si000385m|PACid:19673497  .--PPPR.............STIAAAFSP.DGKTLVSTHGD...........HT...VKIIDCH........
Si016156m|PACid:19688092  .LNTD--.............DAMCTSVAS.EQQILAVGCSR...........GV...VELYDLA........
Si016151m|PACid:19688091  .LNTD--.............DAMCTSVAS.EQQILAVGCSR...........GV...VELYDLA........
Si016152m|PACid:19688090  .LNTD--.............DAMCTSVAS.EQQILAVGCSR...........GV...VELYDLA........
Si021897m|PACid:19699193  .ESESLK.............WPGFVEFDDvNGKVLTYSAQD...........GI...YKVFDLK........
Si033919m|PACid:19679852  .------.............---------.--ESLLLGSSA...........GC...LLLYNVE........
Si017034m|PACid:19686242  .ETESLK.............YPGFVEFDDvNGKVLTFSAQD...........ST...YKVFDLK........
Si021998m|PACid:19700618  .IRRGQPdagfslfeteslkWPGFVEFDDvNGKVLTYSAQD...........ST...YKVFDLK........
Si017337m|PACid:19686243  .ETESLK.............YPGFVEFDDvNGKVLTFSAQD...........ST...YKVFDLK........
Si017123m|PACid:19689482  .-----G.............DGTAVRAAP.DGG--CCVAHG...........GA...VRVYNWM........
Si033873m|PACid:19683889  iTQAGSQ.............PITSVSWLP.TLRLLVTIAKD...........GS...LQVWKTRviinpnrq
Si032987m|PACid:19710893  .------.............---------.-----------...........-SrvdVKLVDVT........
Si002043m|PACid:19674224  .------.............---------.-GLLLYYASRP...........AA...FHVVNPT........
Si033947m|PACid:19681344  .--VHQEtfgksgcrriv..PGQLLAVDP.KGRALCIAALE...........KQkl.VYVLNRD........
Si004597m|PACid:19677945  .LPDPPP.............LRSCFVVGS.CHGLLTIADEQ...........SK...LHLVNPL........
Si020952m|PACid:19701335  .------.............--------E.QSRTLAFCSFKynqtsmeesetHY...IRLLDHQ........
Si030146m|PACid:19712346  .------.............---------.-----------...........--...-------........
Si003789m|PACid:19676109  .------.............---------.-----------...........--...-------........

                                            120               130                                   
                                              |                 |                                   
d1k32a3                     .............TGKP.TVIER........SREAMITD.................................
Si000385m|PACid:19673497  .............TGKC.LKVLS........GHRRTPWV.................................
Si016156m|PACid:19688092  .............ENTRhIRTISlydwgysvEDTGPVAC.................................
Si016151m|PACid:19688091  .............ENTRhIRTISlydwgysvEDTGPVAC.................................
Si016152m|PACid:19688090  .............ENTRhIRTISlydwgysvEDTGPVAC.................................
Si021897m|PACid:19699193  .............NYSF.LYSIP........--DENVQE.................................
Si033919m|PACid:19679852  .............EKTT.EVVGR........L-EGGVNT.................................
Si017034m|PACid:19686242  .............NYNF.LYSIC........--DKNIQE.................................
Si021998m|PACid:19700618  .............NYTL.LYSVS........--DKNVQE.................................
Si017337m|PACid:19686243  .............NYNF.LYSIC........--DKNIQE.................................
Si017123m|PACid:19689482  .............LEER.RPVYC........PGHAPVND.................................
Si033873m|PACid:19683889  pmethfferaaieTMDI.TKILTlqggeav.YPLPRIKN.................................
Si032987m|PACid:19710893  .............SGAI.VTHLD........K-QRSTGH.................................
Si002043m|PACid:19674224  .............TRRW.AALPAprart...LLSVLAFD.................................
Si033947m|PACid:19681344  .............AAAR.LTISSpleahksnTLTFSLTA.................................
Si004597m|PACid:19677945  .............SRAQ.IALPPpltikn..V-----RGcyttdevldsyhllkldlvnhecdaqaepddlt
Si020952m|PACid:19701335  .............TFEF.LSTYPldqy....ECGCSIIS.................................
Si030146m|PACid:19712346  .............----.-----........AAGAACNH.................................
Si003789m|PACid:19676109  .............----.----R........GHSSSLQV.................................

                                               140               150       160                      
                                                 |                 |         |                      
d1k32a3                     .............FTISD.NSRFIAYGFPLK........HGETDGYVMQA......................
Si000385m|PACid:19673497  .............VRYHPlYSDILA------........----SGSLDHE......................
Si016156m|PACid:19688092  .............ISWTP.DNCAFA------........----VGWKFRG......................
Si016151m|PACid:19688091  .............ISWTP.DNCAFA------........----VGWKFRG......................
Si016152m|PACid:19688090  .............ISWTP.DNCAFA------........----VGWKFRG......................
Si021897m|PACid:19699193  .............IKISP.GIM-LLIYDRTP........SYVP-------......................
Si033919m|PACid:19679852  .............IASSP.DGALLS------........----VTTGLGQ......................
Si017034m|PACid:19686242  .............IKISP.GIM-LVIYQKTN........CHVP-------......................
Si021998m|PACid:19700618  .............IKISP.GIMLLIYTRT--........----SSSVP--......................
Si017337m|PACid:19686243  .............IKISP.GIM-LVIYQKTN........CHVP-------......................
Si017123m|PACid:19689482  .............AAYLD.AATLLVAARERPgtgrrgddGG--GGGGGGG......................
Si033873m|PACid:19683889  .............LAVHP.KFNLAAVI----........----FADMSGTeaaknkaaytregrrqlfallq
Si032987m|PACid:19710893  .............IATT-.-GG-LIFLAP--........----TGSTAAS......................
Si002043m|PACid:19674224  .............PCASP.HYKVVCFTGWLP........-------RGAT......................
Si033947m|PACid:19681344  .............LDCGF.DNPIFAAIELEYaes.....DRDPTGQAANQaqklltfyeldlglnhvsrkas
Si004597m|PACid:19677945  leqgcfyfylrvaMSADPsSGRCIVDARWT-........----WIDVDQR......................
Si020952m|PACid:19701335  .............CSFAD.DNNVYYCVGTAYvlpe....ENEP---TKGR......................
Si030146m|PACid:19712346  .............LDCC-.-GGHFLVVVVG-........----TNSNEMF......................
Si003789m|PACid:19676109  .............LSWSP.TTDQ--------........----VGPWDP-......................

d1k32a3                     ........................................................................
Si000385m|PACid:19673497  ........................................................................
Si016156m|PACid:19688092  ........................................................................
Si016151m|PACid:19688091  ........................................................................
Si016152m|PACid:19688090  ........................................................................
Si021897m|PACid:19699193  ........................................................................
Si033919m|PACid:19679852  ........................................................................
Si017034m|PACid:19686242  ........................................................................
Si021998m|PACid:19700618  ........................................................................
Si017337m|PACid:19686243  ........................................................................
Si017123m|PACid:19689482  ........................................................................
Si033873m|PACid:19683889  gargstaavlkekllalgssgilaehqlqaqlqeqhlkgqsqltisdvarkaflhshfmeghaksgpisrlp
Si032987m|PACid:19710893  ........................................................................
Si002043m|PACid:19674224  ........................................................................
Si033947m|PACid:19681344  epidnganllvtvpgggdgpsgvlvccdnfvlyrnqghpevraviprradlpaergvlivaaathrqknlff
Si004597m|PACid:19677945  ........................................................................
Si020952m|PACid:19701335  ........................................................................
Si030146m|PACid:19712346  ........................................................................
Si003789m|PACid:19676109  ........................................................................

d1k32a3                     ...............................................IHVYDME.GR......KIFAATT..
Si000385m|PACid:19673497  ...............................................VRLWDAN.TS......DCIGSQD..
Si016156m|PACid:19688092  ...............................................LTVWSVS.GC......RLMCTIRq.
Si016151m|PACid:19688091  ...............................................LTVWSVS.GC......RLMCTIRq.
Si016152m|PACid:19688090  ...............................................LTVWSVS.GC......RLMCTIRq.
Si021897m|PACid:19699193  ...............................................LKILSIE.DG......KPLKFFKh.
Si033919m|PACid:19679852  ...............................................LLVIT-Q.DW......EVLFETSl.
Si017034m|PACid:19686242  ...............................................LTILSIE.DG......SPLKTFSq.
Si021998m|PACid:19700618  ...............................................LKILSIE.DG......TVLKSFSh.
Si017337m|PACid:19686243  ...............................................LTILSIE.DG......SPLKTFSq.
Si017123m|PACid:19689482  ...............................................VAAFSAL.TG......EPRHRFRva
Si033873m|PACid:19683889  lvtisdssnllrdvpvcqpyhlelnffnkenrvvqypvrafyldgfnLMAHNLS.SGtdnlykKLYSTIPsn
Si032987m|PACid:19710893  ...............................................IGVLNPA.TG......AMTDIPTg.
Si002043m|PACid:19674224  ...............................................IEVFDSE.RGawr...DHE---Vdf
Si033947m|PACid:19681344  ......................................fllqteygdIFKVDLEhSG......ETVTELRik
Si004597m|PACid:19677945  ...............................................CYSYN--.--......-------..
Si020952m|PACid:19701335  ...............................................ILVFAVE.DG......RLQLIVEke
Si030146m|PACid:19712346  ...............................................AHVYSSE.AD......AWSEPAS..
Si003789m|PACid:19676109  ...............................................TMAWSWY.TS......TTPPPFT..

d1k32a3                     ..EN....................................................................
Si000385m|PACid:19673497  ..FH....................................................................
Si016156m|PACid:19688092  ..TGsnsasspmvkpsalkfeplm................................................
Si016151m|PACid:19688091  ..TGsnsasspmvkpsalkfeplm................................................
Si016152m|PACid:19688090  ..TGsnsasspmvkpsalkfeplm................................................
Si021897m|PACid:19699193  ..LL....................................................................
Si033919m|PACid:19679852  ..DPqdatlgdidstg........................................................
Si017034m|PACid:19686242  ..LL....................................................................
Si021998m|PACid:19700618  ..LL....................................................................
Si017337m|PACid:19686243  ..LL....................................................................
Si017123m|PACid:19689482  ..HG....................................................................
Si033873m|PACid:19683889  ..ME....................................................................
Si032987m|PACid:19710893  ..TPanggptsrpayvfgqvpatggykvlsidtaggyghqpnqsceilslggrwrsapsppvlvnmtvsrhr
Si002043m|PACid:19674224  .gID....................................................................
Si033947m|PACid:19681344  yfDT....................................................................
Si004597m|PACid:19677945  ..--....................................................................
Si020952m|PACid:19701335  ..TK....................................................................
Si030146m|PACid:19712346  ..AR....................................................................
Si003789m|PACid:19676109  ..GY....................................................................

                            180                190        200                                     21
                              |                  |          |                                       
d1k32a3                     .SHDY.....AP.AFDA...DSKNLYY.LSYRSL...........................DPSP...DRVV
Si000385m|PACid:19673497  .RPIA.....SI.AFHA...RGEILAV.ASGHK-...........................----...-LYI
Si016156m|PACid:19688092  .GGTS.....HI.QWDD...NGYKLFA.VEESLServlafsfakcclnrglsgttyshqvlYGDD...RILL
Si016151m|PACid:19688091  .GGTS.....HI.QWDD...NGYKLFA.VEESLServlafsfakcclnrglsgttyshqvlYGDD...RILL
Si016152m|PACid:19688090  .GGTS.....HI.QWDD...NGYKLFA.VEESLServlafsfakcclnrglsgttyshqvlYGDD...RILL
Si021897m|PACid:19699193  .HRNK.....KI.DFIEq..FNEKLLV.KQEDE-...........................----...NFQI
Si033919m|PACid:19679852  .C--Qirs..SI.SWRG...DGKYFATlGAPDGA...........................YGPT...KLTI
Si017034m|PACid:19686242  .HRNR.....KV.DFIEqf.NEKLLVK.QDKEN-...........................----...-LQI
Si021998m|PACid:19700618  .HRNK.....KV.DFIEq..FNEKLLV.KQEGE-...........................----...NLQI
Si017337m|PACid:19686243  .HRNR.....KV.DFIEqf.NEKLLVK.QDKEN-...........................----...-LQI
Si017123m|PACid:19689482  .RQPRsftagAL.AFDDg..EGCRVFA.SCKGRL...........................-NEY...GVAV
Si033873m|PACid:19683889  .CHPK.....NI.SYSP...KQHLFLV.VFELSG...........................PNGVaheVVLY
Si032987m|PACid:19710893  aV--Tqg...FA.HFLT...TSRTAAA.GDFDG-...........................----...-IAS
Si002043m|PACid:19674224  .TDAM.....SA.TMHY...SGGALHV.LAYSG-...........................----...HVVR
Si033947m|PACid:19681344  .IPVT.....SA.TCVL...RSGFLFA.ASEFGN...........................----...-HAL
Si004597m|PACid:19677945  .----.....DF.FYND...SNGLFYV.VRGNG-...........................----...EVHT
Si020952m|PACid:19701335  .GAVY.....SLnAFN-...-GKLLAA.INQKI-...........................----...QLYK
Si030146m|PACid:19712346  .HPND.....SV.DFAPsalVGNVLYF.AFQMGT...........................----...AVLE
Si003789m|PACid:19676109  .ETII.....SY.ALHP...DGRTIFM.STDRR-...........................----...RTHS

                            0                220       230       240                                
                            |                  |         |         |                                
d1k32a3                     L.........NFSFEVVSKPFVIPLIPGSPNPTKLVPRSMTSE......AGE....................
Si000385m|PACid:19673497  W.........NYNKRDESSVPA-----IILKTRRSLRAVHFHP......HGApylltaevnniesadspltl
Si016156m|PACid:19688092  V.........QPDDADELKLLHLNVPVSYISQNWPVLHVVASN......DGM....................
Si016151m|PACid:19688091  V.........QPDDADELKLLHLNVPVSYISQNWPVLHVVASN......DGM....................
Si016152m|PACid:19688090  V.........QPDDADELKLLHLNVPVSYISQNWPVLHVVASN......DGM....................
Si021897m|PACid:19699193  L.........DVRTSELIE--------VGVSKFMTPSAFIFLY......ENN....................
Si033919m|PACid:19679852  W.........ERESGKVHS--------SSDAKTFMGTSLDWMP......SGA....................
Si017034m|PACid:19686242  I.........DVRNSDLIE--------VNKTEFMTPSAFIFLY......ENN....................
Si021998m|PACid:19700618  L.........DVRNFQLTE--------VSRTEFMTPSAFIFLY......ELQ....................
Si017337m|PACid:19686243  I.........DVRNSDLIE--------VNKTEFMTPSAFIFLY......ENN....................
Si017123m|PACid:19689482  W.........DVNTGEQAGFFYE----PPGCALGDADRLQWLDg.....TGT....................
Si033873m|PACid:19683889  W.........EQTDLQTV---------NSKGSSIKGRDAAFLGp.....DDN....................
Si032987m|PACid:19710893  F.........DLAKEEWRPSLLQG------PLPSKSRNCCHSNlslvelNGC....................
Si002043m|PACid:19674224  L.........DLGTMACAV--------TALPAPVSCRARAGHC......RGR....................
Si033947m|PACid:19681344  YqfrdigrdaDVES-----------------------------......--Ssatlmeteegfqpvffqprp
Si004597m|PACid:19677945  I.........DLNGPSPVVKIILRPM-----------APCIDN......NKY....................
Si020952m|PACid:19701335  W.........MLREDGSHELQ------SECGHHGHILALYTQT......RGD....................
Si030146m|PACid:19712346  Y.........DLGTKEMAVIRLP----PLLHFNWQRIALTTRT......DGR....................
Si003789m|PACid:19676109  L.........DTSNGVWRDLGEW--------------------......---....................

d1k32a3                     ........................................................................
Si000385m|PACid:19673497  stssgysnypsalfvtntnsrfcphlesnvpspclllpaylrddgilhvlgndssstsaqqrsslvqvatld
Si016156m|PACid:19688092  ........................................................................
Si016151m|PACid:19688091  ........................................................................
Si016152m|PACid:19688090  ........................................................................
Si021897m|PACid:19699193  ........................................................................
Si033919m|PACid:19679852  ........................................................................
Si017034m|PACid:19686242  ........................................................................
Si021998m|PACid:19700618  ........................................................................
Si017337m|PACid:19686243  ........................................................................
Si017123m|PACid:19689482  ........................................................................
Si033873m|PACid:19683889  ........................................................................
Si032987m|PACid:19710893  ........................................................................
Si002043m|PACid:19674224  ........................................................................
Si033947m|PACid:19681344  lknlmrideieslmpvmdmrvanlfdeetpqlftacgrgprstlrilrpglaisemarsmlpaepiavwtvk
Si004597m|PACid:19677945  ........................................................................
Si020952m|PACid:19701335  ........................................................................
Si030146m|PACid:19712346  ........................................................................
Si003789m|PACid:19676109  ........................................................................

d1k32a3                     ........................................................................
Si000385m|PACid:19673497  tenqqpdqfatlmdvcpgeptasndmvdvvpvpasngiemhgadgqsnsrlqgsssisnferfgarddlhvs
Si016156m|PACid:19688092  ........................................................................
Si016151m|PACid:19688091  ........................................................................
Si016152m|PACid:19688090  ........................................................................
Si021897m|PACid:19699193  ........................................................................
Si033919m|PACid:19679852  ........................................................................
Si017034m|PACid:19686242  ........................................................................
Si021998m|PACid:19700618  ........................................................................
Si017337m|PACid:19686243  ........................................................................
Si017123m|PACid:19689482  ........................................................................
Si033873m|PACid:19683889  ........................................................................
Si032987m|PACid:19710893  ........................................................................
Si002043m|PACid:19674224  ........................................................................
Si033947m|PACid:19681344  knindmfdayivvsfanvtlvlsigetieevsdsqfldtthslavtllgedslmqvhpsgirhiredgrvne
Si004597m|PACid:19677945  ........................................................................
Si020952m|PACid:19701335  ........................................................................
Si030146m|PACid:19712346  ........................................................................
Si003789m|PACid:19676109  ........................................................................

d1k32a3                     ........................................................................
Si000385m|PACid:19673497  spsntepipstaglsgsdarramplnmlitggldvqmllrnvesgqpnlfgnsrnwelpflqgflmaqnhtg
Si016156m|PACid:19688092  ........................................................................
Si016151m|PACid:19688091  ........................................................................
Si016152m|PACid:19688090  ........................................................................
Si021897m|PACid:19699193  ........................................................................
Si033919m|PACid:19679852  ........................................................................
Si017034m|PACid:19686242  ........................................................................
Si021998m|PACid:19700618  ........................................................................
Si017337m|PACid:19686243  ........................................................................
Si017123m|PACid:19689482  ........................................................................
Si033873m|PACid:19683889  ........................................................................
Si032987m|PACid:19710893  ........................................................................
Si002043m|PACid:19674224  ........................................................................
Si033947m|PACid:19681344  wrtpgkktitkvgsnrlq......................................................
Si004597m|PACid:19677945  ........................................................................
Si020952m|PACid:19701335  ........................................................................
Si030146m|PACid:19712346  ........................................................................
Si003789m|PACid:19676109  ........................................................................

d1k32a3                     ........................................................................
Si000385m|PACid:19673497  asssipitagssrgsnrryasrsvpgvgssllgpqideaevhaaslgvgseitapmftpgtelpctvklriw
Si016156m|PACid:19688092  ........................................................................
Si016151m|PACid:19688091  ........................................................................
Si016152m|PACid:19688090  ........................................................................
Si021897m|PACid:19699193  ........................................................................
Si033919m|PACid:19679852  ........................................................................
Si017034m|PACid:19686242  ........................................................................
Si021998m|PACid:19700618  ........................................................................
Si017337m|PACid:19686243  ........................................................................
Si017123m|PACid:19689482  ........................................................................
Si033873m|PACid:19683889  ........................................................................
Si032987m|PACid:19710893  ........................................................................
Si002043m|PACid:19674224  ........................................................................
Si033947m|PACid:19681344  ........................................................................
Si004597m|PACid:19677945  ........................................................................
Si020952m|PACid:19701335  ........................................................................
Si030146m|PACid:19712346  ........................................................................
Si003789m|PACid:19676109  ........................................................................

d1k32a3                     ........................................................................
Si000385m|PACid:19673497  rhnikepcrslepeacrltishavlcsemgahfspcgrflvacvacllpqtegdrgsqlpvpydsagagssp
Si016156m|PACid:19688092  ........................................................................
Si016151m|PACid:19688091  ........................................................................
Si016152m|PACid:19688090  ........................................................................
Si021897m|PACid:19699193  ........................................................................
Si033919m|PACid:19679852  ........................................................................
Si017034m|PACid:19686242  ........................................................................
Si021998m|PACid:19700618  ........................................................................
Si017337m|PACid:19686243  ........................................................................
Si017123m|PACid:19689482  ........................................................................
Si033873m|PACid:19683889  ........................................................................
Si032987m|PACid:19710893  ........................................................................
Si002043m|PACid:19674224  ........................................................................
Si033947m|PACid:19681344  ........................................................................
Si004597m|PACid:19677945  ........................................................................
Si020952m|PACid:19701335  ........................................................................
Si030146m|PACid:19712346  ........................................................................
Si003789m|PACid:19676109  ........................................................................

d1k32a3                     .................................................................YDLNDM.
Si000385m|PACid:19673497  trhplpshrviyelrvysleeatfgdilasrairaahcltsiqfsptsehillaygrrhgsllrsIVMEGD.
Si016156m|PACid:19688092  .................................................................YLAVAG.
Si016151m|PACid:19688091  .................................................................YLAVAG.
Si016152m|PACid:19688090  .................................................................YLAVAG.
Si021897m|PACid:19699193  .................................................................LFLTFR.
Si033919m|PACid:19679852  .................................................................KVATIH.
Si017034m|PACid:19686242  .................................................................LFLTFC.
Si021998m|PACid:19700618  .................................................................LFLTFR.
Si017337m|PACid:19686243  .................................................................LFLTFC.
Si017123m|PACid:19689482  .................................................................LMAATMf
Si033873m|PACid:19683889  .................................................................QYAILEe
Si032987m|PACid:19710893  .................................................................LVFVHH.
Si002043m|PACid:19674224  .................................................................LRFASS.
Si033947m|PACid:19681344  .................................................................VVIALS.
Si004597m|PACid:19677945  .................................................................IAQAPW.
Si020952m|PACid:19701335  .................................................................FIVVG-.
Si030146m|PACid:19712346  .................................................................LGFATA.
Si003789m|PACid:19676109  .................................................................------.

                                                                260              270                
                                                                  |                |                
d1k32a3                     ...YKR.......SSPI.....................NVDP.......GDYRMIIP....LE.S.......
Si000385m|PACid:19673497  ...NGIpvyti..LEVY.....................RVSD.......MELVRVLP....--.-.......
Si016156m|PACid:19688092  ...SHG.......LVLY.....................DLRN.......KRWRFFGD....VT.Qeqkiqck
Si016151m|PACid:19688091  ...SHG.......LVLY.....................DLRN.......KRWRFFGD....VT.Qeqkiqck
Si016152m|PACid:19688090  ...SHG.......LVLY.....................DLRN.......KRWRFFGD....VT.Qeqkiqck
Si021897m|PACid:19699193  ...NRT.......IAVW.....................NFRGelvts..FEDHLLWH....HD.C.......
Si033919m|PACid:19679852  ...DRRtegkcplIVFY.....................E-KN.......GLERSHFS....ID.Epaev...
Si017034m|PACid:19686242  ...NRT.......VAAW.....................NFRG.......ELVTSFEDhelwHPnC.......
Si021998m|PACid:19700618  ...NRS.......VAVW.....................NFRGelvts..F-----EDhllwHPdC.......
Si017337m|PACid:19686243  ...NRT.......VAAW.....................NFRG.......E-------....--.-.......
Si017123m|PACid:19689482  praDSSf......ISLL.....................DFRD.......KSVVWSWS....DA.G.......
Si033873m|PACid:19683889  ...DKTs......LNLF.....................----.......--------....--.-.......
Si032987m|PACid:19710893  ...DYLscc....IDLW.....................ALTDlek....GTWLRIQSlh..LG.Silhgwee
Si002043m|PACid:19674224  ...DGTr......LRIW.....................ELEDadagd..WALKHEIG....VS.Dvvpggss
Si033947m|PACid:19681344  ...GGE.......LIYF.....................EMDMt......GQLMEVEKqd..MS.G.......
Si004597m|PACid:19677945  ...GGM.......LQVWryddiveegegravqlevymvDLAE.......QKLVEIKN....LQ.E.......
Si020952m|PACid:19701335  ...---.......----.....................----.......--------....--.-.......
Si030146m|PACid:19712346  ...DRSa......IYLW.....................SREAcpggdarWAQTRVIE....LD.Tllpagal
Si003789m|PACid:19676109  ...---.......----.....................----.......--------....--.-.......

d1k32a3                     ........................................................................
Si000385m|PACid:19673497  ........................................................................
Si016156m|PACid:19688092  gllwlgkivivcnyvessntyellffpryhldyssllyrkpllgrpiamdvfqnyilvtyspfdvhifhvvi
Si016151m|PACid:19688091  gllwlgkivivcnyvessntyellffpryhldyssllyrkpllgrpiamdvfqnyilvtyspfdvhifh...
Si016152m|PACid:19688090  gllwlgkivivcnyvessntyellffpryhldyssllyrkpllgrpiamdvfqnyilvtyspfdvhifh...
Si021897m|PACid:19699193  ........................................................................
Si033919m|PACid:19679852  ........................................................................
Si017034m|PACid:19686242  ........................................................................
Si021998m|PACid:19700618  ........................................................................
Si017337m|PACid:19686243  ........................................................................
Si017123m|PACid:19689482  ........................................................................
Si033873m|PACid:19683889  ........................................................................
Si032987m|PACid:19710893  pkkdepapliptthhrkei.....................................................
Si002043m|PACid:19674224  qai.....................................................................
Si033947m|PACid:19681344  ........................................................................
Si004597m|PACid:19677945  ........................................................................
Si020952m|PACid:19701335  ........................................................................
Si030146m|PACid:19712346  stfsdvvgfv..............................................................
Si003789m|PACid:19676109  ........................................................................

                                    280         290                                 300       310   
                                      |           |                                   |         |   
d1k32a3                     .....SILIYSV..PVHGEFAAYYQGAPEK..........................GVLLKYDVKTRKVTEV
Si000385m|PACid:19673497  .....-------..----------------..........................----------------
Si016156m|PACid:19688092  sgelsP------..----------------..........................----------------
Si016151m|PACid:19688091  .....V------..----------------..........................----------------
Si016152m|PACid:19688090  .....V------..----------------..........................----------------
Si021897m|PACid:19699193  .....STNNIYI..TSDQDL---IISYCKSeavaedgtvtpi..............GSINMSEIMTGKCIAK
Si033919m|PACid:19679852  .....AIHALKW..NCNSEILAALVSSGQH..........................DVIKIWSCRNNHWYLK
Si017034m|PACid:19686242  .....NTNNI--..---------YITADQDliisyckvskqvadcvdseaggvssmGSINMSNIFTGKCVAK
Si021998m|PACid:19700618  .....NTNNIYI..TSDQDLI--ISYCKADstdssseena................GSINISSILTGKCLAK
Si017337m|PACid:19686243  .....-------..---------LVTSFED..........................HELWHPN---------
Si017123m|PACid:19689482  .....TPA----..----------------..........................----------------
Si033873m|PACid:19683889  .....-------..----------------..........................----------------
Si032987m|PACid:19710893  .....FAQPLMV..LDDGRIA--FWVGVPN..........................GAVRVYDPKTRKC---
Si002043m|PACid:19674224  .....TFLFMAF..HPEREVV---------..........................---Y------------
Si033947m|PACid:19681344  .....DVACLAIapVPEGRQR---------..........................----------------
Si004597m|PACid:19677945  .....HVLFIGF..----------------..........................----------------
Si020952m|PACid:19701335  .....-------..----------------..........................----------------
Si030146m|PACid:19712346  .....DAI----..---G-----LIFVRTG..........................DGLFTIDLKSSQVT--
Si003789m|PACid:19676109  .....-------..----------------..........................----------------

                                                              320         330       340       350   
                                                                |           |         |         |   
d1k32a3                     KNN..............................LTDLRLSA.DR.KTVMVRKDDGKIYTFPLEKPEDERTVE
Si000385m|PACid:19673497  --Saede..........................VNVACFHPsPG.GGLVYGTKEGKLRI-------------
Si016156m|PACid:19688092  ---..............................--------.--.---------------------------
Si016151m|PACid:19688091  ---..............................--------.--.---------------------------
Si016152m|PACid:19688090  ---..............................--------.--.---------------------------
Si021897m|PACid:19699193  IAAgdpalnvtpsrnsskkrssvwstvpealedVTALFYDE.DR.NEIYTGNSQGLVHVWS-----------
Si033919m|PACid:19679852  HELrytkee........................RVKFFWDP.TKpMHLICWTLGGQVVIHR-----------
Si017034m|PACid:19686242  ISPsdptltiaprnrgdksrstihstvsealedITALFYDE.DR.NEIYTGNSKGLVHVWS-----------
Si021998m|PACid:19700618  VNSgngnsckqkkawkfqntvsealed......ITALYYDE.ER.DEIYTGNRHGLVHVWS-----------
Si017337m|PACid:19686243  ---..............................--------.--.---------------------------
Si017123m|PACid:19689482  ---..............................--------.--.---------------------------
Si033873m|PACid:19683889  ---..............................--------.--.---------------------------
Si032987m|PACid:19710893  ---..............................--------.--.---------------------------
Si002043m|PACid:19674224  ---..............................--------.--.---------------------------
Si033947m|PACid:19681344  ---..............................--------.-S.RFLAVGSYDNTIRILSLDPDDCL----
Si004597m|PACid:19677945  ---..............................--------.--.---------------------------
Si020952m|PACid:19701335  ---..............................--------.--.---------------------------
Si030146m|PACid:19712346  ---..............................--------.--.---------------------------
Si003789m|PACid:19676109  ---..............................--------.--.---------------------------

d1k32a3                     TDKRPL-v................................................................
Si000385m|PACid:19673497  -------lq...............................................................
Si016156m|PACid:19688092  -------asnpvlqlstvrelsimspksppvsmrfipdqndkgalkqnasgssdllseqpsrclilrtngel
Si016151m|PACid:19688091  -------visgelspasnpvlqlstvrelsimspksppvsmrfipdqndkgalkqnasgssdllseqpsrcl
Si016152m|PACid:19688090  -------visgelspasnpvlqlstvrelsimspksppvsmrfipdqndkgalkqnasgssdllseqpsrcl
Si021897m|PACid:19699193  -------.................................................................
Si033919m|PACid:19679852  -------fa...............................................................
Si017034m|PACid:19686242  -------.................................................................
Si021998m|PACid:19700618  -------.................................................................
Si017337m|PACid:19686243  -------cntnniyitadq.....................................................
Si017123m|PACid:19689482  -------sledkhavhavamedgrsvcvinqyhdlgfldlr...............................
Si033873m|PACid:19683889  -------sl...............................................................
Si032987m|PACid:19710893  -------kev..............................................................
Si002043m|PACid:19674224  -------lwspw............................................................
Si033947m|PACid:19681344  -------qpl..............................................................
Si004597m|PACid:19677945  -------ntpffllaedynmltpdciyltndymdyiyskkfgprqvlvfnmkdgsltdlfpd..........
Si020952m|PACid:19701335  -------dlm..............................................................
Si030146m|PACid:19712346  -------kvskd............................................................
Si003789m|PACid:19676109  -------tlpf.............................................................

d1k32a3                     ...................................
Si000385m|PACid:19673497  ...................................
Si016156m|PACid:19688092  svldmddghehaltnsvelfwvtcsqfe.......
Si016151m|PACid:19688091  ilrtngelsvldmddghehaltnsvelfwvtcsqf
Si016152m|PACid:19688090  ilrtngelsvldmddghehaltnsvelfwvtcsqf
Si021897m|PACid:19699193  ...................................
Si033919m|PACid:19679852  ...................................
Si017034m|PACid:19686242  ...................................
Si021998m|PACid:19700618  ...................................
Si017337m|PACid:19686243  ...................................
Si017123m|PACid:19689482  ...................................
Si033873m|PACid:19683889  ...................................
Si032987m|PACid:19710893  ...................................
Si002043m|PACid:19674224  ...................................
Si033947m|PACid:19681344  ...................................
Si004597m|PACid:19677945  ...................................
Si020952m|PACid:19701335  ...................................
Si030146m|PACid:19712346  ...................................
Si003789m|PACid:19676109  ...................................

Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:

Model: 0047732 (list models)
Initial SAMT99 seed:

Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues

Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.

Select to display   Genome
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Trichodesmium erythraeum IMS101
NoYes   Halothece sp. PCC 7418
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Nostoc sp. PCC 7524
NoYes   Conexibacter woesei DSM 14684
NoYes   Ilumatobacter coccineus
NoYes   Thermobispora bispora DSM 43833
NoYes   Modestobacter marinus
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces bingchenggensis BCW-1
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Salinispora arenicola CNS-205
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Rhodococcus jostii RHA1
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Microbacterium testaceum StLB037
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Renibacterium salmoninarum ATCC 33209
NoYes   Anaerolinea thermophila UNI-1
NoYes   Thermomicrobium roseum DSM 5159
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Oceanithermus profundus DSM 14977
NoYes   Meiothermus silvanus DSM 9946
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Erysipelothrix rhusiopathiae str. Fujisawa
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   Eubacterium rectale ATCC 33656
NoYes   Roseburia hominis A2-183
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Clostridium cellulovorans 743B
NoYes   Thermosediminibacter oceani DSM 16646
NoYes   Caldicellulosiruptor hydrothermalis 108
NoYes   Caldicellulosiruptor owensensis OL
NoYes   Caldicellulosiruptor bescii DSM 6725
NoYes   Coprothermobacter proteolyticus DSM 5265
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Oenococcus oeni PSU-1
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC BAA-365
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius DSM 446
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Ignavibacterium album JCM 16511
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Candidatus Amoebophilus asiaticus 5a2
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Fibrella aestuarina
NoYes   Leadbetterella byssophila DSM 17132
NoYes   Dyadobacter fermentans DSM 18053
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Sphingobacterium sp. 21
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Robiginitalea biformata HTCC2501
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Flavobacterium johnsoniae UW101
NoYes   Candidatus Protochlamydia amoebophila UWE25
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Leptospira interrogans serovar Lai str. IPAV
NoYes   Brachyspira intermedia PWS/A
NoYes   Brachyspira hyodysenteriae WA1
NoYes   Borrelia turicatae 91E135
NoYes   Borrelia hermsii DAH
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema succinifaciens DSM 2489
NoYes   Treponema denticola ATCC 35405
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermovibrio ammonificans HB-1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Bacteriovorax marinus SJ
NoYes   Bdellovibrio bacteriovorus HD100
NoYes   Campylobacter curvus 525.92
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Geobacter sp. M21
NoYes   Geobacter lovleyi SZ
NoYes   Babela massiliensis
NoYes   Haliangium ochraceum DSM 14365
NoYes   Sorangium cellulosum 'So ce 56'
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus fulvus HW-1
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Burkholderia rhizoxinica HKI 454
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Caulobacter sp. K31
NoYes   Sphingobium sp. SYK-6
NoYes   Hirschia baltica ATCC 49814
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Roseobacter denitrificans OCh 114
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Rhizobium etli CIAT 652
NoYes   Agrobacterium radiobacter K84
NoYes   Hyphomicrobium sp. MC1
NoYes   Cellvibrio japonicus Ueda107
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Photobacterium profundum SS9
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella violacea DSS12
NoYes   Colwellia psychrerythraea 34H
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Hahella chejuensis KCTC 2396
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Proteus mirabilis HI4320
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Shigella sonnei Ss046
NoYes   Enterobacter sp. R4-368
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Psychrobacter sp. PRwf-1
NoYes   Francisella cf. novicida 3523
NoYes   Cenarchaeum symbiosum A
NoYes   Ignisphaera aggregans DSM 17230
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Desulfurococcus fermentans DSM 16532
NoYes   Desulfurococcus mucosus DSM 2162
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Pyrobaculum sp. 1860
NoYes   Pyrobaculum arsenaticum DSM 13514
NoYes   Pyrobaculum oguniense TE7
NoYes   Pyrobaculum aerophilum str. IM2
NoYes   Thermoproteus uzoniensis 768-20
NoYes   halophilic archaeon DL31
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanoculleus bourgensis MS2
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus gammatolerans EJ3
NoYes   Thermococcus barophilus MP
NoYes   Thermoplasma volcanium GSS1
NoYes   Thermoplasma acidophilum DSM 1728
NoYes   Picrophilus torridus DSM 9790
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Methanobrevibacter smithii ATCC 35061
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae YPS163
NoYes   Saccharomyces cerevisiae T73
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Synechococcus sp. JA-3-3Ab
NoYes   Prochlorococcus marinus str. AS9601
NoYes   Prochlorococcus marinus subsp. marinus str. CCMP1375
NoYes   Prochlorococcus marinus str. MIT 9215
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. ATCC 51142
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Anabaena cylindrica PCC 7122
NoYes   Frankia sp. EuI1c
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Corynebacterium diphtheriae HC04
NoYes   Corynebacterium diphtheriae HC03
NoYes   Thermus oshimai JL-2
NoYes   Erysipelothrix rhusiopathiae SY1027
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Coprococcus catus GD/7
NoYes   Clostridium sp. SY8519
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Lactobacillus casei LOCK919
NoYes   Lactobacillus casei str. Zhang
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ND02
NoYes   Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842
NoYes   Lactobacillus delbrueckii subsp. bulgaricus 2038
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Alicyclobacillus acidocaldarius subsp. acidocaldarius Tc-4-1
NoYes   Paenibacillus sp. Y412MC10
NoYes   Paenibacillus mucilaginosus KNP414
NoYes   Paenibacillus mucilaginosus K02
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Bacillus amyloliquefaciens subsp. plantarum UCMB5036
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus infantis NRRL B-14911
NoYes   Bacillus toyonensis BCT-7112
NoYes   Bacillus thuringiensis MC28
NoYes   Bacillus thuringiensis YBT-1518
NoYes   Bacillus thuringiensis serovar finitimus YBT-020
NoYes   Bacillus cereus B4264
NoYes   Bacillus cereus F837/76
NoYes   Salinibacter ruber DSM 13855
NoYes   Rhodothermus marinus SG0.5JP17-172
NoYes   Prevotella sp. oral taxon 299 str. F0039
NoYes   Prevotella dentalis DSM 3688
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Nonlabens dokdonensis DSW-6
NoYes   Leptospira interrogans serovar Lai str. 56601
NoYes   Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130
NoYes   Treponema pedis str. T A4
NoYes   Bdellovibrio exovorus JSS
NoYes   Bdellovibrio bacteriovorus str. Tiberius
NoYes   Desulfobacula toluolica Tol2
NoYes   Sorangium cellulosum So0157-2
NoYes   Neisseria meningitidis M01-240355
NoYes   Ralstonia solanacearum CMR15
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia cepacia GG4
NoYes   Variovorax paradoxus B4
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acetobacter pasteurianus 386B
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Sinorhizobium meliloti 2011
NoYes   Sinorhizobium meliloti 1021
NoYes   Rhizobium tropici CIAT 899
NoYes   Mesorhizobium australicum WSM2073
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Vibrio vulnificus CMCP6
NoYes   Vibrio vulnificus YJ016
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Shewanella putrefaciens 200
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alcanivorax dieselolei B5
NoYes   Dickeya dadantii Ech586
NoYes   Cronobacter sakazakii SP291
NoYes   Shigella sonnei 53G
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli LY180
NoYes   Escherichia coli P12b
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli SE11
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Sulfolobus islandicus LAL14/1
NoYes   Sulfolobus islandicus Y.G.57.14
NoYes   Sulfolobus islandicus L.S.2.15
NoYes   Sulfolobus islandicus M.16.27
NoYes   Sulfolobus islandicus M.14.25
NoYes   Sulfolobus islandicus M.16.4
NoYes   Sulfolobus islandicus L.D.8.5
NoYes   Sulfolobus solfataricus 98/2
NoYes   Sulfolobus acidocaldarius SUSAZ
NoYes   Sulfolobus acidocaldarius Ron12/I
NoYes   Sulfolobus acidocaldarius N8
NoYes   Methanoregula formicica Methanoregula formicicum SMSP
NoYes   Thermococcus sp. AM4
NoYes   Ferroplasma acidarmanus fer1
NoYes   Natronococcus occultus SP4
NoYes   Natronobacterium gregoryi SP2
NoYes   Natronomonas moolapensis 8.8.11
NoYes   Haloarcula hispanica N601
NoYes   Homo sapiens 69_37 - Human
NoYes   Pan troglodytes 69_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 69_3.1 - Western gorilla
NoYes   Pongo abelii 69_2 - Sumatran orangutan
NoYes   Nomascus leucogenys 69_1.0 - Northern white-cheeked gibbon
NoYes   Macaca mulatta 69_1 - Rhesus monkey
NoYes   Callithrix jacchus 69_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 69_3 - Small-eared galago
NoYes   Tarsius syrichta 69_1
NoYes   Microcebus murinus 69_1 - Gray mouse lemur
NoYes   Rattus norvegicus 69_3.4 - Norway rat
NoYes   Mus musculus 69_38 - House mouse
NoYes   Dipodomys ordii 69_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 69_2 - Thirteen-lined ground squirrel
NoYes   Cavia porcellus 69_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 69_2 - Rabbit
NoYes   Ochotona princeps 69 - American pika
NoYes   Tupaia belangeri 69 - Northern tree shrew
NoYes   Sus scrofa 69_10.2 - Pig
NoYes   Bos taurus 69_3.1 - Cattle
NoYes   Vicugna pacos 69_1 - Alpaca
NoYes   Tursiops truncatus 69_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 69_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 69_1 - Giant panda
NoYes   Canis familiaris 69_3.1 - Dog
NoYes   Felis catus 69 - Domestic cat
NoYes   Equus caballus 69_2 - Horse
NoYes   Myotis lucifugus 69_2.0 - Little brown bat
NoYes   Pteropus vampyrus 69_1 - Large flying fox
NoYes   Erinaceus europaeus 69 - Western European hedgehog
NoYes   Procavia capensis 69_1 - Cape rock hyrax
NoYes   Loxodonta africana 69_3 - African savanna elephant
NoYes   Echinops telfairi 69 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 69_2 - Nine-banded armadillo
NoYes   Macropus eugenii 69_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 69_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 69_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 69_5 - Platypus
NoYes   Petromyzon marinus 69_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 69_2 - Turkey
NoYes   Gallus gallus 69_2 - Chicken
NoYes   Taeniopygia guttata 69_3.2.4 - Zebra finch
NoYes   Pelodiscus sinensis 69_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 69_2.0 - Green anole
NoYes   Xenopus tropicalis 69_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 69_1 - Coelacanth
NoYes   Gadus morhua 69_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 69_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 69_4 - Torafugu
NoYes   Gasterosteus aculeatus 69_1 - Three-spined stickleback
NoYes   Oryzias latipes 69_1 - Japanese medaka
NoYes   Xiphophorus maculatus 69_4.4.2 - Southern platyfish
NoYes   Oreochromis niloticus 69_1.0 - Nile tilapia
NoYes   Danio rerio 69_9 - Zebrafish
NoYes   Ciona savignyi 69_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 69 - Vase tunicate
NoYes   Drosophila melanogaster 69_5 - Fruit fly
NoYes   Caenorhabditis elegans 69_215 - Roundworm
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Homo sapiens 75_37 - Human
NoYes   Homo sapiens - Human
NoYes   Mus musculus 63_37 (longest transcript per gene) - House mouse
NoYes   Heliconius numata
NoYes   Loa loa v3.3 - Eye worm
NoYes   Wuchereria bancrofti v1.0 - Agent of lymphatic filariasis
NoYes   Brugia malayi v1.0 - Agent of lymphatic filariasis
NoYes   Moniliophthora perniciosa FA553
NoYes   Encephalitozoon intestinalis
NoYes   Encephalitozoon cuniculi
NoYes   Picea sitchensis - Sitka spruce
NoYes   Lotus japonicus
NoYes   Malus x domestica - Apple
NoYes   Ricinus communis - Castor bean
NoYes   Nicotiana benthamiana 0.4.4
NoYes   Solanum pimpinellifolium A-1.0 - Currant tomato
NoYes   Solanum lycopersicum v2.3 - Tomato
NoYes   Phoenix dactylifera - Date palm
NoYes   Guillardia theta
NoYes   1_050719N (meta-genome)
NoYes   2_050719S (meta-genome)
NoYes   3_050719R (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   4_Deep_abyss (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   5_Below_upper_mesopelagic (meta-genome)
NoYes   6_Upper_euphotic (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, filamentous community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Core Eukaryotic Genes 458 (CEGMA)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 01(G) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot Spring microbial communities from Yellowstone Obsidian Hot Spring, Sample 10594 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP8 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP1 from Alice Springs, Crater Hills (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP12 from Calcite Springs, Tower Falls Region (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP13 from Bechler Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP14 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP19 from Cistern Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP4 from Joseph's Coat Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing switchgr (meta-genome)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   UniProt viral sequences (Viral)
NoYes   ALL (only advised for small superfamilies)

Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]