SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Chemotaxis phosphatase CheZ alignments

These alignments are sequences aligned to the 0053466 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                      10        20        30        40        50        60        70        80      
                       |         |         |         |         |         |         |         |      
d1kmiz_ sikpad------EHSAGDIIARIGSLTRMLRDSLRELGLDQAIAEAAEAIPDARDRLYYVVQMTAQAAERALNSVEASQPHQDQMEKSAKAL


          90       100       110       120       130       140       150       160       170       1
           |         |         |         |         |         |         |         |         |        
d1kmiz_ TQRWDDWFADPIDLADARELVTDTRQFLADVPAHTSFTNAQLLKIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLENIPEQESRPKREN


        80       190       200         
         |         |         |         
d1kmiz_ QSLLNGPQVDTSKAGVVASQDQVDDLLDSLG


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0053466 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Trichomonas vaginalis
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Thermovibrio ammonificans HB-1
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Thermocrinis albus DSM 14484
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Candidatus Nitrospira defluvii
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Acidithiobacillus caldus SM-1
NoYes   Nautilia profundicola AmH
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter mustelae 12198
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Hippea maritima DSM 10411
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Rubrivivax gelatinosus IL144
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Burkholderia sp. RPE64
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Burkholderia gladioli BSR3
NoYes   Burkholderia glumae BGR1
NoYes   Verminephrobacter eiseniae EF01-2
NoYes   Alicycliphilus denitrificans K601
NoYes   Delftia sp. Cs1-4
NoYes   Delftia acidovorans SPH-1
NoYes   Variovorax paradoxus S110
NoYes   Rhodoferax ferrireducens T118
NoYes   Acidovorax ebreus TPSY
NoYes   Acidovorax sp. KKS102
NoYes   Acidovorax sp. JS42
NoYes   Acidovorax citrulli AAC00-1
NoYes   Acidovorax avenae subsp. avenae ATCC 19860
NoYes   Comamonas testosteroni CNB-2
NoYes   Herminiimonas arsenicoxydans
NoYes   Collimonas fungivorans Ter331
NoYes   Janthinobacterium sp. Marseille
NoYes   Herbaspirillum seropedicae SmR1
NoYes   Pusillimonas sp. T7-7
NoYes   Bordetella petrii DSM 12804
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Nitrosomonas sp. Is79A3
NoYes   Nitrosomonas eutropha C91
NoYes   Nitrosomonas europaea ATCC 19718
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Asticcacaulis excentricus CB 48
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Phenylobacterium zucineum HLK1
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium populi BJ001
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Agrobacterium vitis S4
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter winogradskyi Nb-255
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Cellvibrio japonicus Ueda107
NoYes   Oceanimonas sp. GK1
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas sp. CNPT3
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Hahella chejuensis KCTC 2396
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Rhodanobacter denitrificans
NoYes   Frateuria aurantia DSM 6220
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas albilineans GPE PC73
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Halothiobacillus neapolitanus c2
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus bovienii SS-2004
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Sodalis glossinidius str. 'morsitans'
NoYes   Pantoea sp. At-9b
NoYes   Pantoea vagans C9-1
NoYes   Pantoea ananatis LMG 20103
NoYes   Erwinia tasmaniensis Et1/99
NoYes   Erwinia sp. Ejp617
NoYes   Erwinia billingiae Eb661
NoYes   Erwinia pyrifoliae Ep1/96
NoYes   Erwinia amylovora ATCC 49946
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Methylophaga sp. JAM1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Methanopyrus kandleri AV19
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Salinibacter ruber DSM 13855
NoYes   Rhodothermus marinus SG0.5JP17-172
NoYes   Helicobacter cinaedi ATCC BAA-847
NoYes   Spirochaeta thermophila DSM 6578
NoYes   Leptospirillum ferriphilum ML-04
NoYes   Arcobacter butzleri 7h1h
NoYes   Arcobacter butzleri ED-1
NoYes   Campylobacter jejuni Waterborne C.jejuni Outbreak
NoYes   Campylobacter jejuni RM1221
NoYes   Campylobacter jejuni subsp. jejuni 00-2544
NoYes   Campylobacter jejuni subsp. jejuni 00-2538
NoYes   Campylobacter jejuni subsp. jejuni 00-2426
NoYes   Campylobacter jejuni subsp. jejuni 00-2425
NoYes   Campylobacter jejuni subsp. jejuni PT14
NoYes   Campylobacter jejuni subsp. jejuni ICDCCJ07001
NoYes   Campylobacter jejuni subsp. jejuni S3
NoYes   Campylobacter jejuni subsp. jejuni M1
NoYes   Campylobacter jejuni subsp. jejuni IA3902
NoYes   Campylobacter jejuni subsp. jejuni 81116
NoYes   Campylobacter jejuni subsp. jejuni 81-176
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
NoYes   Campylobacter coli 76339
NoYes   Campylobacter coli 15-537360
NoYes   Campylobacter coli CVM N29710
NoYes   Helicobacter cetorum MIT 99-5656
NoYes   Helicobacter pylori BM012S
NoYes   Helicobacter pylori BM012A
NoYes   Helicobacter pylori SouthAfrica20
NoYes   Helicobacter pylori UM298
NoYes   Helicobacter pylori UM066
NoYes   Helicobacter pylori UM037
NoYes   Helicobacter pylori UM299
NoYes   Helicobacter pylori UM032
NoYes   Helicobacter pylori OK310
NoYes   Helicobacter pylori OK113
NoYes   Helicobacter pylori Rif2
NoYes   Helicobacter pylori Rif1
NoYes   Helicobacter pylori HUP-B14
NoYes   Helicobacter pylori PeCan18
NoYes   Helicobacter pylori Shi169
NoYes   Helicobacter pylori Shi112
NoYes   Helicobacter pylori Shi417
NoYes   Helicobacter pylori XZ274
NoYes   Helicobacter pylori Aklavik86
NoYes   Helicobacter pylori Aklavik117
NoYes   Helicobacter pylori SNT49
NoYes   Helicobacter pylori Puno135
NoYes   Helicobacter pylori Puno120
NoYes   Helicobacter pylori ELS37
NoYes   Helicobacter pylori Gambia94/24
NoYes   Helicobacter pylori SouthAfrica7
NoYes   Helicobacter pylori India7
NoYes   Helicobacter pylori Lithuania75
NoYes   Helicobacter pylori 2017
NoYes   Helicobacter pylori 2018
NoYes   Helicobacter pylori 908
NoYes   Helicobacter pylori F57
NoYes   Helicobacter pylori F30
NoYes   Helicobacter pylori F16
NoYes   Helicobacter pylori Sat464
NoYes   Helicobacter pylori Cuz20
NoYes   Helicobacter pylori PeCan4
NoYes   Helicobacter pylori SJM180
NoYes   Helicobacter pylori B8
NoYes   Helicobacter pylori 52
NoYes   Helicobacter pylori v225d
NoYes   Helicobacter pylori 83
NoYes   Helicobacter pylori 35A
NoYes   Helicobacter pylori P12
NoYes   Helicobacter pylori G27
NoYes   Helicobacter pylori Shi470
NoYes   Helicobacter pylori HPAG1
NoYes   Helicobacter pylori 51
NoYes   Helicobacter pylori F32
NoYes   Helicobacter pylori J99
NoYes   Helicobacter pylori 26695
NoYes   Helicobacter pylori 26695
NoYes   Lawsonia intracellularis N343
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio vulgaris RCH1
NoYes   Desulfovibrio vulgaris str. 'Miyazaki F'
NoYes   Desulfovibrio vulgaris str. Hildenborough
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Burkholderia phenoliruptrix BR3459a
NoYes   Pandoraea pnomenusa 3kgm
NoYes   Ralstonia pickettii 12J
NoYes   Ralstonia solanacearum FQY_4
NoYes   Ralstonia solanacearum Po82
NoYes   Ralstonia solanacearum PSI07
NoYes   Ralstonia solanacearum CMR15
NoYes   Ralstonia solanacearum GMI1000
NoYes   Burkholderia sp. YI23
NoYes   Burkholderia sp. CCGE1003
NoYes   Burkholderia sp. CCGE1001
NoYes   Burkholderia sp. KJ006
NoYes   Burkholderia thailandensis MSMB121
NoYes   Burkholderia pseudomallei MSHR305
NoYes   Burkholderia pseudomallei NCTC 13179
NoYes   Burkholderia pseudomallei BPC006
NoYes   Burkholderia pseudomallei 1026b
NoYes   Burkholderia pseudomallei MSHR346
NoYes   Burkholderia pseudomallei 668
NoYes   Burkholderia pseudomallei 1710b
NoYes   Burkholderia pseudomallei K96243
NoYes   Burkholderia mallei NCTC 10229
NoYes   Burkholderia mallei NCTC 10247
NoYes   Burkholderia mallei ATCC 23344
NoYes   Burkholderia lata
NoYes   Burkholderia ambifaria MC40-6
NoYes   Burkholderia cenocepacia MC0-3
NoYes   Burkholderia cenocepacia AU 1054
NoYes   Burkholderia cenocepacia J2315
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia cepacia GG4
NoYes   Candidatus Symbiobacter mobilis Comamonadaceae bacterium CR
NoYes   Alicycliphilus denitrificans BC
NoYes   Variovorax paradoxus B4
NoYes   Bordetella pertussis CS
NoYes   Bordetella parapertussis 18323
NoYes   Bordetella bronchiseptica MO149
NoYes   Bordetella bronchiseptica 253
NoYes   Achromobacter xylosoxidans NBRC 15126 = ATCC 27061
NoYes   Nitrosomonas sp. AL212
NoYes   Sulfuricella denitrificans skB26
NoYes   Caulobacter crescentus CB15
NoYes   Magnetospirillum gryphiswaldense MSR-1 v2
NoYes   Rhodospirillum rubrum ATCC 11170
NoYes   Micavibrio aeruginosavorus EPB
NoYes   Methylobacterium extorquens DM4
NoYes   Methylobacterium extorquens PA1
NoYes   Oligotropha carboxidovorans OM5
NoYes   Oligotropha carboxidovorans OM5
NoYes   Rhodopseudomonas palustris DX-1
NoYes   Rhodopseudomonas palustris TIE-1
NoYes   Rhodopseudomonas palustris HaA2
NoYes   Rhodopseudomonas palustris BisB5
NoYes   Rhodopseudomonas palustris BisB18
NoYes   Rhodopseudomonas palustris CGA009
NoYes   Bradyrhizobium sp. S23321
NoYes   Bradyrhizobium sp. BTAi1
NoYes   Bradyrhizobium oligotrophicum S58
NoYes   Bradyrhizobium japonicum USDA 6
NoYes   Simiduia agarivorans SA1 = DSM 21679
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio fischeri ES114
NoYes   Vibrio sp. EJY3
NoYes   Vibrio parahaemolyticus BB22OP
NoYes   Vibrio alginolyticus NBRC 15630 = ATCC 17749
NoYes   Vibrio anguillarum Listonella anguillarum M3
NoYes   Vibrio nigripulchritudo VibrioScope
NoYes   Vibrio vulnificus CMCP6
NoYes   Vibrio vulnificus YJ016
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Idiomarina loihiensis GSL 199
NoYes   Shewanella sp. W3-18-1
NoYes   Shewanella sp. ANA-3
NoYes   Shewanella baltica BA175
NoYes   Shewanella baltica OS678
NoYes   Shewanella baltica OS117
NoYes   Shewanella baltica OS223
NoYes   Shewanella baltica OS195
NoYes   Shewanella baltica OS155
NoYes   Shewanella sp. MR-7
NoYes   Shewanella putrefaciens 200
NoYes   Glaciecola psychrophila 170
NoYes   Alteromonas macleodii str. 'Ionian Sea UM4b'
NoYes   Alteromonas macleodii str. 'Ionian Sea UM7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U8'
NoYes   Alteromonas macleodii str. 'Ionian Sea U7'
NoYes   Alteromonas macleodii str. 'Ionian Sea U4'
NoYes   Alteromonas macleodii str. 'Aegean Sea MED64'
NoYes   Alteromonas macleodii str. 'English Channel 615'
NoYes   Alteromonas macleodii AltDE1
NoYes   Alteromonas macleodii str. 'English Channel 673'
NoYes   Alteromonas macleodii str. 'Balearic Sea AD45'
NoYes   Alteromonas macleodii str. 'Black Sea 11'
NoYes   Alteromonas macleodii ATCC 27126
NoYes   Alcanivorax dieselolei B5
NoYes   Thalassolituus oleivorans MIL-1
NoYes   Stenotrophomonas maltophilia D457
NoYes   Stenotrophomonas maltophilia JV3
NoYes   Stenotrophomonas maltophilia R551-3
NoYes   Xanthomonas citri subsp. citri Aw12879
NoYes   Xanthomonas campestris pv. vesicatoria str. 85-10
NoYes   Xanthomonas axonopodis pv. citrumelo F1
NoYes   Xanthomonas axonopodis Xac29-1
NoYes   Xanthomonas oryzae pv. oryzicola BLS256
NoYes   Xanthomonas oryzae pv. oryzae MAFF 311018
NoYes   Xanthomonas oryzae pv. oryzae KACC 10331
NoYes   Xanthomonas campestris pv. raphani 756C
NoYes   Xanthomonas campestris pv. campestris str. 8004
NoYes   Xanthomonas campestris pv. campestris str. ATCC 33913
NoYes   Proteus mirabilis BB2000
NoYes   Morganella morganii subsp. morganii KT
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis Angola
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Dickeya dadantii Ech586
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Pantoea ananatis LMG 5342
NoYes   Pantoea ananatis PA13
NoYes   Pantoea ananatis AJ13355
NoYes   Erwinia pyrifoliae DSM 12163
NoYes   Erwinia amylovora CFBP1430
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii SP291
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella boydii Sb227
NoYes   Salmonella bongori N268-08
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Pullorum str. S06004
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum str. 287/91
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli P12b
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae EcWSU1
NoYes   Enterobacter cloacae subsp. cloacae ENHKU01
NoYes   Enterobacter cloacae subsp. cloacae NCTC 9394
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Azotobacter vinelandii CA6
NoYes   Azotobacter vinelandii CA
NoYes   Pseudomonas denitrificans ATCC 13867
NoYes   Pseudomonas syringae pv. phaseolicola 1448A
NoYes   Pseudomonas syringae pv. syringae B728a
NoYes   Pseudomonas stutzeri CCUG 29243
NoYes   Pseudomonas stutzeri DSM 10701
NoYes   Pseudomonas stutzeri DSM 4166
NoYes   Pseudomonas stutzeri RCH2
NoYes   Pseudomonas stutzeri ATCC 17588 = LMG 11199
NoYes   Pseudomonas monteilii SB3101
NoYes   Pseudomonas monteilii SB3078
NoYes   Pseudomonas putida H8234
NoYes   Pseudomonas putida HB3267
NoYes   Pseudomonas putida NBRC 14164
NoYes   Pseudomonas putida DOT-T1E
NoYes   Pseudomonas putida S16
NoYes   Pseudomonas putida BIRD-1
NoYes   Pseudomonas putida W619
NoYes   Pseudomonas putida ND6
NoYes   Pseudomonas putida KT2440
NoYes   Pseudomonas putida GB-1
NoYes   Pseudomonas protegens CHA0
NoYes   Pseudomonas poae RE*1-1-14
NoYes   Pseudomonas fluorescens F113
NoYes   Pseudomonas fluorescens A506
NoYes   Pseudomonas fluorescens R124
NoYes   Pseudomonas fluorescens Pf0-1
NoYes   Pseudomonas resinovorans NBRC 106553
NoYes   Pseudomonas mendocina NK-01
NoYes   Pseudomonas aeruginosa SCV20265
NoYes   Pseudomonas aeruginosa MTB-1
NoYes   Pseudomonas aeruginosa LES431
NoYes   Pseudomonas aeruginosa RP73
NoYes   Pseudomonas aeruginosa B136-33
NoYes   Pseudomonas aeruginosa PA1R
NoYes   Pseudomonas aeruginosa PA1
NoYes   Pseudomonas aeruginosa DK2
NoYes   Pseudomonas aeruginosa NCGM2.S1
NoYes   Pseudomonas aeruginosa M18
NoYes   Pseudomonas aeruginosa LESB58
NoYes   Pseudomonas aeruginosa PA7
NoYes   Pseudomonas aeruginosa PAO1
NoYes   Methylophaga sp. JAM7
NoYes   Ricinus communis - Castor bean
NoYes   Vibrio campbellii ATCC BAA-1116
NoYes   2_050719S (meta-genome)
NoYes   2_Base_of_chrolophyll_max (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Activated sludge plasmid pool Visp-2009 (Newbler) (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 1 (meta-genome)
NoYes   Air microbial communities Singapore indoor air filters 2 (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Dump bottom (Dump bottom) (meta-genome)
NoYes   Dump top (Dump top) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP14 from OSP Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Miscanthus rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample of Miscanthus x giga (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Sludge/US, Jazz Assembly (meta-genome)
NoYes   Sludge/US, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2+ (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 3 Nevada Test Site Creosote CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Uranium Contaminated Groundwater FW106 (meta-genome)
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]