SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Voltage-gated potassium channels alignments in Callithrix jacchus 76_3.2.1

These alignments are sequences aligned to the 0041998 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                           10        20          30                 
                                                            |         |           |                 
d1orqc_               .........................igdv----MEHPLVELGVSYAALLSVIVVVVE..CTMQ...............
ENSCJAP00000001034  ...........................sa-------RAIAIVSVLVILISIITFCLE..TLPEfrderellrhppaph
ENSCJAP00000006275  .........................argi----------AIVSVLVILISIVIFCLE..TLPEfrdekdypsspsqda
ENSCJAP00000011257  .........................sspa-------RGIAIVSVLVILISIVIFCLE..TLPEfrddrdlvmalsagg
ENSCJAP00000051240  .........................sspa-------RGIAIVSVLVILISIVIFCLE..TLPEfrddrdlvmalsagg
ENSCJAP00000040816  .........................argi----------AIVSVLVILISIVIFCLE..TLPQfrvdgrgggngggvs
ENSCJAP00000041201  ..........................qil----------AIISIMFIVLSTIALSLN..TLPE...............
ENSCJAP00000041491  ..........................scp------ARVVAVLSFLLILVSSVVMCMG..TIPE...............
ENSCJAP00000000350  ..........................sqa------ARVLAVVSVLVILVSIVVFCLE..TLPDfrddrrrgvggdgrg
ENSCJAP00000002245  ...........................sr-----AARFIAFASLFFILVSITTFCLE..THEAfnivknktepvingt
ENSCJAP00000006280  ............................s---------------------IVSFCLE..TLPIfrdenedmhgggvtf
ENSCJAP00000000354  ..........................sqa------ARVLAVVSVLVILVSIVVFCLE..TLPDfrddrdgpglaavaa
ENSCJAP00000002246  ...........................sr-----AARFIAFASLFFILVSITTFCLE..THEAfnivknktepvingt
ENSCJAP00000002252  ...........................sr-----AARFIAFASLFFILVSITTFCLE..THEAfnivknktepvingt
ENSCJAP00000043218  ...........................sr-----AARFIAFASLFFILVSITTFCLE..THEAfnivknktepvingt
ENSCJAP00000002244  ...........................sr-----AARFIAFASLFFILVSITTFCLE..THEAfnivknktepvingt
ENSCJAP00000006178  ...........................sr-----AARVVAFASLFFILVSITTFCLE..THEAfnidrnvteilrvgn
ENSCJAP00000006190  ...........................sr-----AARVVAFASLFFILVSITTFCLE..THEAfnidrnvteilrvgn
ENSCJAP00000011362  .............................PGSSTAARIFGVISIIFVVVSIINMALM..SAE-...............
ENSCJAP00000042235  .............................PGSSTAARIFGVISIIFVVVSIINMALM..SAE-...............
ENSCJAP00000006168  ...........................sr-----AARVVAFASLFFILVSITTFCLE..THEAfnidrnvteilrvgn
ENSCJAP00000020121  .......................kaigva-------------SSIFVLVSVVTLALN..TVEE...............
ENSCJAP00000006183  ..........................sry------ARVTAWAELGFQLTSLSAFCLE..THERfnpivnktienvrng
ENSCJAP00000013687  .......................liaiss--------------LSVVLASIVAMCVH..SMSE...............
ENSCJAP00000007967  ............................q--------YVAFASLFFILISITTFCLE..THEGfihisnktvtqaspi
ENSCJAP00000013573  ..........................aet----------------------------..----...............
ENSCJAP00000020116  .........................igva-------------SSIFVLVSVVTLALN..TVEE...............
ENSCJAP00000028718  .............................PGYSVLSRVFSILSILVVMGSIITMCLN..SLPDfqipdsq........
ENSCJAP00000000985  .........................glpg-------KVFACLSVLFVTVTAVNLSVS..TLPS...............
ENSCJAP00000049469  .........................glpg-------KVFACLSVLFVTVTAVNLSVS..TLPS...............
ENSCJAP00000014952  .............................PGYSLPSKLFSCVSISVVLASIAAMCIH..SLPEyqareaaaavaavaa
ENSCJAP00000032384  .............................PGYSLPSKLFSCVSISVVLASIAAMCIH..SLPEyqareaaaavaavaa
ENSCJAP00000007249  ..........................lpg-------KVFACLSILFVATTAVSLCVS..TMPD...............
ENSCJAP00000027043  ..........................aqi---------LASVSVVFVIVSMVVLCAS..TLPDwrnaaadnrslddrs
ENSCJAP00000050058  .............................-HYSPFKAVWDWLILLLVIYTAVFTPYS..AAFL...............
ENSCJAP00000037509  .............................-HYSPFKAVWDWLILLLVIYTAVFTPYS..AAFL...............
ENSCJAP00000014024  .............................-HYSPFKAVWDWLILLLVIYTAVFTPYS..AAFL...............
ENSCJAP00000037518  .............................-HYSPFKAVWDWLILLLVIYTAVFTPYS..AAFL...............
ENSCJAP00000037477  .............................-HYSPFKAVWDWLILLLVIYTAVFTPYS..AAFL...............
ENSCJAP00000037521  .............................-HYSPFKAVWDWLILLLVIYTAVFTPYS..AAFL...............
ENSCJAP00000018246  ............................w------AFIYHAFVFLLVFGCLILSVFS..TIPE...............
ENSCJAP00000011046  .............................-HYSPFKAVWDWLILLLVIYTAVFTPYS..AAFL...............
ENSCJAP00000036726  .............................-HYSPFKAVWDWLILLLVIYTAVFTPYS..AAFL...............
ENSCJAP00000003807  .............................-HYSPFKAVWDWLILLLVIYTAVFTPYS..AAFL...............
ENSCJAP00000011055  .............................-HYSPFKAVWDWLILLLVIYTAIFTPYS..AAFL...............
ENSCJAP00000035788  ...........................fk-------TTWDWVILILTFYTAIMVPYN..VSF-...............
ENSCJAP00000035791  ...........................fk-------TTWDWVILILTFYTAIMVPYN..VSF-...............
ENSCJAP00000035786  ...........................fk-------TTWDWVILILTFYTAIMVPYN..VSF-...............
ENSCJAP00000035785  ...........................fk-------TTWDWVILILTFYTAIMVPYN..VSF-...............
ENSCJAP00000005433  ............................l----------------LVFSCLVLSVLS..TIQE...............
ENSCJAP00000018820  ............................l--------------VFSCLVLSVFSTIR..NHQE...............
ENSCJAP00000032952  ...........................hn--------WFETFIIFMILLSSGALAFEd.IYIE...............
ENSCJAP00000032909  ...........................hn--------WFETFIIFMILLSSGALAFEd.IYIE...............
ENSCJAP00000005420  ............................l----------------LVFSCLVLSVLS..TIQE...............
ENSCJAP00000021515  ...........................pr---GCKCFIYHFAVFLIVLVCLIFSVLS..TIEQ...............
ENSCJAP00000018413  ............................h-------SWFETFIIFMILLSSGALAFEd.IYLE...............
ENSCJAP00000036144  ...........................hn--------WFETFIVFMILLSSGALAFEd.IYIE...............
ENSCJAP00000018484  ............................h-------SWFETFIIFMILLSSGALAFEd.IYLE...............
ENSCJAP00000018438  ............................h-------SWFETFIIFMILLSSGALAFEd.IYLE...............
ENSCJAP00000034755  ............................h-------KMFDHVVLVIIFLNCITIAMEr.PKID...............
ENSCJAP00000011266  ...........................hn--------WFETFIVFMILLSSGALAFEd.IYIE...............
ENSCJAP00000034722  ............................h-------KMFDHVVLVIIFLNCITIAMEr.PKID...............
ENSCJAP00000011510  ...........................hn--------WFETFIVFMILLSSGALAFEd.IYIE...............
ENSCJAP00000011251  ...........................hn--------WFETFIVFMILLSSGALAFEd.IYIE...............
ENSCJAP00000011518  ...........................hn--------WFETFIVFMILLSSGALAFEd.IYIE...............
ENSCJAP00000011461  ...........................hn--------WFETFIVFMILLSSGALAFEd.IYIE...............
ENSCJAP00000035750  ...........................fk-------TTWDWVILILTFYTAIMVPYN..VSF-...............
ENSCJAP00000011705  ...........................hn--------WFETFIVFMILLSSGALAFEd.IYID...............
ENSCJAP00000024714  ..........................stl------ALVFYYVTGFFIAVSVITNVVE..TVPCgtvpgskelp.....
ENSCJAP00000032944  ............................q--------AFDIVIMMLICLNMVTMMVE..TDT-...............
ENSCJAP00000032952  ............................q--------AFDIVIMMLICLNMVTMMVE..TDT-...............
ENSCJAP00000032909  ............................q--------AFDIVIMMLICLNMVTMMVE..TDT-...............
ENSCJAP00000040782  ..........................tst-----MALVFYYVTGFFIAVSVIANVVE..TVPCgsspghikelp....
ENSCJAP00000011510  ............................k-------QVFDISIMILICLNMVTMMVE..TDD-...............
ENSCJAP00000011251  ............................k-------QVFDISIMILICLNMVTMMVE..TDD-...............
ENSCJAP00000011518  ............................k-------QVFDISIMILICLNMVTMMVE..TDD-...............
ENSCJAP00000011461  ............................k-------QVFDISIMILICLNMVTMMVE..TDD-...............
ENSCJAP00000035768  ...........................fk-------TTWDWVILILTFYTAIMVPYN..VSF-...............
ENSCJAP00000038945  ...........................ra--------TWDGFILLATLYVAVTVPYS..VCVS...............
ENSCJAP00000038937  ...........................ra--------TWDGFILLATLYVAVTVPYS..VCVS...............
ENSCJAP00000024617  ............................h-------KLFDHVVLIFIFLNCVTIALEr.PDID...............
ENSCJAP00000011705  ............................r-------QVFDISIMILICLNMVTMMVE..TDD-...............
ENSCJAP00000035074  .............................DPSGNTYYNWLFCITLPVMYNWTMVIARa.CFDE...............
ENSCJAP00000035079  .............................DPSGNTYYNWLFCITLPVMYNWTMVIARs.CFDE...............
ENSCJAP00000008124  ..........................lqf---------------LIVLGCLILAVLT..TFKE...............
ENSCJAP00000011222  ............................q--------VFDISIMILICLNMVTMMVE..TDD-...............
ENSCJAP00000011864  ............................h-------SWFESFIVLMILLSSGALAFEd.IYIE...............
ENSCJAP00000011864  ............................q--------AFDISIMVLICLNMVTMMVE..KED-...............
ENSCJAP00000024578  .............................-------PWFEHVSMLVIMLNCVTLGMF..RPCEdve............
ENSCJAP00000018242  .............................----------------------------..----...............
ENSCJAP00000024617  ............................s-------KYFSRGIMMAILVNTLSMGVE..YHE-...............
ENSCJAP00000000792  ............................y---SVPKAIWDGLILLATFYVAVTVPYN..VCFL...............
ENSCJAP00000008119  ............................i-----------------VLGCLILAVLT..TFKE...............
ENSCJAP00000014021  ...........................wk--------PFDIFILLAIFANCVALAIY..IPFP...............
ENSCJAP00000001539  ............................s-------TYFEYLMFVLILLNTICLAMQ..HYG-...............
ENSCJAP00000006710  ..........................stf------KAGWDWLILLATFYVAVTVPYN..VCFIgn.............
ENSCJAP00000048898  ............................y---SVPKAIWDGLILLATFYVAVTVPYN..VCFL...............
ENSCJAP00000011266  ............................r-------QVFDISIMILICLNMVTMMVE..TDD-...............
ENSCJAP00000001544  ............................s-------TYFEYLMFVLILLNTICLAMQ..HYG-...............
ENSCJAP00000018110  ............................h-------GWFESFIIFVILLSSGALIFEd.VHLE...............
ENSCJAP00000008393  ............................s-------QVFYWIVLSLVALNTACVAIV..HHN-...............
ENSCJAP00000018413  ............................q--------AFDVTIMFLICLNMVTMMVE..TDD-...............
ENSCJAP00000008410  ............................s-------QVFYWIVLSLVALNTACVAIV..HHN-...............
ENSCJAP00000018484  ............................q--------AFDVTIMFLICLNMVTMMVE..TDD-...............
ENSCJAP00000018438  ............................q--------AFDVTIMFLICLNMVTMMVE..TDD-...............
ENSCJAP00000018440  ............................q--------AFDVTIMFLICLNMVTMMVE..TDD-...............
ENSCJAP00000014011  ...........................wk--------PFDIFILLAIFANCVALAIY..IPFP...............
ENSCJAP00000013976  ...........................wk--------PFDIFILLAIFANCVALAIY..IPFP...............
ENSCJAP00000050238  ...........................wk--------PFDIFILLAIFANCVALAIY..IPFP...............
ENSCJAP00000013508  .............................DPSSNLYYRWLTAIALPVFYNWCLLICRa.CFDE...............
ENSCJAP00000050035  .............................DPSSNLYYRWLTAIALPVFYNWCLLICRa.CFDE...............
ENSCJAP00000013510  .............................DPSSNLYYRWLTAIALPVFYNWCLLICRa.CFDE...............
ENSCJAP00000013487  .............................DPSSNLYYRWLTAIALPVFYNWCLLICRa.CFDE...............
ENSCJAP00000008406  ............................s-------QVFYWIVLSLVALNTACVAIV..HHN-...............
ENSCJAP00000001452  ............................s-------TYFEYLMFVLILLNTICLAMQ..HYG-...............
ENSCJAP00000007056  .............................DPAGDWYYRWLFVIAMPVLYNWCLLVARa.CFSD...............
ENSCJAP00000007061  .............................DPAGDWYYRWLFVIAMPVLYNWCLLVARa.CFSD...............
ENSCJAP00000024932  ............................a-------QSFYWVVLCVVALNTLCVAMV..HYN-...............
ENSCJAP00000024922  ............................a-------QSFYWVVLCVVALNTLCVAMV..HYN-...............
ENSCJAP00000005022  ............................k--------PFDILILLTIFANCVALGVY..IPFP...............
ENSCJAP00000015533  .............................HPYSDFRFYWDLIMLLLMVGNLIVLPVG..ITF-...............
ENSCJAP00000015531  .............................HPYSDFRFYWDLIMLLLMVGNLIVLPVG..ITF-...............
ENSCJAP00000036148  ...........................hn--------WFETFIVFMILLSSGALAFEd.IYIE...............
ENSCJAP00000018471  ............................r-------QAFDVTIMVLICLNMITMMVE..TDE-...............
ENSCJAP00000036134  ...........................hn--------WFETFIVFMILLSSGALAFEd.IYIE...............
ENSCJAP00000051809  ............................p---------FEYMMFVLIMLNTLCLAMQ..HYE-...............
ENSCJAP00000018440  ............................h-------SWFETFIIFMILLSSGALAFEd.IYLE...............
ENSCJAP00000051772  ............................s-------TYFEYLMFVLILLNTICLAMQ..HYG-...............
ENSCJAP00000001522  ............................s-------TYFEYLMFVLILLNTICLAMQ..HYG-...............
ENSCJAP00000043192  ............................s-------TYFEYLMFVLILLNTICLAMQ..HYG-...............
ENSCJAP00000002533  .............................HPYSDFRFYWDLIMLIMMVGNLVIIPVG..ITF-...............
ENSCJAP00000008130  ............................t-------QAFYWTVLSLVALNTLCVAIV..HYN-...............
ENSCJAP00000014011  ............................p---------FEYMMFVLIMLNTLCLAMQ..HYE-...............
ENSCJAP00000001328  ...........................aq---------TLTGRVLVVLVFALSIGAL..VIYF...............
ENSCJAP00000001906  ...........................aq---------TLTGRVLVVLVFALSIGAL..VIYF...............
ENSCJAP00000049896  ...........................aq---------TLTGRVLVVLVFALSIGAL..VIYF...............
ENSCJAP00000042093  ...........................aq---------TLTGRVLVVLVFALSIGAL..VIYF...............
ENSCJAP00000014021  ............................p---------FEYMMFVLIMLNTLCLAMQ..HYE-...............
ENSCJAP00000013976  ............................p---------FEYMMFVLIMLNTLCLAMQ..HYE-...............
ENSCJAP00000050238  ............................p---------FEYMMFVLIMLNTLCLAMQ..HYE-...............
ENSCJAP00000024617  ............................s-------HYLDLFITFIICVNVITMSME..HYN-...............
ENSCJAP00000051772  ............................n--------VFYWLVIFLVFLNTLTIASE..HYN-...............
ENSCJAP00000001522  ............................n--------VFYWLVIFLVFLNTLTIASE..HYN-...............
ENSCJAP00000008352  ............................s-------QVFYWIVLSLVALNTACVAIV..HHN-...............
ENSCJAP00000043192  ............................n--------VFYWLVIFLVFLNTLTIASE..HYN-...............
ENSCJAP00000001452  ............................n--------VFYWLVIFLVFLNTLTIASE..HYN-...............
ENSCJAP00000009758  ............................n--------VFYWLVIFLVFLNTLTIASE..HYN-...............
ENSCJAP00000001424  ............................n--------VFYWLVIFLVFLNTLTIASE..HYN-...............
ENSCJAP00000001424  ............................t--------YFEYLMFVLILLNTICLAMQ..HYG-...............
ENSCJAP00000009782  ............................s-------SYFEYLMFALIMLNTICLGMQ..HYN-...............
ENSCJAP00000009782  ............................s-------KVFYWLVILIVALNTLSIASE..HHN-...............
ENSCJAP00000008130  ............................s-------PPFEYTIMAMIALNTIVLMMK..FYG-...............
ENSCJAP00000005022  ............................a--------AFEYLMFLLILLNTVALAMQ..HYE-...............
ENSCJAP00000004594  ..........................sta------ALVFYYVTGFFIAVSVIANVVE..TIPCrssarrssreqp...
ENSCJAP00000036717  .............................-HYSPFKAVWDWLILLLVIYTAVFTPYS..AAFL...............
ENSCJAP00000001901  ..........................saq---------TLTGRVLVVLVFALSIGAL..VIYF...............
ENSCJAP00000034755  ...........................sh--------YLDLFITGVIGLNVVTMAME..HYQ-...............
ENSCJAP00000011864  ...........................hs--------LFSMLIMCTILTNCIFMTLY..----...............
ENSCJAP00000005008  ............................a--------AFEYLMFLLILLNTVALAMQ..HYE-...............
ENSCJAP00000034722  ...........................sh--------YLDLFITGVIGLNVVTMAME..HYQ-...............
ENSCJAP00000034731  ...........................sh--------YLDLFITGVIGLNVVTMAME..HYQ-...............
ENSCJAP00000024932  ............................m-------RYFEMVILVVIALSSIALAAE..DPVR...............
ENSCJAP00000024922  ............................m-------RYFEMVILVVIALSSIALAAE..DPVR...............
ENSCJAP00000008393  ............................s-------PSFEYTIMAMIALNTVVLMMK..YYS-...............
ENSCJAP00000008406  ............................s-------PSFEYTIMAMIALNTVVLMMK..YYS-...............
ENSCJAP00000008410  ............................s-------PSFEYTIMAMIALNTVVLMMK..YYS-...............
ENSCJAP00000024922  ............................s-------PPFEYFIMAMIALNTVVLMMK..FYD-...............
ENSCJAP00000018110  ..........................tes----------------------------..----...............
ENSCJAP00000024932  ............................s-------PPFEYFIMAMIALNTVVLMMK..FYD-...............
ENSCJAP00000014011  ............................v--------TFYWLVIVLVFLNTLTISSE..HYN-...............
ENSCJAP00000009782  ...........................kp---------FETIILLTIFANCVALAVY..LPMP...............
ENSCJAP00000008352  ............................l-------RYFEMCILLVIAASSIALAAE..DPVL...............
ENSCJAP00000011251  .............................-------PFVDLAITICIVLNTLFMAME..HYP-...............
ENSCJAP00000011518  .............................-------PFVDLAITICIVLNTLFMAME..HYP-...............
ENSCJAP00000011461  .............................-------PFVDLAITICIVLNTLFMAME..HYP-...............
ENSCJAP00000009782  ............................a-------TWFTNFILLFIMLSSAALAAE..DPIR...............
ENSCJAP00000032909  .............................-------PFVDLAITICIVLNTLFMAME..HHP-...............
ENSCJAP00000011510  .............................-------PFVDLAITICIVLNTLFMAME..HYP-...............
ENSCJAP00000051432  ............................v--------TFYWLVIVLVFLNTLTISSE..HYN-...............
ENSCJAP00000011266  .............................-------PFVDLAITICIVLNTLFMAME..HYP-...............
ENSCJAP00000024922  ............................w-------PPFEYMILATIIANCIVLALEq.HLPD...............
ENSCJAP00000003065  ...........................sl--------AFEAFVVFIVCLNTIMLVAQ..TFAE...............
ENSCJAP00000049104  ...........................sl--------AFEAFVVFIVCLNTIMLVAQ..TFAE...............
ENSCJAP00000032944  .............................-------PFVDLAITICIVLNTLFMAME..HHP-...............
ENSCJAP00000032952  .............................-------PFVDLAITICIVLNTLFMAME..HHP-...............
ENSCJAP00000008393  ............................w-------PPFEYMILATIIANCIVLALEq.HLPE...............
ENSCJAP00000008406  ............................w-------PPFEYMILATIIANCIVLALEq.HLPE...............
ENSCJAP00000008410  ............................w-------PPFEYMILATIIANCIVLALEq.HLPE...............
ENSCJAP00000013976  ............................v--------TFYWLVIVLVFLNTLTISSE..HYN-...............
ENSCJAP00000050238  ............................v--------TFYWLVIVLVFLNTLTISSE..HYN-...............
ENSCJAP00000008406  ............................l-------RYFEMCILLVIAASSIALAAE..DPVL...............
ENSCJAP00000008410  ............................l-------RYFEMCILLVIAASSIALAAE..DPVL...............
ENSCJAP00000008393  ............................l-------RYFEMCILLVIAASSIALAAE..DPVL...............
ENSCJAP00000051012  ............................v--------TFYWLVIVLVFLNTLTISSE..HYN-...............
ENSCJAP00000011705  .............................-------PFVDLAITICIVLNTLFMAME..HYP-...............
ENSCJAP00000024932  ...........................rt--------PFEYMILATIIANCIVLALEq.HLPD...............
ENSCJAP00000051772  ............................r----------------------------..----...............
ENSCJAP00000014021  ............................v--------TFYWLVIVLVFLNTLTISSE..HYN-...............
ENSCJAP00000001522  ............................r----------------------------..----...............
ENSCJAP00000026361  .............................DPSGDYYYWWLNTMVFPVMYNLIILVCRa.CFPD...............
ENSCJAP00000023649  .............................HPYSDFRFYWDFTMLLFMVGNLIIIPVG..ITF-...............
ENSCJAP00000043192  ............................r----------------------------..----...............
ENSCJAP00000009758  ............................r----------------------------..----...............
ENSCJAP00000001424  ............................r----------------------------..----...............
ENSCJAP00000024617  .............................--------WFEHVSMLVIMLNCVTLGMF..RPCEdve............
ENSCJAP00000051012  ............................p---------FEYMMFVLIMLNTLCLAMQ..HYE-...............
ENSCJAP00000009776  ............................s-------KVFYWLVILIVALNTLSIASE..HHN-...............
ENSCJAP00000047289  ...........................pp----------------------------..----...............
ENSCJAP00000049465  ...........................hs--------LFSMLIMCTILTNCVFM---..----...............
ENSCJAP00000011864  .............................-------PFVDLAITICIVLNTLFMAME..HHP-...............
ENSCJAP00000014011  ............................h-------HIFTNLILVFIMLSSAALAAE..DPIR...............
ENSCJAP00000013976  ............................h-------HIFTNLILVFIMLSSAALAAE..DPIR...............
ENSCJAP00000050238  ............................h-------HIFTNLILVFIMLSSAALAAE..DPIR...............
ENSCJAP00000014021  ............................h-------HIFTNLILVFIMLSSAALAAE..DPIR...............
ENSCJAP00000001452  ............................r----------------------------..----...............
ENSCJAP00000051012  ............................h-------HIFTNLILVFIMLSSAALAAE..DPIR...............
ENSCJAP00000024578  ............................s-------KYFSRGIMMAILVNTLSMGVE..YHE-...............
ENSCJAP00000043192  ............................i---------FTNLILFFILLSSISLAAE..DPVQ...............
ENSCJAP00000001539  ............................r----------------------------..----...............
ENSCJAP00000001452  ............................i---------FTNLILFFILLSSISLAAE..DPVQ...............
ENSCJAP00000001544  ............................r----------------------------..----...............
ENSCJAP00000051432  ............................h-------HIFTNLILVFIMLSSAALAAE..DPIR...............
ENSCJAP00000011693  ............................t--------LFNMLIMCTILTNCVFMTMS..----...............
ENSCJAP00000032944  ............................h-------SVFSMIIMCTILTNCVFMTFS..----...............
ENSCJAP00000032952  ............................h-------SVFSMIIMCTILTNCVFMTFS..----...............
ENSCJAP00000032909  ...........................hs--------LFSMIIMCTILTNCVFMTFS..----...............
ENSCJAP00000018413  ...........................hs--------LFSMLIMCTILTNCVFM---..----...............
ENSCJAP00000018438  ...........................hs--------LFSMLIMCTILTNCVFM---..----...............
ENSCJAP00000018440  ...........................hs--------LFSMLIMCTILTNCVFM---..----...............
ENSCJAP00000005090  ........................fvgqv------------LMILVFVLSIGSLIIY..LIKS...............
ENSCJAP00000011860  ...........................pp----------------------------..----...............
ENSCJAP00000051772  ............................i---------FTNLILFFILLSSISLAAE..DPVQ...............
ENSCJAP00000001522  ............................i---------FTNLILFFILLSSISLAAE..DPVQ...............
ENSCJAP00000009758  ............................i---------FTNLILFFILLSSISLAAE..DPVQ...............
ENSCJAP00000011461  ............................h-------SLFNMLIMCTILTNCVFMTMS..----...............
ENSCJAP00000008352  ............................s-------PSFEYTIMAMIALNTVVLMMK..YYS-...............
ENSCJAP00000036134  .............................-------PFVDLGITICIVLNTLFMAME..HYP-...............
ENSCJAP00000011251  ............................h-------SLFNMLIMCTILTNCVFMTMS..----...............
ENSCJAP00000011518  ............................h-------SLFNMLIMCTILTNCVFMTMS..----...............
ENSCJAP00000032944  ...........................hn--------WFETFIIFMILLSSGALAFEd.IYIE...............
ENSCJAP00000011705  ...........................fs--------IFSMLIMCTILTNCVFMTMS..SPP-...............
ENSCJAP00000018484  ..........................ypl----------HMLIMCTILTNCVFM---..----...............
ENSCJAP00000018413  ............................p--------FADLTITMCIVLNTLFMALE..HYN-...............
ENSCJAP00000036134  ............................h-------TLFSMFIMITILTNCVFMTMS..----...............
ENSCJAP00000000428  ............................l------YLLWLLLVTLAYNWNCWFIPLRl.VFPY...............
ENSCJAP00000018440  ............................p--------FADLTITMCIVLNTLFMALE..HYN-...............
ENSCJAP00000018484  ............................p--------FADLTITMCIVLNTLFMALE..HYN-...............
ENSCJAP00000018438  ............................p--------FADLTITMCIVLNTLFMALE..HYN-...............
ENSCJAP00000005022  ............................y-----------WAVLLLVFLNTLTIASE..HHG-...............
ENSCJAP00000018471  ............................h-------SWFESFIIFMILLSSGSLAFEd.YYLD...............
ENSCJAP00000051432  ............................p---------FEYMMFVLIMLNTLCLAMQ..HYE-...............
ENSCJAP00000011510  ............................l---------FNMLIMCTILTNCVFMTMS..----...............
ENSCJAP00000028522  ............................s----------------------------..----...............
ENSCJAP00000005008  ............................h-------HVFTNLILVFIILSSVSLAAE..DPIR...............
ENSCJAP00000008130  ............................l-------RYFEMCILMVIAMSSIALAAE..DPVQ...............
ENSCJAP00000005022  ............................h-------HVFTNLILVFIILSSVSLAAE..DPIR...............
ENSCJAP00000036148  .............................-------PFVDLGITICIVLNTLFMAME..HYP-...............
ENSCJAP00000009776  .............................----------------------------..----...............
ENSCJAP00000018471  ............................h-------LWFSLFITVTILVNCVCMTQT..ELP-...............
ENSCJAP00000036144  .............................-----------MFIMITILTNCVFMTMS..----...............
ENSCJAP00000018471  ..........................pfa----------ELTITLCIVVNTVFMAME..YHG-...............
ENSCJAP00000036148  ............................g-----------MFIMITILTNCVFMTMS..----...............
ENSCJAP00000001539  ............................n--------VFYWLVIFLVFLNTLTIASE..HYN-...............
ENSCJAP00000001544  ............................n--------VFYWLVIFLVFLNTLTIASE..HYN-...............
ENSCJAP00000015632  ............................l----------------------------..----...............
ENSCJAP00000045673  .............................----------------------------..----...............
ENSCJAP00000017214  .............................----------------------------..----...............
ENSCJAP00000030676  .............................----------------------------..----...............
ENSCJAP00000048251  .............................----------------------------..----...............
ENSCJAP00000019483  ............................l----------------------------..----...............
ENSCJAP00000017218  .............................----------------------------..----...............
ENSCJAP00000031810  ...........................ia----------------------------..----...............
ENSCJAP00000031809  ...........................ia----------------------------..----...............
ENSCJAP00000031817  ...........................ia----------------------------..----...............
ENSCJAP00000018110  ...........................hs--------LFSMFIISTVIINCVFMASG..LGK-...............
ENSCJAP00000025797  lrlyllgrvmllhskiftdassrsigaln----------------------------..----...............
ENSCJAP00000047563  lrlyllgrvmllhskiftdassrsigaln----------------------------..----...............
ENSCJAP00000025796  lrlyllgrvmllhskiftdassrsigaln----------------------------..----...............
ENSCJAP00000036144  .............................-------PFVDLGITICIVLNTLFMAME..HYP-...............
ENSCJAP00000001539  ............................i---------FTNLILFFILLSSISLAAE..DPVQ...............
ENSCJAP00000015636  ............................l----------------------------..----...............
ENSCJAP00000001544  ............................i---------FTNLILFFILLSSISLAAE..DPVQ...............
ENSCJAP00000044387  ............................s-------QVFNVIVMVLICFQAIAMMID..TDE-...............
ENSCJAP00000051406  lrlyllgrvmllhskiftdassrsigaln----------------------------..----...............
ENSCJAP00000017751  .............................------HPAFQLLLAVLLVVNAITIALR..TNSY...............
ENSCJAP00000001424  ...........................lg----------------------------..----...............
ENSCJAP00000028312  ..................mkifkkwnvsq----------------------------..----...............
ENSCJAP00000039183  ...........................vt--------YLDWVMIIVTICSCISMMFE..SPF-...............
ENSCJAP00000018110  .............................-------PFTELAITICIIINTVFLAME..HHK-...............
ENSCJAP00000039178  ...........................vt--------YLDWVMIIVTICSCISMMFE..SPF-...............
ENSCJAP00000011922  ............................s-------QVFNVIVMVLICFQAIAMMID..TDE-...............
ENSCJAP00000007663  ...........................rt----------------------------..----...............
ENSCJAP00000032603  ...........................rt----------------------------..----...............
ENSCJAP00000009758  .............................----------------------------..----...............
ENSCJAP00000025602  .........................rgla----------------------------..----...............
ENSCJAP00000048019  .........................nsik----------------------------..----...............
ENSCJAP00000010880  ............................r----------------------------..----...............
ENSCJAP00000028254  ......................wnvsqtk----------------------------..----...............
ENSCJAP00000024637  ..................rfrhwfvakly----------------------------..----...............
ENSCJAP00000028292  ......................wnvsqtk----------------------------..----...............
ENSCJAP00000021660  ............................m------YILWLFFVVMAWNWNCWLIPVRw.AFPY...............
ENSCJAP00000021649  ............................m------YILWLFFVVMAWNWNCWLIPVRw.AFPY...............
ENSCJAP00000028286  ......................wnvsqtk----------------------------..----...............
ENSCJAP00000036223  ...........................fp----------------------------..----...............
ENSCJAP00000010869  ............................r----------------------------..----...............
ENSCJAP00000044387  .............................--------WFKCFIGLVTLLSTSTLALEd.IYID...............
ENSCJAP00000033717  ..........................ver----------------------------..----...............
ENSCJAP00000000198  ..........................gqr----------------------------..----...............
ENSCJAP00000051538  ..........................gqr----------------------------..----...............
ENSCJAP00000011266  ...........................st--------LFSMLIMCTILTNCVFMTLS..----...............
ENSCJAP00000036144  ............................k-------QVFDITIMILICLNMVTMMVE..TDD-...............
ENSCJAP00000031810  ............................t----------------------------..----...............
ENSCJAP00000031809  ............................t----------------------------..----...............
ENSCJAP00000031817  ............................t----------------------------..----...............
ENSCJAP00000004803  ............................c-------PLFTNFIIFLIFLNTIVLMVE..IELL...............
ENSCJAP00000011922  .............................--------WFKCFIGLVTLLSTSTLALEd.IYID...............
ENSCJAP00000010847  ............................t----------------------------..----...............
ENSCJAP00000010844  ............................t----------------------------..----...............
ENSCJAP00000034853  .........................ksqr----------------------------..----...............
ENSCJAP00000004793  ............................c-------PLFTNFIIFLIFLNTIVLMVE..IELL...............
ENSCJAP00000007663  .............krikkccgmrntdvsm----------------------------..----...............
ENSCJAP00000032603  .............krikkccgmrntdvsm----------------------------..----...............
ENSCJAP00000042788  ............................m----------------------------..----...............
ENSCJAP00000033365  ............................a----------------------------..----...............
ENSCJAP00000004804  ............................c-------PLFTNFIIFLIFLNTIVLMVE..IELL...............
ENSCJAP00000028286  ............................m----------------------------..----...............
ENSCJAP00000028292  ............................m----------------------------..----...............
ENSCJAP00000025789  lrlyllgrvmllhskiftdassrsigaln----------------------------..----...............
ENSCJAP00000028254  ............................m----------------------------..----...............
ENSCJAP00000033361  ...........................tt----------------------------..----...............
ENSCJAP00000016635  .........................qety----------------------------..----...............
ENSCJAP00000044520  .........................qety----------------------------..----...............
ENSCJAP00000004712  .......................nvrety----------------------------..----...............
ENSCJAP00000004717  .......................nvrety----------------------------..----...............
ENSCJAP00000033717  ................rrpvlyfhirwgf----------------------------..----...............
ENSCJAP00000028312  ............................m----------------------------..----...............
ENSCJAP00000000665  ............................a----------------------------..----...............
ENSCJAP00000010822  ............................r----------------------------..----...............
ENSCJAP00000011922  .............................------APFTDLFLFICIILNVSFLALE..HYP-...............
ENSCJAP00000030680  ..................svfkaayclps----------------------------..----...............
ENSCJAP00000036134  ............................k-------QVFDITIMILICLNMVTMMVE..TDD-...............
ENSCJAP00000036148  ............................q--------VFDITIMILICLNMVTMMVE..TDD-...............
ENSCJAP00000041691  ........................gsyvv----------------------------..----...............
ENSCJAP00000043961  ........................gsyvv----------------------------..----...............
ENSCJAP00000050339  ........................gsyvv----------------------------..----...............
ENSCJAP00000032611  ...........................ar----------------------------..----...............
ENSCJAP00000036223  .........................kldi----------------------------..----...............
ENSCJAP00000006678  ............................s----------------------------..----...............
ENSCJAP00000002449  ..............hrakkglgmrradvs----------------------------..----...............
ENSCJAP00000028533  ...........................ts----------------------------..----...............
ENSCJAP00000008130  ..........................gte----------------------------..----...............
ENSCJAP00000033335  ..........................lml----------------------------..----...............
ENSCJAP00000044017  .............................------HPAFQLLLAVLLVVNAITIALR..TNSY...............
ENSCJAP00000002449  ..........................agv----------------------------..----...............
ENSCJAP00000008352  .............................----------------------------..----...............
ENSCJAP00000010847  ...................vtwqdpgkaq----------------------------..----...............
ENSCJAP00000010844  ...................vtwqdpgkaq----------------------------..----...............
ENSCJAP00000032608  ..........................rps----------------------------..----...............
ENSCJAP00000001064  ......................lnedtgr----------------------------..----...............
ENSCJAP00000044773  ...........................kr----------------------------..----...............
ENSCJAP00000015112  ...........................ly----------------------------..----...............
ENSCJAP00000042307  ...........................ly----------------------------..----...............
ENSCJAP00000044603  ...........................ly----------------------------..----...............
ENSCJAP00000032611  .........................vyyv----------------------------..----...............
ENSCJAP00000024941  ..........................hwg----------------------------..----...............
ENSCJAP00000039178  ...........................sv---------FHMFILSMVTVDVIVAASN..YYKG...............
ENSCJAP00000010822  ............................n----------------------------..----...............
ENSCJAP00000010657  ............................h--------FFKIIMICAVGSNAFLTALW..TSYD...............
ENSCJAP00000045969  ...........................tl---------FRLFILISVLTDCIFMSLT..----...............
ENSCJAP00000010880  .........latierwedqprrsqllrvl----------------------------..----...............
ENSCJAP00000047810  ...........................ic----------------AVGSNAFLTALW..TSYD...............
ENSCJAP00000032608  ...................lrrarvsten----------------------------..----...............
ENSCJAP00000024941  .........................laga----------------------------..----...............
ENSCJAP00000016592  .......................rliffv----------------------------..----...............
ENSCJAP00000001064  .....................gwkpsvyh----------------------------..----...............
ENSCJAP00000039183  ...........................sv---------FHMFILSMVTVDVIVAASN..YYKG...............
ENSCJAP00000029287  .............................------HYYFDYLGNLIALANLVSICVF..LVLD...............
ENSCJAP00000010869  .........latierwedqprrsqllrvl----------------------------..----...............
ENSCJAP00000003851  ............................r----------------------------..----...............
ENSCJAP00000018351  ............................s-------KAFQYFMYLVVAVNGVWILVE..TFML...............
ENSCJAP00000011922  ...........................at--------LFRLFILISVLTDCIFMSLT..----...............
ENSCJAP00000039178  .............................-------PWVHSLLRICAIISVISVCMNtpVTFE...............
ENSCJAP00000034731  ..........................slk----------------------------..----...............
ENSCJAP00000011191  ............................n----------------------------..----...............
ENSCJAP00000040639  ......awwliafahgdlapregaaepcv----------------------------..----...............
ENSCJAP00000000427  ............................l------YLLWLLLVTLAYNWNCWFIPLRl.VFPY...............
ENSCJAP00000039183  .............ffkrtiallvlaqsvl--------------------------LS..VKWD...............
ENSCJAP00000009758  ............................s-------TYFEYLMFVLILLNTICLAMQ..HYG-...............
ENSCJAP00000039178  .............ffkrtiallvlaqsvl--------------------------LS..VKWD...............
ENSCJAP00000043591  ...........................hs--------LFSMLIMCTILTNCVFM---..----...............
ENSCJAP00000018307  ............................s-------KAFQYFMYLVVAVNGVWILVE..TFML...............
ENSCJAP00000003851  ......................vvhwqls----------------------------..----...............
ENSCJAP00000018358  ............................s-------KAFQYFMYLVVAVNGVWILVE..TFML...............
ENSCJAP00000016835  ...........................sh--------RFQVIIICLVVLDALLVLAE..LILDlkiiqpd........
ENSCJAP00000016824  ...........................sh--------RFQVIIICLVVLDALLVLAE..LILDlkiiqpd........
ENSCJAP00000018307  .........................yvha----------------------------..----...............
ENSCJAP00000018358  .........................yvha----------------------------..----...............
ENSCJAP00000023858  ....................ldsfmqpfq----------------------------..----...............
ENSCJAP00000023857  ....................ldsfmqpfq----------------------------..----...............
ENSCJAP00000011719  ........................flaac----------------------------..----...............
ENSCJAP00000023869  ....................ldsfmqpfq----------------------------..----...............
ENSCJAP00000011724  ........................flaac----------------------------..----...............
ENSCJAP00000031891  .........................evvf----------------------------..----...............
ENSCJAP00000032813  ...........................fa---------FGIFGVCLLLLNVGLIFADl.IFAE...............
ENSCJAP00000018176  ...................ayeiwmcivf----------------------------..----...............
ENSCJAP00000029682  ........................fayig----------------------------..----...............
ENSCJAP00000029731  ........................fayig----------------------------..----...............
ENSCJAP00000029720  ........................fayig----------------------------..----...............
ENSCJAP00000029725  ........................fayig----------------------------..----...............
ENSCJAP00000016830  ....................iiclvvlda---------------LLVLAELILDLKI..IQPD...............
ENSCJAP00000026317  .............................-------------MVFPVMYNLIILVCRa.CFPD...............
ENSCJAP00000031883  ........................gcevv----------------------------..----...............
ENSCJAP00000008550  .........................yeiw----------------------------..----...............
ENSCJAP00000008592  .........................yeiw----------------------------..----...............
ENSCJAP00000019881  ...........................ns------------FLVACVILVVILLTLE..LLIDikllqfs........
ENSCJAP00000018165  .....................eiwmcivf----------------------------..----...............
ENSCJAP00000008585  .........................yeiw----------------------------..----...............
ENSCJAP00000051777  .........................yeiw----------------------------..----...............
ENSCJAP00000008594  .........................yeiw----------------------------..----...............
ENSCJAP00000043053  .........................yeiw----------------------------..----...............
ENSCJAP00000018166  .........................yeiw----------------------------..----...............
ENSCJAP00000043051  .....................wsvisqvi----------------------------..----...............


                                                                                 40        50       
                                                                                  |         |       
d1orqc_               ..........................................LSGE...........YLVRLYLVDLILVIILWADYA
ENSCJAP00000001034  ................qppapasgangsgvvgqpsgptvaplLPRT...........LADPFFIVETTCVIWFTFELL
ENSCJAP00000006275  .............................fdaagnstsgasgGASS...........FSDPFFVVETLCIIWFSFELL
ENSCJAP00000011257  ..........................hggllndtsaphlensGHTI...........FNDPFFIVETVCIVWFSFEFV
ENSCJAP00000051240  ..........................hggllndtsaphlensGHTI...........FNDPFFIVETVCIVWFSFEFV
ENSCJAP00000040816  rvspvsrgsqeeeedeedsytfhhgitpgemgtggssslstlGGSF...........FTDPFFLVETLCIVWFTFELL
ENSCJAP00000041201  ..........................................LQSLdefgqst....DNPQLAHVEAVCIAWFTMEYL
ENSCJAP00000041491  ..........................................LQVLdaegnrv....EHPTLENVETACIGWFTLEYL
ENSCJAP00000000350  .......................lggdfparlngsslvpgnaPRLP...........FNDPFFVVETLCICWFSFELL
ENSCJAP00000002245  .....................................svvlqYEIE...........TDPALTYVEGVCVVWFTFEFL
ENSCJAP00000006280  ...............................htysnstigyqQSTS...........FTDPFFIVETLCIIWFSFEFL
ENSCJAP00000000354  ........................agpfparlngsslvpgnaPRLP...........FNDPFFVVETLCICWFSFELL
ENSCJAP00000002246  .....................................svvlqYEIE...........TDPALTYVEGVCVVWFTFEFL
ENSCJAP00000002252  .....................................svvlqYEIE...........TDPALTYVEGVCVVWFTFEFL
ENSCJAP00000043218  .....................................svvlqYEIE...........TDPALTYVEGVCVVWFTFEFL
ENSCJAP00000002244  .....................................svvlqYEIE...........TDPALTYVEGVCVVWFTFEFL
ENSCJAP00000006178  ...................................itsvhfrREVE...........TEPILTYIEGVCVLWFTLEFL
ENSCJAP00000006190  ...................................itsvhfrREVE...........TEPILTYIEGVCVLWFTLEFL
ENSCJAP00000011362  ..........................................LSWL...........DLQLLEILEYVCISWFTGEFV
ENSCJAP00000042235  ..........................................LSWL...........DLQLLEILEYVCISWFTGEFV
ENSCJAP00000006168  ...................................itsvhfrREVE...........TEPILTYIEGVCVLWFTLEFL
ENSCJAP00000020121  ..........................................IQQHseqdeggpd..MRSILEHVEMLCIGFFTLEYL
ENSCJAP00000006183  ....................................tqvryyREAE...........TEAFLTYIEGVCVVWFTFEFL
ENSCJAP00000013687  ..........................................FQNEdgev.......DDPVLEGVEIACIAWFTGELA
ENSCJAP00000007967  ................................pgappenitnVEVE...........TEPFLTYVEGVCVVWFTFEFL
ENSCJAP00000013573  ..........................................----...........-EAFLTYIEGVCVVWFTFEFL
ENSCJAP00000020116  ..........................................IQQHseqdeggpd..MRSILEHVEMLCIGFFTLEYL
ENSCJAP00000028718  ..........................................GNPG...........EDPRFEIVEHFGIAWFTFELV
ENSCJAP00000000985  ..........................................LREEeeqghcsq...MCHNVFIVESVCVGWFSLEFL
ENSCJAP00000049469  ..........................................LREEeeqghcsq...MCHNVFIVESVCVGWFSLEFL
ENSCJAP00000014952  ......................................grsaEGVR...........DDPVLRRLEYFCIAWFSFEVS
ENSCJAP00000032384  ......................................grsaEGVR...........DDPVLRRLEYFCIAWFSFEVS
ENSCJAP00000007249  ..........................................LRAEedkgecsr...KCYYIFIVETVCVAWFSLEFC
ENSCJAP00000027043  ........................................rySAVP...........GREPSGIIEAICIGWFTAECI
ENSCJAP00000050058  ..........................................LKETeegpaapdcgyACQPLAVVDLIVDIMFIVDIL
ENSCJAP00000037509  ..........................................LKETeegpaapdcgyACQPLAVVDLIVDIMFIVDIL
ENSCJAP00000014024  ..........................................LKETeegpaapdcgyACQPLAVVDLIVDIMFIVDIL
ENSCJAP00000037518  ..........................................LKETeegpaapdcgyACQPLAVVDLIVDIMFIVDIL
ENSCJAP00000037477  ..........................................LKETeegpaapdcgyACQPLAVVDLIVDIMFIVDIL
ENSCJAP00000037521  ..........................................LKETeegpaapdcgyACQPLAVVDLIVDIMFIVDIL
ENSCJAP00000018246  ..........................................HTKL...........ASSCLLILEFVMIVVFGLEFI
ENSCJAP00000011046  ..........................................LSDQdesrrgacsy.TCSPLTVVDLIVDIMFVVDII
ENSCJAP00000036726  ..........................................LSDQdesrrgacsy.TCSPLTVVDLIVDIMFVVDII
ENSCJAP00000003807  ..........................................LSDQdesrrgacsy.TCSPLTVVDLIVDIMFVVDII
ENSCJAP00000011055  ..........................................LNDReeqkrrecgy.SCSPLNVVDLIVDIMFIIDIL
ENSCJAP00000035788  ..........................................KTKQ...........NNIAWLVLDSVVDVIFLVDIV
ENSCJAP00000035791  ..........................................KTKQ...........NNIAWLVLDSVVDVIFLVDIV
ENSCJAP00000035786  ..........................................KTKQ...........NNIAWLVLDSVVDVIFLVDIV
ENSCJAP00000035785  ..........................................KTKQ...........NNIAWLVLDSVVDVIFLVDIV
ENSCJAP00000005433  ..........................................HQEL...........ANECLLILEFVMIVVFGLEYI
ENSCJAP00000018820  ..........................................YERA...........RRGPSTSLEIVTIVVFGVEYF
ENSCJAP00000032952  ..........................................QRKT...........IRTILEYADKVFTYIFILEML
ENSCJAP00000032909  ..........................................QRKT...........IRTILEYADKVFTYIFILEML
ENSCJAP00000005420  ..........................................HQEL...........ANECLLILEFVMIVVFGLEYI
ENSCJAP00000021515  ..........................................YAAL...........ATGTLFWMEIVLVVFFGTEYM
ENSCJAP00000018413  ..........................................ERKT...........IKVLLEYADKMFTYVFVLEML
ENSCJAP00000036144  ..........................................QRRV...........IRTILEYADKVFTYIFIMEML
ENSCJAP00000018484  ..........................................ERKT...........IKVLLEYADKMFTYVFVLEML
ENSCJAP00000018438  ..........................................ERKT...........IKVLLEYADKMFTYVFVLEML
ENSCJAP00000034755  ..........................................PHSA...........KRIFLTLSNYIFTAVFLAEMT
ENSCJAP00000011266  ..........................................QRKT...........IKTMLEYADKVFTYIFILEML
ENSCJAP00000034722  ..........................................PHSA...........KRIFLTLSNYIFTAVFLAEMT
ENSCJAP00000011510  ..........................................QRKT...........IKTMLEYADKVFTYIFILEML
ENSCJAP00000011251  ..........................................QRKT...........IKTMLEYADKVFTYIFILEML
ENSCJAP00000011518  ..........................................QRKT...........IKTMLEYADKVFTYIFILEML
ENSCJAP00000011461  ..........................................QRKT...........IKTMLEYADKVFTYIFILEML
ENSCJAP00000035750  ..........................................KTKQ...........NNIAWLVLDSVVDVIFLVDIV
ENSCJAP00000011705  ..........................................QRKT...........IKTMLEYADKVFTYIFILEML
ENSCJAP00000024714  ..........................................CGER...........YSVAFFCLDTACVMIFTVEYL
ENSCJAP00000032944  ..........................................QSKQ...........MENILYWINLVFVIFFTCECV
ENSCJAP00000032952  ..........................................QSKQ...........MENILYWINLVFVIFFTCECV
ENSCJAP00000032909  ..........................................QSKQ...........MENILYWINLVFVIFFTCECV
ENSCJAP00000040782  ..........................................CGER...........YAVAFFCLDTACVMIFTVEYL
ENSCJAP00000011510  ..........................................QSQE...........MTNILYWINLVFIVLFTGECV
ENSCJAP00000011251  ..........................................QSQE...........MTNILYWINLVFIVLFTGECV
ENSCJAP00000011518  ..........................................QSQE...........MTNILYWINLVFIVLFTGECV
ENSCJAP00000011461  ..........................................QSQE...........MTNILYWINLVFIVLFTGECV
ENSCJAP00000035768  ..........................................KTKQ...........NNIAWLVLDSVVDVIFLVDIV
ENSCJAP00000038945  ..........................................TAREpsa........ARGPPSVCDLAVEVLFILDIV
ENSCJAP00000038937  ..........................................TAREpsa........ARGPPSVCDLAVEVLFILDIV
ENSCJAP00000024617  ..........................................PGST...........ERVFLSISNYIFTAIFVAEMM
ENSCJAP00000011705  ..........................................QSEY...........VTTILSRINLVFIVLFTGECV
ENSCJAP00000035074  ..........................................LQSD...........YLEYWIVLDYVSDIVYLMDMF
ENSCJAP00000035079  ..........................................LQSD...........YLEYWIVLDYVSDIVYLMDMF
ENSCJAP00000008124  ..........................................YETV...........SGDWLLLLETFAIFIFGAEFA
ENSCJAP00000011222  ..........................................QGKY...........MTLVLSRINLVFIVLFTGEFV
ENSCJAP00000011864  ..........................................RKKT...........IKIILEYADKIFTYVFILEML
ENSCJAP00000011864  ..........................................QSKY...........MTGVLNWINLVFIILFTGECA
ENSCJAP00000024578  ..........................................CGSE...........RCNILEAFDAFIFAFFAVEMV
ENSCJAP00000018242  ..........................................----...........--------EFVMIVVFGLEFI
ENSCJAP00000024617  ..........................................QPEE...........LTNALEISNIVFTSMFALEML
ENSCJAP00000000792  ..........................................GDDDtpi........TSRHTLVSDIAVEMLFILDII
ENSCJAP00000008119  ..........................................YETV...........SGDWLLLLETFAIFIFGAEFA
ENSCJAP00000014021  ..........................................EDDSns.........TNHNLEKVEYAFLIIFTVETF
ENSCJAP00000001539  ..........................................QSCL...........FKIAMNILNMLFTGLFTVEMI
ENSCJAP00000006710  ..........................................DDLS...........TTRSTTVSDIAVEILFIIDII
ENSCJAP00000048898  ..........................................GDDDtpi........TSRHTLVSDIAVEMLFILDII
ENSCJAP00000011266  ..........................................QGKY...........MTLVLSRINLVFIVLFTGEFV
ENSCJAP00000001544  ..........................................QSCL...........FKIAMNILNMLFTGLFTVEMI
ENSCJAP00000018110  ..........................................GRPK...........IQELLNCTDFIFTHIFILEML
ENSCJAP00000008393  ..........................................QPQW...........LTHLLYYAEFLFLGLFLLEMS
ENSCJAP00000018413  ..........................................QSPE...........KVNILTKINLLFVAIFTGECI
ENSCJAP00000008410  ..........................................QPQW...........LTHLLYYAEFLFLGLFLLEMS
ENSCJAP00000018484  ..........................................QSPE...........KVNILTKINLLFVAIFTGECI
ENSCJAP00000018438  ..........................................QSPE...........KVNILTKINLLFVAIFTGECI
ENSCJAP00000018440  ..........................................QSPE...........KVNILTKINLLFVAIFTGECI
ENSCJAP00000014011  ..........................................EDDSns.........TNHNLEKVEYAFLIIFTVETF
ENSCJAP00000013976  ..........................................EDDSns.........TNHNLEKVEYAFLIIFTVETF
ENSCJAP00000050238  ..........................................EDDSns.........TNHNLEKVEYAFLIIFTVETF
ENSCJAP00000013508  ..........................................LQSE...........YLMLWLVLDYSADVLYVLDMF
ENSCJAP00000050035  ..........................................LQSE...........YLMLWLVLDYSADVLYVLDMF
ENSCJAP00000013510  ..........................................LQSE...........YLMLWLVLDYSADVLYVLDMF
ENSCJAP00000013487  ..........................................LQSE...........YLMLWLVLDYSADVLYVLDMF
ENSCJAP00000008406  ..........................................QPQW...........LTHLLYYAEFLFLGLFLLEMS
ENSCJAP00000001452  ..........................................QSCL...........FKIAMNILNMLFTGLFTVEMI
ENSCJAP00000007056  ..........................................LQHS...........YYLVWLVLDYVSDVVYIADLF
ENSCJAP00000007061  ..........................................LQHS...........YYLVWLVLDYVSDVVYIADLF
ENSCJAP00000024932  ..........................................QPRR...........LTTALYFAEFVFLGLFLTEMS
ENSCJAP00000024922  ..........................................QPRR...........LTTALYFAEFVFLGLFLTEMS
ENSCJAP00000005022  ..........................................EDDSnt.........ANHNLEQVEYVFLVIFTVETV
ENSCJAP00000015533  ..........................................FKEE...........NSPPWIVFNVLSDTFFLLDLV
ENSCJAP00000015531  ..........................................FKEE...........NSPPWIVFNVLSDTFFLLDLV
ENSCJAP00000036148  ..........................................QRRV...........IRTILEYADKVFTYIFIMEML
ENSCJAP00000018471  ..........................................QSEE...........KTKILGKINQFFVAVFTGECV
ENSCJAP00000036134  ..........................................QRRV...........IRTILEYADKVFTYIFIMEML
ENSCJAP00000051809  ..........................................QSKM...........FNDAMDILNMVFTGVFTVEMV
ENSCJAP00000018440  ..........................................ERKT...........IKVLLEYADKMFTYVFVLEML
ENSCJAP00000051772  ..........................................QSCL...........FKIAMNILNMLFTGLFTVEMI
ENSCJAP00000001522  ..........................................QSCL...........FKIAMNILNMLFTGLFTVEMI
ENSCJAP00000043192  ..........................................QSCL...........FKIAMNILNMLFTGLFTVEMI
ENSCJAP00000002533  ..........................................FTEQ...........TTTPWIIFNVASDTVFLLDLI
ENSCJAP00000008130  ..........................................QPEW...........LSDFLYYAEFIFLGLFMSEMF
ENSCJAP00000014011  ..........................................QSKM...........FNDAMDILNMVFTGVFTVEMV
ENSCJAP00000001328  ..........................................IDSSnpiescqnf..YKDFTLQIDMAFNVFFLLYFG
ENSCJAP00000001906  ..........................................IDSSnpiescqnf..YKDFTLQIDMAFNVFFLLYFG
ENSCJAP00000049896  ..........................................IDSSnpiescqnf..YKDFTLQIDMAFNVFFLLYFG
ENSCJAP00000042093  ..........................................IDSSnpiescqnf..YKDFTLQIDMAFNVFFLLYFG
ENSCJAP00000014021  ..........................................QSKM...........FNDAMDILNMVFTGVFTVEMV
ENSCJAP00000013976  ..........................................QSKM...........FNDAMDILNMVFTGVFTVEMV
ENSCJAP00000050238  ..........................................QSKM...........FNDAMDILNMVFTGVFTVEMV
ENSCJAP00000024617  ..........................................QPKS...........LDEALKYCNYVFTIVFVFEAA
ENSCJAP00000051772  ..........................................QPHW...........LTEVQDTANKALLALFTAEML
ENSCJAP00000001522  ..........................................QPHW...........LTEVQDTANKALLALFTAEML
ENSCJAP00000008352  ..........................................QPQW...........LTHLLYYAEFLFLGLFLLEMS
ENSCJAP00000043192  ..........................................QPHW...........LTEVQDTANKALLALFTAEML
ENSCJAP00000001452  ..........................................QPHW...........LTEVQDTANKALLALFTAEML
ENSCJAP00000009758  ..........................................QPHW...........LTEVQDTANKALLALFTAEML
ENSCJAP00000001424  ..........................................QPHW...........LTEVQDTANKALLALFTAEML
ENSCJAP00000001424  ..........................................QSCL...........FKIAMNILNMLFTGLFTVEMI
ENSCJAP00000009782  ..........................................QSEQ...........MNHISDILNVAFTIIFTLEMI
ENSCJAP00000009782  ..........................................QPLW...........LTHLQDIANRVLLSLFTIEML
ENSCJAP00000008130  ..........................................ASVA...........YENALRVFNIVFTSLFSLECV
ENSCJAP00000005022  ..........................................QTAP...........FNYAMDILNMVFTGLFTIEMV
ENSCJAP00000004594  ..........................................CGER...........FPQAFFCMDTACVLIFTGEYL
ENSCJAP00000036717  ..........................................LSDQdesrrgacsy.TCSPLTVVDLIVDIMFVVDII
ENSCJAP00000001901  ..........................................IDSSnpiescqnf..YKDFTLQIDMAFNVFFLLYFG
ENSCJAP00000034755  ..........................................QPQI...........LDEALKICNYIFTVIFVLESV
ENSCJAP00000011864  ..........................................---N...........PPEWTKIVEYTFTGIYTFESL
ENSCJAP00000005008  ..........................................QTAP...........FNYAMDILNMVFTGLFTIEMV
ENSCJAP00000034722  ..........................................QPQI...........LDEALKICNYIFTVIFVLESV
ENSCJAP00000034731  ..........................................QPQI...........LDEALKICNYIFTVIFVLESV
ENSCJAP00000024932  ..........................................TDSP...........RNNALKYLDYIFTGVFTFEMV
ENSCJAP00000024922  ..........................................TDSP...........RNNALKYLDYIFTGVFTFEMV
ENSCJAP00000008393  ..........................................APCT...........YELALKYLNIAFTMVFSLECV
ENSCJAP00000008406  ..........................................APCT...........YELALKYLNIAFTMVFSLECV
ENSCJAP00000008410  ..........................................APCT...........YELALKYLNIAFTMVFSLECV
ENSCJAP00000024922  ..........................................APYE...........YELMLKCLNIVFTSMFSMECV
ENSCJAP00000018110  ..........................................----...........---ALDRLNWTFVAVFTVECL
ENSCJAP00000024932  ..........................................APYE...........YELMLKCLNIVFTSMFSMECV
ENSCJAP00000014011  ..........................................QPDW...........LTQIQDIANKVLLALFTCEML
ENSCJAP00000009782  ..........................................EDDNns.........LNLGLEKLEYFFLIVFSIEAA
ENSCJAP00000008352  ..........................................TNSE...........RNKVLRYFDYVFTGVFTFEMV
ENSCJAP00000011251  ..........................................MTEQ...........FSSVLSVGNLVFTGIFTAEMF
ENSCJAP00000011518  ..........................................MTEQ...........FSSVLSVGNLVFTGIFTAEMF
ENSCJAP00000011461  ..........................................MTEQ...........FSSVLSVGNLVFTGIFTAEMF
ENSCJAP00000009782  ..........................................AEST...........RNQILKHFDVGFTSVFTVEIV
ENSCJAP00000032909  ..........................................MTPQ...........FEHVLAVGNLVFTGIFTAEMF
ENSCJAP00000011510  ..........................................MTEQ...........FSSVLSVGNLVFTGIFTAEMF
ENSCJAP00000051432  ..........................................QPDW...........LTQIQDIANKVLLALFTCEML
ENSCJAP00000011266  ..........................................MTEQ...........FSSVLTVGNLVFTGIFTAEMV
ENSCJAP00000024922  ..........................................GDKTp..........MSERLDDTEPYFIGIFCFEAG
ENSCJAP00000003065  ..........................................VEIR...........GEWYFMALDSIFFCIYVLEAL
ENSCJAP00000049104  ..........................................VEIR...........GEWYFMALDSIFFCIYVLEAL
ENSCJAP00000032944  ..........................................MTPQ...........FEHVLAVGNLVFTGIFTAEMF
ENSCJAP00000032952  ..........................................MTPQ...........FEHVLAVGNLVFTGIFTAEMF
ENSCJAP00000008393  ..........................................DDKTp..........MSRRLEKTEPYFIGIFCFEAG
ENSCJAP00000008406  ..........................................DDKTp..........MSRRLEKTEPYFIGIFCFEAG
ENSCJAP00000008410  ..........................................DDKTp..........MSRRLEKTEPYFIGIFCFEAG
ENSCJAP00000013976  ..........................................QPDW...........LTQIQDIANKVLLALFTCEML
ENSCJAP00000050238  ..........................................QPDW...........LTQIQDIANKVLLALFTCEML
ENSCJAP00000008406  ..........................................TNSE...........RNKVLRYFDYVFTGVFTFEMV
ENSCJAP00000008410  ..........................................TNSE...........RNKVLRYFDYVFTGVFTFEMV
ENSCJAP00000008393  ..........................................TNSE...........RNKVLRYFDYVFTGVFTFEMV
ENSCJAP00000051012  ..........................................QPDW...........LTQIQDIANKVLLALFTCEML
ENSCJAP00000011705  ..........................................MTDH...........FNNVLTVGNLVFTGIFTAEMF
ENSCJAP00000024932  ..........................................GDKTp..........MSERLDDTEPYFIGIFCFEAG
ENSCJAP00000051772  ..........................................----...........-------VEYLFLIIFTVEAF
ENSCJAP00000014021  ..........................................QPDW...........LTQIQDIANKVLLALFTCEML
ENSCJAP00000001522  ..........................................----...........-------VEYLFLIIFTVEAF
ENSCJAP00000026361  ..........................................LQHG...........YLGAWLVLDYTSDLLYLLDIV
ENSCJAP00000023649  ..........................................FKDE...........TTAPWIVFNVVSDTFFLMDLV
ENSCJAP00000043192  ..........................................----...........-------VEYLFLIIFTVEAF
ENSCJAP00000009758  ..........................................----...........-------VEYLFLIIFTVEAF
ENSCJAP00000001424  ..........................................----...........-------VEYLFLIIFTVEAF
ENSCJAP00000024617  ..........................................CGSE...........RCNILEAFDAFIFAFFAVEMV
ENSCJAP00000051012  ..........................................QSKM...........FNDAMDILNMVFTGVFTVEMV
ENSCJAP00000009776  ..........................................QPLW...........LTHLQDIANRVLLSLFTIEML
ENSCJAP00000047289  ..........................................----...........--EWTKIVEYTFTGIYTFESL
ENSCJAP00000049465  ..........................................AQHD...........PPPWTKYVEYTFTAIYTFESL
ENSCJAP00000011864  ..........................................MTEE...........FKNVLTIGNLVFTGIFAAEMV
ENSCJAP00000014011  ..........................................SHSF...........RNTILGYFDYAFTAIFTVEIL
ENSCJAP00000013976  ..........................................SHSF...........RNTILGYFDYAFTAIFTVEIL
ENSCJAP00000050238  ..........................................SHSF...........RNTILGYFDYAFTAIFTVEIL
ENSCJAP00000014021  ..........................................SHSF...........RNTILGYFDYAFTAIFTVEIL
ENSCJAP00000001452  ..........................................----...........-------VEYLFLIIFTVEAF
ENSCJAP00000051012  ..........................................SHSF...........RNTILGYFDYAFTAIFTVEIL
ENSCJAP00000024578  ..........................................QPEE...........LTNALEISNIVFTSMFALEML
ENSCJAP00000043192  ..........................................HTSF...........RNHILFYFDIVFTTIFTIEIA
ENSCJAP00000001539  ..........................................----...........-------VEYLFLIIFTVEAF
ENSCJAP00000001452  ..........................................HTSF...........RNHILFYFDIVFTTIFTIEIA
ENSCJAP00000001544  ..........................................----...........-------VEYLFLIIFTVEAF
ENSCJAP00000051432  ..........................................SHSF...........RNTILGYFDYAFTAIFTVEIL
ENSCJAP00000011693  ..........................................---N...........PPDWTKNVEYTFTGIYTFESL
ENSCJAP00000032944  ..........................................---N...........PPDWSKNVEYTFTGIYTFESL
ENSCJAP00000032952  ..........................................---N...........PPDWSKNVEYTFTGIYTFESL
ENSCJAP00000032909  ..........................................---N...........PPDWSKNVEYTFTGIYTFESL
ENSCJAP00000018413  ..........................................AQHD...........PPPWTKYVEYTFTAIYTFESL
ENSCJAP00000018438  ..........................................AQHD...........PPPWTKYVEYTFTAIYTFESL
ENSCJAP00000018440  ..........................................AQHD...........PPPWTKYVEYTFTAIYTFESL
ENSCJAP00000005090  ..........................................TDPVrscls......YEDKTIPIDLAFNAFFSFYFG
ENSCJAP00000011860  ..........................................----...........--EWTKIVEYTFTGIYTFESL
ENSCJAP00000051772  ..........................................HTSF...........RNHILGNADYVFTSIFTLEII
ENSCJAP00000001522  ..........................................HTSF...........RNHILGNADYVFTSIFTLEII
ENSCJAP00000009758  ..........................................HTSF...........RNHILGNADYVFTSIFTLEII
ENSCJAP00000011461  ..........................................---N...........PPDWTKNVEYTFTGIYTFESL
ENSCJAP00000008352  ..........................................APCT...........YELALKYLNIAFTMVFSLECV
ENSCJAP00000036134  ..........................................MTEH...........FDRPHLTTPQVFTGIFTAEMV
ENSCJAP00000011251  ..........................................---N...........PPDWTKNVEYTFTGIYTFESL
ENSCJAP00000011518  ..........................................---N...........PPDWTKNVEYTFTGIYTFESL
ENSCJAP00000032944  ..........................................QRKT...........IRTILEYADKVFTYIFILEML
ENSCJAP00000011705  ..........................................----...........--DWTKNVEYTFTGIYTFESL
ENSCJAP00000018484  ..........................................AQHD...........PPPWTKYVEYTFTAIYTFESL
ENSCJAP00000018413  ..........................................MTSE...........FEDMLQVGNLVFTGIFTAEMT
ENSCJAP00000036134  ..........................................---N...........PPPWSKNVEYTFTGIYTFESL
ENSCJAP00000000428  ..........................................QTPD...........NIHYWLIVDIICDIIYLYDIL
ENSCJAP00000018440  ..........................................MTSE...........FEDMLQVGNLVFTGIFTAEMT
ENSCJAP00000018484  ..........................................MTSE...........FEDMLQVGNLVFTGIFTAEMT
ENSCJAP00000018438  ..........................................MTSE...........FEDMLQVGNLVFTGIFTAEMT
ENSCJAP00000005022  ..........................................QPVW...........LTQIQEYANKVLLCLFTVEML
ENSCJAP00000018471  ..........................................QKPT...........VKALLEYTDRVFPFIFVFEML
ENSCJAP00000051432  ..........................................QSKM...........FNDAMDILNMVFTGVFTVEMV
ENSCJAP00000011510  ..........................................---N...........PPDWTKNVEYTFTGIYTFESL
ENSCJAP00000028522  ..........................................----...........---------------------
ENSCJAP00000005008  ..........................................AHSF...........RNHILGYFDYAFTSIFTVEIL
ENSCJAP00000008130  ..........................................PNAP...........RNNVLRYFDYVFTGVFTFEMV
ENSCJAP00000005022  ..........................................AHSF...........RNHILGYFDYAFTSIFTVEIL
ENSCJAP00000036148  ..........................................MTEH...........FDRPHLTTPQVFTGIFTAEMV
ENSCJAP00000009776  ..........................................----...........-------LEYFFLIVFSIEAA
ENSCJAP00000018471  ..........................................----...........-----EKIEYVFTAIYTFEAS
ENSCJAP00000036144  ..........................................---N...........PPPWSKNVEYTFTGIYTFESL
ENSCJAP00000018471  ..........................................MSST...........FEAMLYIGNIVFTVVFTAEMV
ENSCJAP00000036148  ..........................................---N...........PPPWSKNVEYTFTGIYTFESL
ENSCJAP00000001539  ..........................................QPHW...........LTEVQDTANKALLALFTAEML
ENSCJAP00000001544  ..........................................QPHW...........LTEVQDTANKALLALFTAEML
ENSCJAP00000015632  ..........................................----...........---------------------
ENSCJAP00000045673  ..........................................----...........---------------------
ENSCJAP00000017214  ..........................................----...........---------------------
ENSCJAP00000030676  ..........................................----...........---------------------
ENSCJAP00000048251  ..........................................----...........---------------------
ENSCJAP00000019483  ..........................................----...........---------------------
ENSCJAP00000017218  ..........................................----...........---------------------
ENSCJAP00000031810  ..........................................----...........---------------------
ENSCJAP00000031809  ..........................................----...........---------------------
ENSCJAP00000031817  ..........................................----...........---------------------
ENSCJAP00000018110  ..........................................--TS...........NSNDTDIAEYVFTGIYIFEAL
ENSCJAP00000025797  ..........................................----...........---------------------
ENSCJAP00000047563  ..........................................----...........---------------------
ENSCJAP00000025796  ..........................................----...........---------------------
ENSCJAP00000036144  ..........................................-MTE...........HFDNXXXXHSVFTGIFTAEMV
ENSCJAP00000001539  ..........................................HTSF...........RNHILGNADYVFTSIFTLEII
ENSCJAP00000015636  ..........................................----...........---------------------
ENSCJAP00000001544  ..........................................HTSF...........RNHILGNADYVFTSIFTLEII
ENSCJAP00000044387  ..........................................HSLQ...........MEIALYWINLIFVILYTMECI
ENSCJAP00000051406  ..........................................----...........---------------------
ENSCJAP00000017751  ..........................................LDQK...........HYELFSTIDDIVLTILICEVL
ENSCJAP00000001424  ..........................................----...........------NADYVFTSIFTLEII
ENSCJAP00000028312  ..........................................----...........---------------------
ENSCJAP00000039183  ..........................................RRVM...........HAPTLQIAEYVFVIFMSIELN
ENSCJAP00000018110  ..........................................MEAS...........FEKMLNTGNLVFTSIFLAEMC
ENSCJAP00000039178  ..........................................RRVM...........HAPTLQIAEYVFVIFMSIELN
ENSCJAP00000011922  ..........................................HSLQ...........MEIALYWINLIFVILYTMECI
ENSCJAP00000007663  ..........................................----...........---------------------
ENSCJAP00000032603  ..........................................----...........---------------------
ENSCJAP00000009758  ..........................................----...........---------------------
ENSCJAP00000025602  ..........................................----...........---------------------
ENSCJAP00000048019  ..........................................----...........---------------------
ENSCJAP00000010880  ..........................................----...........---------------------
ENSCJAP00000028254  ..........................................----...........---------------------
ENSCJAP00000024637  ..........................................----...........---------------------
ENSCJAP00000028292  ..........................................----...........---------------------
ENSCJAP00000021660  ..........................................QTPD...........NIHLWLLTDYLCDLIYFLDIT
ENSCJAP00000021649  ..........................................QTPD...........NIHLWLLTDYLCDLIYFLDIT
ENSCJAP00000028286  ..........................................----...........---------------------
ENSCJAP00000036223  ..........................................----...........---------------------
ENSCJAP00000010869  ..........................................----...........---------------------
ENSCJAP00000044387  ..........................................QRKT...........VKILLEYADMIFTYIFILEML
ENSCJAP00000033717  ..........................................----...........---------------------
ENSCJAP00000000198  ..........................................----...........---------------------
ENSCJAP00000051538  ..........................................----...........---------------------
ENSCJAP00000011266  ..........................................---N...........PPDWTKNVEYTFTGIYTFESL
ENSCJAP00000036144  ..........................................QSQL...........KVDILYNINMIFIIIFTGECV
ENSCJAP00000031810  ..........................................----...........---------------------
ENSCJAP00000031809  ..........................................----...........---------------------
ENSCJAP00000031817  ..........................................----...........---------------------
ENSCJAP00000004803  ..........................................ESTNtklwp......LKLTLEVAAWFILFIFILEII
ENSCJAP00000011922  ..........................................QRKT...........VKILLEYADMIFTYIFILEML
ENSCJAP00000010847  ..........................................----...........---------------------
ENSCJAP00000010844  ..........................................----...........---------------------
ENSCJAP00000034853  ..........................................----...........---------------------
ENSCJAP00000004793  ..........................................ESTNtklwp......LKLTLEVAAWFILFIFILEII
ENSCJAP00000007663  ..........................................----...........---------------------
ENSCJAP00000032603  ..........................................----...........---------------------
ENSCJAP00000042788  ..........................................----...........---------------------
ENSCJAP00000033365  ..........................................----...........---------------------
ENSCJAP00000004804  ..........................................ESTNtklwp......LKLTLEVAAWFILFIFILEII
ENSCJAP00000028286  ..........................................----...........---------------------
ENSCJAP00000028292  ..........................................----...........---------------------
ENSCJAP00000025789  ..........................................----...........---------------------
ENSCJAP00000028254  ..........................................----...........---------------------
ENSCJAP00000033361  ..........................................----...........---------------------
ENSCJAP00000016635  ..........................................----...........---------------------
ENSCJAP00000044520  ..........................................----...........---------------------
ENSCJAP00000004712  ..........................................----...........---------------------
ENSCJAP00000004717  ..........................................----...........---------------------
ENSCJAP00000033717  ..........................................----...........---------------------
ENSCJAP00000028312  ..........................................----...........---------------------
ENSCJAP00000000665  ..........................................----...........---------------------
ENSCJAP00000010822  ..........................................----...........---------------------
ENSCJAP00000011922  ..........................................MSEQ...........TSNLLSTGNLVFIGIFTAEMI
ENSCJAP00000030680  ..........................................----...........---------------------
ENSCJAP00000036134  ..........................................QSQL...........KVDILYNINMIFIIIFTGECV
ENSCJAP00000036148  ..........................................QSQL...........KVDILYNINMIFIIIFTGECV
ENSCJAP00000041691  ..........................................----...........---------------------
ENSCJAP00000043961  ..........................................----...........---------------------
ENSCJAP00000050339  ..........................................----...........---------------------
ENSCJAP00000032611  ..........................................----...........---------------------
ENSCJAP00000036223  ..........................................----...........---------------------
ENSCJAP00000006678  ..........................................----...........---------------------
ENSCJAP00000002449  ..........................................----...........---------------------
ENSCJAP00000028533  ..........................................----...........---------------------
ENSCJAP00000008130  ..........................................----...........---------------------
ENSCJAP00000033335  ..........................................----...........---------------------
ENSCJAP00000044017  ..........................................LDQK...........HYELFSTIDDIVLTILICEVL
ENSCJAP00000002449  ..........................................----...........---------------------
ENSCJAP00000008352  ..........................................----...........---------------------
ENSCJAP00000010847  ..........................................----...........---------------------
ENSCJAP00000010844  ..........................................----...........---------------------
ENSCJAP00000032608  ..........................................----...........---------------------
ENSCJAP00000001064  ..........................................----...........---------------------
ENSCJAP00000044773  ..........................................----...........---------------------
ENSCJAP00000015112  ..........................................----...........---------------------
ENSCJAP00000042307  ..........................................----...........---------------------
ENSCJAP00000044603  ..........................................----...........---------------------
ENSCJAP00000032611  ..........................................----...........---------------------
ENSCJAP00000024941  ..........................................----...........---------------------
ENSCJAP00000039178  ..........................................ENFRr..........QYDEFYLAEVAFTVLFDLEAL
ENSCJAP00000010822  ..........................................----...........---------------------
ENSCJAP00000010657  ..........................................IRYR...........LFRLLEFSEIFFVSICISELA
ENSCJAP00000045969  ..........................................---N...........LPKWRPVVENTLLGIYTFEIL
ENSCJAP00000010880  ..........................................----...........---------------------
ENSCJAP00000047810  ..........................................IRYR...........LFRLLEFSEIFFVSICISELA
ENSCJAP00000032608  ..........................................----...........---------------------
ENSCJAP00000024941  ..........................................----...........---------------------
ENSCJAP00000016592  ..........................................----...........---------------------
ENSCJAP00000001064  ..........................................----...........---------------------
ENSCJAP00000039183  ..........................................ENFRr..........QYDEFYLAEVAFTVLFDLEAL
ENSCJAP00000029287  ..........................................ADVLpaer.......DDFVLGILNCVFIVYYLLELL
ENSCJAP00000010869  ..........................................----...........---------------------
ENSCJAP00000003851  ..........................................----...........---------------------
ENSCJAP00000018351  ..........................................KGGNf..........FSKHVPWSYLVFLTIYGVELF
ENSCJAP00000011922  ..........................................---N...........LPKWRPVVENTLLGIYTFEIL
ENSCJAP00000039178  ..........................................HYPP...........LQYVTFTLDTLLMFLYTAEMI
ENSCJAP00000034731  ..........................................----...........---------------------
ENSCJAP00000011191  ..........................................----...........---------------------
ENSCJAP00000040639  ..........................................----...........---------------------
ENSCJAP00000000427  ..........................................QTPD...........NIHYWLIVDIICDIIYLYDIL
ENSCJAP00000039183  ..........................................VEDP...........VTVPLATMSVVFTFIFVLEVT
ENSCJAP00000009758  ..........................................QSCL...........FKIAMNILNMLFTGLFTVEMI
ENSCJAP00000039178  ..........................................VEDP...........VTVPLATMSVVFTFIFVLEVT
ENSCJAP00000043591  ..........................................AQHD...........PPPWTKYVEYTFTAIYTFESL
ENSCJAP00000018307  ..........................................KGGNf..........FSKHVPWSYLVFLTIYGVELF
ENSCJAP00000003851  ..........................................----...........---------------------
ENSCJAP00000018358  ..........................................KGGNf..........FSKHVPWSYLVFLTIYGVELF
ENSCJAP00000016835  ..........................................KNNY...........AAMVFHYMSIAILVFFMMEII
ENSCJAP00000016824  ..........................................KNNY...........AAMVFHYMSIAILVFFMMEII
ENSCJAP00000018307  ..........................................----...........------TLELFALMVVVFELC
ENSCJAP00000018358  ..........................................----...........------TLELFALMVVVFELC
ENSCJAP00000023858  ..........................................----...........---------------------
ENSCJAP00000023857  ..........................................----...........---------------------
ENSCJAP00000011719  ..........................................----...........-----EIIFCFFILYYLVEEI
ENSCJAP00000023869  ..........................................----...........---------------------
ENSCJAP00000011724  ..........................................----...........-----EIIFCFFILYYLVEEI
ENSCJAP00000031891  ..........................................----...........---------CVFIFYYVVEEI
ENSCJAP00000032813  ..........................................KKIY...........MPLEYRCISPSIAIFFLMDIL
ENSCJAP00000018176  ..........................................----...........---------------------
ENSCJAP00000029682  ..........................................----...........---------------------
ENSCJAP00000029731  ..........................................----...........---------------------
ENSCJAP00000029720  ..........................................----...........---------------------
ENSCJAP00000029725  ..........................................----...........---------------------
ENSCJAP00000016830  ..........................................KNNY...........AAMVFHYMSIAILVFFMMEII
ENSCJAP00000026317  ..........................................LQHG...........YLGAWLVLDYTSDLLYLLDIV
ENSCJAP00000031883  ..........................................----...........--------FCVFIFYYVVEEI
ENSCJAP00000008550  ..........................................----...........---------------------
ENSCJAP00000008592  ..........................................----...........---------------------
ENSCJAP00000019881  ..........................................SAFQ...........FAGVIHWISLVILSVFFSETV
ENSCJAP00000018165  ..........................................----...........---------------------
ENSCJAP00000008585  ..........................................----...........---------------------
ENSCJAP00000051777  ..........................................----...........---------------------
ENSCJAP00000008594  ..........................................----...........---------------------
ENSCJAP00000043053  ..........................................----...........---------------------
ENSCJAP00000018166  ..........................................----...........---------------------
ENSCJAP00000043051  ..........................................----...........--------YYLLICYYAFIQG


                       60                               70             80        90                 
                        |                                |              |         |                 
d1orqc_               YRAYKS..............GDP.........AGYVK..K...TLYEIPALVPAGLLALIE.................
ENSCJAP00000001034  VRFFAC..............PSK.........AGFSR..Nim.NIIDVVAIFPYFITLGTElaeqqpggggggqn...
ENSCJAP00000006275  VRFFAC..............PSK.........ATFSR..Nim.NLIDIVAIIPYFITLGTElaerqgn..........
ENSCJAP00000011257  VRCFAC..............PSQ.........ALFFK..Nim.NIIDIVSILPYFITLGTDlaqqqgggng.......
ENSCJAP00000051240  VRCFAC..............PSQ.........ALFFK..Nim.NIIDIVSILPYFITLGTDlaqqqgggng.......
ENSCJAP00000040816  VRFSAC..............PSK.........PAFFR..Nim.NIIDLVAIFPYFITLGTElvqqqeqqpasgggsq.
ENSCJAP00000041201  LRFLSS..............PKK.........WKFFKg.Pl..NAIDLLAILPYYVTIFLTesnksvlqfq.......
ENSCJAP00000041491  LRLFSS..............PNK.........LHFAL..Sfm.NIVDVLAILPFYVSLTLThlgarmmelt.......
ENSCJAP00000000350  VRLLAC..............PSK.........AIFFK..Nvm.NLIDFVAILPYFVALGTElarqrgvgq........
ENSCJAP00000002245  VRIVFS..............PNK.........LEFIK..Nll.NIIDFVAILPFYLEVGLSglsskaak.........
ENSCJAP00000006280  VRFFAC..............PSK.........AGFFT..Nim.NIIDIVAIIPYFITLGTElaekpedaqq.......
ENSCJAP00000000354  VRLLAC..............PSK.........AIFFK..Nvm.NLIDFVAILPYFVALGTElarqrgvgq........
ENSCJAP00000002246  VRIVFS..............PNK.........LEFIK..Nll.NIIDFVAILPFYLEVGLSglsskaak.........
ENSCJAP00000002252  VRIVFS..............PNK.........LEFIK..Nll.NIIDFVAILPFYLEVGLSglsskaak.........
ENSCJAP00000043218  VRIVFS..............PNK.........LEFIK..Nll.NIIDFVAILPFYLEVGLSglsskaak.........
ENSCJAP00000002244  VRIVFS..............PNK.........LEFIK..Nll.NIIDFVAILPFYLEVGLSglsskaak.........
ENSCJAP00000006178  VRIVCC..............PDT.........LDFIK..Nll.NIIDFVAILPFYLEVGLSglsskaar.........
ENSCJAP00000006190  VRIVCC..............PDT.........LDFIK..Nll.NIIDFVAILPFYLEVGLSglsskaar.........
ENSCJAP00000011362  LRFLCV..............RDR.........CHFLR..Kvp.NIIDLLAILPFYITLLVEslsgsqttqele.....
ENSCJAP00000042235  LRFLCV..............RDR.........CHFLR..Kvp.NIIDLLAILPFYITLLVEslsgsqttqele.....
ENSCJAP00000006168  VRIVCC..............PDT.........LDFIK..Nll.NIIDFVAILPFYLEVGLSglsskaar.........
ENSCJAP00000020121  LRLAST..............PDL.........RRFVR..Sal.NLVDLVAILPLYLQLLLEcftgedhqrgqtvgsvg
ENSCJAP00000006183  MRVVFC..............PNK.........VEFIKn.Sl..NIIDFVAILPFYLEVGLSglsskaak.........
ENSCJAP00000013687  VRLAAA..............PCQ.........KKFWKn.Pl..NIIDFVSIIPFYATLAVDtkeeesedie.......
ENSCJAP00000007967  MRITFC..............PDK.........VEFLK..Ssl.NIIDCVAILPFYLEVGLSglsskaak.........
ENSCJAP00000013573  MRVVFC..............PNK.........VEFIKn.Sl..NIIDFVAILPFYLEVGLSglsskaak.........
ENSCJAP00000020116  LRLAST..............PDL.........RRFVR..Sal.NLVDLVAILPLYLQLLLEcftgedhqrgqtvgsvg
ENSCJAP00000028718  ARFAVA..............PDF.........LKFFR..Nal.NLIDLMSIVPFYITLVVNlvvestptla.......
ENSCJAP00000000985  LRFIQA..............PSK.........FTFLR..Spl.TLIDLVAILPYYITLLVDgaaagrrkpsagnsyld
ENSCJAP00000049469  LRFIQA..............PSK.........FTFLR..Spl.TLIDLVAILPYYITLLVDgaaagrrkpsagnsyld
ENSCJAP00000014952  SRLLLA..............PST.........RNFFCh.Pl..NLIDIVSVLPFYLTLLAGaalgddggtggk.....
ENSCJAP00000032384  SRLLLA..............PST.........RNFFCh.Pl..NLIDIVSVLPFYLTLLAGaalgddggtggk.....
ENSCJAP00000007249  LRFVQA..............QDK.........CEFFQg.Pl..NIIDILAISPYYVSLAVSeeppedgerpsgssyle
ENSCJAP00000027043  VRFIVS..............KNK.........CEFVKr.Pl..NIIDLLAITPYYISVLMTvftgensqlq.......
ENSCJAP00000050058  INFRTTyvnaneevvshpg.RIA.........VHYFKg.W...FLIDMVAAIPFDLLIFGS.................
ENSCJAP00000037509  INFRTTyvnaneevvshpg.RIA.........VHYFKg.W...FLIDMVAAIPFDLLIFGS.................
ENSCJAP00000014024  INFRTTyvnaneevvshpg.RIA.........VHYFKg.W...FLIDMVAAIPFDLLIFGS.................
ENSCJAP00000037518  INFRTTyvnaneevvshpg.RIA.........VHYFKg.W...FLIDMVAAIPFDLLIFGS.................
ENSCJAP00000037477  INFRTTyvnaneevvshpg.RIA.........VHYFKg.W...FLIDMVAAIPFDLLIFGS.................
ENSCJAP00000037521  INFRTTyvnaneevvshpg.RIA.........VHYFKg.W...FLIDMVAAIPFDLLIFGS.................
ENSCJAP00000018246  IRIWSA..............GCCcryrgwqgrLRFARk.Pf..CVIDTIVLIASIAVVSAK.................
ENSCJAP00000011046  INFRTTyvnnndevvshpr.RIV.........VHYFKg.W...FLIDMVAAIPFDLLIFRTgsd..............
ENSCJAP00000036726  INFRTTyvnnndevvshpr.RIV.........VHYFKg.W...FLIDMVAAIPFDLLIFRTgsd..............
ENSCJAP00000003807  INFRTTyvnnndevvshpr.RIV.........VHYFKg.W...FLIDMVAAIPFDLLIFRTgsd..............
ENSCJAP00000011055  INFRTTyvnqneevvsdpa.KIA.........IHYFKg.W...FLIDMVAAIPFDLLIFGSgsd..............
ENSCJAP00000035788  LNFHTTfvgpggevisdpk.LIR.........MNYLKt.W...FVIDLLSCLPYDIINAFE.................
ENSCJAP00000035791  LNFHTTfvgpggevisdpk.LIR.........MNYLKt.W...FVIDLLSCLPYDIINAFE.................
ENSCJAP00000035786  LNFHTTfvgpggevisdpk.LIR.........MNYLKt.W...FVIDLLSCLPYDIINAFE.................
ENSCJAP00000035785  LNFHTTfvgpggevisdpk.LIR.........MNYLKt.W...FVIDLLSCLPYDIINAFE.................
ENSCJAP00000005433  VRVWSA..............GCCcryrgwqgrFRFARk.Pf..CVIDFIVFVASVAVIAAG.................
ENSCJAP00000018820  VRIWAAgcccryrgw.....RGR.........LKFARk.Pf..CVIDIMVLIASIAVLAAG.................
ENSCJAP00000032952  LKWTAY..............GFV.........KFFTNa.W...CWLDFLIVAVSLVSLIANalgy.............
ENSCJAP00000032909  LKWTAY..............GFV.........KFFTNa.W...CWLDFLIVAVSLVSLIANalgy.............
ENSCJAP00000005420  VRVWSA..............GCCcryrgwqgrFRFARk.Pf..CVIDFIVFVASVAVIAAG.................
ENSCJAP00000021515  VRLWSA..............GCRskyvglwgrLRFARk.Pi..SIIDLIVVVASMVVLCVG.................
ENSCJAP00000018413  LKWVAY..............GFK.........KYFTNa.W...CWLDFLIVDVSLVSLVAN.................
ENSCJAP00000036144  LKWVAY..............GFK.........VYFTNa.W...CWLDFLIVDVSIISLVANwlgy.............
ENSCJAP00000018484  LKWVAY..............GFK.........KYFTNa.W...CWLDFLIVDVSLVSLVAN.................
ENSCJAP00000018438  LKWVAY..............GFK.........KYFTNa.W...CWLDFLIVDVSLVSLVAN.................
ENSCJAP00000034755  VKVVAL..............GWCfge......QAYLRssW...NVLDGLLVLISVIDILVSmvsdsgt..........
ENSCJAP00000011266  LKWVAY..............GFQ.........TYFTNa.W...CWLDFLIVDVSLVSLVANalgy.............
ENSCJAP00000034722  VKVVAL..............GWCfge......QAYLRssW...NVLDGLLVLISVIDILVSmvsdsgt..........
ENSCJAP00000011510  LKWVAY..............GFQ.........VYFTNa.W...CWLDFLIVDVSLVSLTANalgy.............
ENSCJAP00000011251  LKWVAY..............GFQ.........VYFTNa.W...CWLDFLIVDVSLVSLTANalgy.............
ENSCJAP00000011518  LKWVAY..............GFQ.........VYFTNa.W...CWLDFLIVDVSLVSLTANalgy.............
ENSCJAP00000011461  LKWVAY..............GFQ.........VYFTNa.W...CWLDFLIVDVSLVSLTANalgy.............
ENSCJAP00000035750  LNFHTTfvgpggevisdpk.LIR.........MNYLKt.W...FVIDLLSCLPYDIINAFE.................
ENSCJAP00000011705  LKWVAY..............GYQ.........TYFTNa.W...CWLDFLIVDVSLVSLTANalgy.............
ENSCJAP00000024714  LRLFAA..............PSR.........YRFIR..Svm.SIIDVVAIMPYYIGLVMTnne..............
ENSCJAP00000032944  LKMFAL..............RHY.........YFTIG..W...NIFDFVVVILSIVGMFLAdiiekyf..........
ENSCJAP00000032952  LKMFAL..............RHY.........YFTIG..W...NIFDFVVVILSIVGMFLAdiiekyf..........
ENSCJAP00000032909  LKMFAL..............RHY.........YFTIG..W...NIFDFVVVILSIVGMFLAdiiekyf..........
ENSCJAP00000040782  LRLAAA..............PSR.........YRFVR..Svm.SIIDVVAILPYYIGLVMTdne..............
ENSCJAP00000011510  LKLISL..............RYY.........YFTIG..W...NIFDFVVVILSIVGMFLAeliekyf..........
ENSCJAP00000011251  LKLISL..............RYY.........YFTIG..W...NIFDFVVVILSIVGMFLAeliekyf..........
ENSCJAP00000011518  LKLISL..............RYY.........YFTIG..W...NIFDFVVVILSIVGMFLAeliekyf..........
ENSCJAP00000011461  LKLISL..............RYY.........YFTIG..W...NIFDFVVVILSIVGMFLAeliekyf..........
ENSCJAP00000035768  LNFHTTfvgpggevisdpk.LIR.........MNYLKt.W...FVIDLLSCLPYDIINAFE.................
ENSCJAP00000038945  LNFRTTfvsksgqvvfapk.SIC.........LHYITt.W...FLLDVIAALPFDLLHAFKv................
ENSCJAP00000038937  LNFRTTfvsksgqvvfapk.SIC.........LHYITt.W...FLLDVIAALPFDLLHAFKv................
ENSCJAP00000024617  VKVVAL..............GLLsgeh.....AYLQSs.W...NLLDGLLVLVSLVDIVVAmasagga..........
ENSCJAP00000011705  LKLISL..............RHY.........YFTIG..W...NIFDFVVVILSIVGMFLAeliekyf..........
ENSCJAP00000035074  VRTRTGyleqgllvreel..KLI.........NKYKS..Nlq.FKLDVLSLIPTDLLYFK-.................
ENSCJAP00000035079  VRTRTGyleqgllvreel..KLI.........NKYKS..Nlq.FKLDVLSLIPTDLLYFK-.................
ENSCJAP00000008124  LRIWAAgcccrykgw.....RGR.........LKFARk.Pl..CMLDIFVLIASVPVVAVG.................
ENSCJAP00000011222  LKLVSL..............RHY.........YFTIG..W...NIFDFVVVILSIVGMFLAemiekyf..........
ENSCJAP00000011864  LKWVAY..............GYK.........TYFTNa.W...CWLDFLIVDVSLVTLVANtlgy.............
ENSCJAP00000011864  LKLISL..............RHY.........YFTVG..W...NIFDFVVVIISIVGMFLAdmiekyf..........
ENSCJAP00000024578  IKMVALglf...........GQK.........CYLGDt.W...NRLDFFIVMAGMMEYSLD.................
ENSCJAP00000018242  IRIWSA..............GCCcryrgwqgrLRFARk.Pf..CVIDTIVLIASIAVVSAK.................
ENSCJAP00000024617  LKLLAC..............GPL.........GYIRS..Py..NIFDGIIVVISVWEIVGQ.................
ENSCJAP00000000792  LNFRTTyvsqsgqvisapr.SIG.........LHYLAt.W...FFIDLIAALPFDLLYIFNi................
ENSCJAP00000008119  LRIWAAgcccrykgw.....RGR.........LKFARk.Pl..CMLDIFVLIASVPVVAVG.................
ENSCJAP00000014021  LKIIAY..............GLLlhp......NAYVRngW...NLLDFVIVIVGLFSVILEqltketeggnhssgk..
ENSCJAP00000001539  LKLIAF..............KPK.........GYFSDp.W...NVFDFLIVIGSIIDVILSetnnaee..........
ENSCJAP00000006710  LNFRTTyvsksgqvifear.SIC.........IHYVTt.W...FIIDLIAALPFDLLYAFNv................
ENSCJAP00000048898  LNFRTTyvsqsgqvisapr.SIG.........LHYLAt.W...FFIDLIAALPFDLLYIFNitvt.............
ENSCJAP00000011266  LKLVSL..............RHY.........YFTIG..W...NIFDFVVVILSIVGMFLAemiekyf..........
ENSCJAP00000001544  LKLIAF..............KPK.........GYFSDp.W...NVFDFLIVIGSIIDVILSetnpheqthipqplalp
ENSCJAP00000018110  LKWVAF..............GFG.........KYFTSa.W...CCLDFIIVIVSVTSLINL.................
ENSCJAP00000008393  LKMYGM..............GPR.........LYFHS..Sf..NCFDFGVTVGSIFEVVWAifrp.............
ENSCJAP00000018413  FKMAAL..............RHY.........YFTNS..W...NIFDFVVVILSIVGTVLSdiiqkyf..........
ENSCJAP00000008410  LKMYGM..............GPR.........LYFHS..Sf..NCFDFGVTVGSIFEVVWAifrp.............
ENSCJAP00000018484  FKMAAL..............RHY.........YFTNS..W...NIFDFVVVILSIVGTVLSdiiqkyf..........
ENSCJAP00000018438  FKMAAL..............RHY.........YFTNS..W...NIFDFVVVILSIVGTVLSdiiqkyf..........
ENSCJAP00000018440  FKMAAL..............RHY.........YFTNS..W...NIFDFVVVILSIVGTVLSdiiqkyf..........
ENSCJAP00000014011  LKIIAY..............GLLlhp......NAYVRngW...NLLDFVIVIVGLFSVILEqltketeggnhssgk..
ENSCJAP00000013976  LKIIAY..............GLLlhp......NAYVRngW...NLLDFVIVIVGLFSVILEqltketeggnhssgk..
ENSCJAP00000050238  LKIIAY..............GLLlhp......NAYVRngW...NLLDFVIVIVGLFSVILEqltketeggnhssgk..
ENSCJAP00000013508  VRARTGfleqglmvsdtd..RLW.........QHYKA..Tmq.FKLDVLSLVPTDLAYLQ-.................
ENSCJAP00000050035  VRARTGfleqglmvsdtd..RLW.........QHYKA..Tmq.FKLDVLSLVPTDLAYLQ-.................
ENSCJAP00000013510  VRARTGfleqglmvsdtd..RLW.........QHYKA..Tmq.FKLDVLSLVPTDLAYLQ-.................
ENSCJAP00000013487  VRARTGfleqglmvsdtd..RLW.........QHYKA..Tmq.FKLDVLSLVPTDLAYLQ-.................
ENSCJAP00000008406  LKMYGM..............GPR.........LYFHS..Sf..NCFDFGVTVGSIFEVVWAifrp.............
ENSCJAP00000001452  LKLIAF..............KPK.........GYFSDp.W...NVFDFLIVIGSIIDVILSetnpaehtqcspsmnae
ENSCJAP00000007056  IRLRTGfleqgllvkdtk..KLR.........DNYIH..Tlq.FKLDMASIIPTDLIYFA-.................
ENSCJAP00000007061  IRLRTGfleqgllvkdtk..KLR.........DNYIH..Tlq.FKLDMASIIPTDLIYFA-.................
ENSCJAP00000024932  LKMYGL..............GPR.........SYFRS..Sf..NCFDFGVIVGSVFEVVWAaikp.............
ENSCJAP00000024922  LKMYGL..............GPR.........SYFRS..Sf..NCFDFGVIVGSVFEVVWAaikp.............
ENSCJAP00000005022  LKIVAY..............GLVlhp......SAYIRngW...NLLDFIIVVVGLFSVLLEqgpgrpgdaphtggk..
ENSCJAP00000015533  LNFRTGivveegaeillapeAIR.........TRYLRt.W...FLVDLISSIPVDYIFLVVeleprldaevy......
ENSCJAP00000015531  LNFRTGivveegaeillapeAIR.........TRYLRt.W...FLVDLISSIPVDYIFLVVeleprldaevy......
ENSCJAP00000036148  LKWVAY..............GFK.........VYFTNa.W...CWLDFLIVDVSIISLVANwlgy.............
ENSCJAP00000018471  MKMFAL..............RQY.........YFTNG..W...NVFDFIVVVLSIASLIFSailkslqsy........
ENSCJAP00000036134  LKWVAY..............GFK.........VYFTNa.W...CWLDFLIVDVSIISLVANwlgy.............
ENSCJAP00000051809  LKVIAF..............KPK.........GYFSDa.W...NTFDSLIVIGSIIDVALSeadnsee..........
ENSCJAP00000018440  LKWVAY..............GFK.........KYFTNa.W...CWLDFLIVDVSLVSLVAN.................
ENSCJAP00000051772  LKLIAF..............KPK.........HYFCDa.W...NTFDALIVVGSIVDIAITevnpaehtqcspsmnae
ENSCJAP00000001522  LKLIAF..............KPK.........HYFCDa.W...NTFDALIVVGSIVDIAITevnpaehtqcspsmnae
ENSCJAP00000043192  LKLIAF..............KPK.........HYFCDa.W...NTFDALIVVGSIVDIAITevnpaehtqcspsmnae
ENSCJAP00000002533  MNFRTGtvnedsseiildpkVIK.........MNYLKs.W...FVVDFISSIPVDYIFLIV.................
ENSCJAP00000008130  IKMYGL..............GTR.........PYFHS..Sf..NCFDCGVIIGSIFEVIWAvikp.............
ENSCJAP00000014011  LKVIAF..............KPK.........GYFSDa.W...NTFDSLIVIGSIIDVALSeadnsee..........
ENSCJAP00000001328  LRFIAA..............NDK.........LWFWLevN...SVVDFFTVPPVFVSVYLN.................
ENSCJAP00000001906  LRFIAA..............NDK.........LWFWLevN...SVVDFFTVPPVFVSVYLN.................
ENSCJAP00000049896  LRFIAA..............NDK.........LWFWLevN...SVVDFFTVPPVFVSVYLN.................
ENSCJAP00000042093  LRFIAA..............NDK.........LWFWLevN...SVVDFFTVPPVFVSVYLN.................
ENSCJAP00000014021  LKVIAF..............KPK.........GYFSDa.W...NTFDSLIVIGSIIDVALSeadptesetvpvptatp
ENSCJAP00000013976  LKVIAF..............KPK.........GYFSDa.W...NTFDSLIVIGSIIDVALSeadptesetvpvptatp
ENSCJAP00000050238  LKVIAF..............KPK.........GYFSDa.W...NTFDSLIVIGSIIDVALSeadptesetvpvptatp
ENSCJAP00000024617  LKLVAF..............GFR.........RFFKDr.W...NQLDLAIVLLSLMGITLEeiemna...........
ENSCJAP00000051772  LKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGILETILV.................
ENSCJAP00000001522  LKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGILETILV.................
ENSCJAP00000008352  LKMYGM..............GPR.........LYFHS..Sf..NCFDFGLKIGIIMSQWAVsfevvwaifrp......
ENSCJAP00000043192  LKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGILETILV.................
ENSCJAP00000001452  LKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGILETILV.................
ENSCJAP00000009758  LKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGILETILV.................
ENSCJAP00000001424  LKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGILETILV.................
ENSCJAP00000001424  LKLIAF..............KPK.........GYFSDp.W...NVFDFLIVIGSIIDVILSetnhyfcdawntfdal.
ENSCJAP00000009782  LKLMAF..............KAR.........GYFGDp.W...NVFDFLIVIGSIIDVILSeidvsisgeg.......
ENSCJAP00000009782  MKMYGL..............GLR.........QYFMSi.F...NRFDCFVVCSGILEVLLV.................
ENSCJAP00000008130  LKVMAF..............GIL.........NYFRDa.W...NIFDFVTVLGSITDILVTefg..............
ENSCJAP00000005022  LKIIAF..............KPK.........HYFTDa.W...NTFDALIVVGSVVDIAVTevnng............
ENSCJAP00000004594  LRLFAA..............PSR.........CRFLR..Svm.SLIDVVAILPYYIGLLVPknd..............
ENSCJAP00000036717  INFRTTyvnnndevvshpr.RIV.........VHYFKg.W...FLIDMVAAIPFDLLIFRTgsd..............
ENSCJAP00000001901  LRFIAA..............NDK.........LWFWLevN...SVVDFFTVPPVFVSVYLN.................
ENSCJAP00000034755  FKLVAF..............GFR.........RFFQDr.W...NQLDLAIVLLSIMGITLEeievna...........
ENSCJAP00000011864  VKILAR..............GFCvge......FTFLRdpW...NWLDFVVIVFAYLTEFV-.................
ENSCJAP00000005008  LKIIAF..............KPK.........HYFTDa.W...NTFDALIVVGSVVDIAVTevnng............
ENSCJAP00000034722  FKLVAF..............GFR.........RFFQDr.W...NQLDLAIVLLSIMGITLEeievna...........
ENSCJAP00000034731  FKLVAF..............GFR.........RFFQDr.W...NQLDLAIVLLSIMGITLEeievna...........
ENSCJAP00000024932  IKMIDL..............GLLlhp......GAYFRdlW...NILDFIVVSGALVAFAFSgskg.............
ENSCJAP00000024922  IKMIDL..............GLLlhp......GAYFRdlW...NILDFIVVSGALVAFAFSgskg.............
ENSCJAP00000008393  LKVIAF..............GFL.........NYFRDt.W...NIFDFITVIGSITEIILTdsklvn...........
ENSCJAP00000008406  LKVIAF..............GFL.........NYFRDt.W...NIFDFITVIGSITEIILTdsklvn...........
ENSCJAP00000008410  LKVIAF..............GFL.........NYFRDt.W...NIFDFITVIGSITEIILTdsklvn...........
ENSCJAP00000024922  LKIIAF..............GVL.........NYFRDa.W...NVFDFVTVLGSITDILVTeiavk............
ENSCJAP00000018110  IKIFAL..............RQH.........YFTNG..W...NLFDCVVVVLSIVSTIVSilakqdhip........
ENSCJAP00000024932  LKIIAF..............GVL.........NYFRDa.W...NVFDFVTVLGSITDILVTeiart............
ENSCJAP00000014011  VKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGITETILV.................
ENSCJAP00000009782  MKIIAY..............GFLfhq......DAYLRsgW...NVLDFTIVFLGVFTVILEqvnviqsntapmssk..
ENSCJAP00000008352  IKMIDQ..............GLIlqd......GSYFRdlW...NILDFVVVVGALVAFALA.................
ENSCJAP00000011251  LKIIAM..............DPY.........YYFQEg.W...NIFDGFIVSLSLMELGLA.................
ENSCJAP00000011518  LKIIAM..............DPY.........YYFQEg.W...NIFDGFIVSLSLMELGLA.................
ENSCJAP00000011461  LKIIAM..............DPY.........YYFQEg.W...NIFDGFIVSLSLMELGLA.................
ENSCJAP00000009782  LKMTTYgaf...........LHK.........GSFCR..Nyf.NILDLLVVAVSLISMGLE.................
ENSCJAP00000032909  LKLIAM..............DPY.........YYFQEg.W...NIFDGFIVSLSLMELSLA.................
ENSCJAP00000011510  LKIIAM..............DPY.........YYFQEg.W...NIFDGFIVSLSLMELGLA.................
ENSCJAP00000051432  VKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGITETILV.................
ENSCJAP00000011266  LKIIAM..............DPY.........YYFQEg.W...NIFDGIIVSLSLMELGLS.................
ENSCJAP00000024922  IKIIAL..............GFVfhk......GSYLRngW...NVMDFVVVLTGILATAG-.................
ENSCJAP00000003065  LKIFAL..............GLS.........YFYDF..W...NNLDFFIMSMAVLDFVLMlthsfaiyhq.......
ENSCJAP00000049104  LKIFAL..............GLS.........YFYDF..W...NNLDFFIMSMAVLDFVLMlthsfaiyhq.......
ENSCJAP00000032944  LKLIAM..............DPY.........YYFQEg.W...NIFDGFIVSLSLMELSLA.................
ENSCJAP00000032952  LKLIAM..............DPY.........YYFQEg.W...NIFDGFIVSLSLMELSLA.................
ENSCJAP00000008393  IKIVAL..............GFIfhk......GSYLRngW...NVMDFIVVLSGILATAGThf...............
ENSCJAP00000008406  IKIVAL..............GFIfhk......GSYLRngW...NVMDFIVVLSGILATAGThf...............
ENSCJAP00000008410  IKIVAL..............GFIfhk......GSYLRngW...NVMDFIVVLSGILATAGThf...............
ENSCJAP00000013976  VKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGITETILV.................
ENSCJAP00000050238  VKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGITETILV.................
ENSCJAP00000008406  IKMIDQ..............GLIlqd......GSYFRdlW...NILDFVVVVGALVAFALAafprrtnkg........
ENSCJAP00000008410  IKMIDQ..............GLIlqd......GSYFRdlW...NILDFVVVVGALVAFALAafprrtnkg........
ENSCJAP00000008393  IKMIDQ..............GLIlqd......GSYFRdlW...NILDFVVVVGALVAFALAafprrtnkg........
ENSCJAP00000051012  VKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGITETILV.................
ENSCJAP00000011705  LKIIAM..............DPY.........YYFQEg.W...NIFDGFIVTLSLVELGLA.................
ENSCJAP00000024932  IKIIAL..............GFVfhk......GSYLRngW...NVMDFVVVLTGILATAG-.................
ENSCJAP00000051772  LKVIAY..............GLLfhp......NAYLRngW...NLLDFIIVVVGLFSAILEqatkadganalggk...
ENSCJAP00000014021  VKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGITETILV.................
ENSCJAP00000001522  LKVIAY..............GLLfhp......NAYLRngW...NLLDFIIVVVGLFSAILEqatkadganalggk...
ENSCJAP00000026361  VRFHTGfleqgilvvdkg..RIS.........SRYVRt.Ws..FLLDLASLMPTDVVYLRL.................
ENSCJAP00000023649  LNFRTGiviednteiildpeKIK.........KKYLRt.W...FVVDFVSSIPVDYGTKAAgpgregdgag.......
ENSCJAP00000043192  LKVIAY..............GLLfhp......NAYLRngW...NLLDFIIVVVGLFSAILEqatkadganalggk...
ENSCJAP00000009758  LKVIAY..............GLLfhp......NAYLRngW...NLLDFIIVVVGLFSAILEqatkadganalggk...
ENSCJAP00000001424  LKVIAY..............GLLfhp......NAYLRngW...NLLDFIIVVVGLFSAILEqatkadganalggk...
ENSCJAP00000024617  IKMVALglf...........GQK.........CYLGDt.W...NRLDFFIVMAGMMEYSLD.................
ENSCJAP00000051012  LKVIAF..............KPK.........GYFSDa.W...NTFDSLIVIGSIIDVALS.................
ENSCJAP00000009776  MKMYGL..............GLR.........QYFMSi.F...NRFDCFVVCSGILEVLLV.................
ENSCJAP00000047289  VKILAR..............GFCvge......FTFLRdpW...NWLDFVVIVFAYLTEFV-.................
ENSCJAP00000049465  VKILAR..............GFClha......FTFLRdpW...NWLDFSVIVMAYTTEFV-.................
ENSCJAP00000011864  LKLIAM..............DPY.........EYFQVg.W...NIFDSLIVTLSLVELFLA.................
ENSCJAP00000014011  LKMTTFgaf...........LHK.........GAFCR..Nyf.NLLDMLVVGVSLVSFGIQ.................
ENSCJAP00000013976  LKMTTFgaf...........LHK.........GAFCR..Nyf.NLLDMLVVGVSLVSFGIQ.................
ENSCJAP00000050238  LKMTTFgaf...........LHK.........GAFCR..Nyf.NLLDMLVVGVSLVSFGIQ.................
ENSCJAP00000014021  LKMTTFgaf...........LHK.........GAFCR..Nyf.NLLDMLVVGVSLVSFGIQ.................
ENSCJAP00000001452  LKVIAY..............GLLfhp......NAYLRngW...NLLDFIIVVVGLFSAILEqatkadganalggk...
ENSCJAP00000051012  LKMTTFgaf...........LHK.........GAFCR..Nyf.NLLDMLVVGVSLVSFGIQ.................
ENSCJAP00000024578  LKLLAC..............GPL.........GYIRS..Py..NIFDGIIVVISVWEIVGQ.................
ENSCJAP00000043192  LKMTAYgaf...........LHK.........GSFCR..Nyf.NILDLLVVSVSLISFGIQ.................
ENSCJAP00000001539  LKVIAY..............GLLfhp......NAYLRngW...NLLDFIIVVVGLFSAILEqatkadganalggk...
ENSCJAP00000001452  LKMTAYgaf...........LHK.........GSFCR..Nyf.NILDLLVVSVSLISFGIQ.................
ENSCJAP00000001544  LKVIAY..............GLLfhp......NAYLRngW...NLLDFIIVVVGLFSAILEqatkadganalggk...
ENSCJAP00000051432  LKMTTFgaf...........LHK.........GAFCR..Nyf.NLLDMLVVGVSLVSFGIQ.................
ENSCJAP00000011693  IKILAR..............GFCled......FTFLRdpW...NWLDFTVITFAYVTEFV-.................
ENSCJAP00000032944  VKIIAR..............GFCidg......FTFLRdpW...NWLDFSVIMMAYITEFV-.................
ENSCJAP00000032952  VKIIAR..............GFCidg......FTFLRdpW...NWLDFSVIMMAYITEFV-.................
ENSCJAP00000032909  VKIIAR..............GFCidg......FTFLRdpW...NWLDFSVIMMAYITEFV-.................
ENSCJAP00000018413  VKILAR..............GFClha......FTFLRdpW...NWLDFSVIVMAYVSENI-.................
ENSCJAP00000018438  VKILAR..............GFClha......FTFLRdpW...NWLDFSVIVMAYVSENI-.................
ENSCJAP00000018440  VKILAR..............GFClha......FTFLRdpW...NWLDFSVIVMAYVSENI-.................
ENSCJAP00000005090  LRFMAA..............DDK.........IKFWLemN...SIVDIFTIPPTFISYYLK.................
ENSCJAP00000011860  VKILAR..............GFCvge......FTFLRdpW...NWLDFVVIVFAYVTEFV-.................
ENSCJAP00000051772  LKMTAYgaf...........LHK.........GSFCR..Nyf.NILDLLVVSVSLISFGIQ.................
ENSCJAP00000001522  LKMTAYgaf...........LHK.........GSFCR..Nyf.NILDLLVVSVSLISFGIQ.................
ENSCJAP00000009758  LKMTAYgaf...........LHK.........GSFCR..Nyf.NILDLLVVSVSLISFGIQ.................
ENSCJAP00000011461  IKILAR..............GFCled......FTFLRdpW...NWLDFTVITFAYVTEFV-.................
ENSCJAP00000008352  LKVIAF..............GFL.........NYFRDt.W...NIFDFITVIGSITEIILTdsklvn...........
ENSCJAP00000036134  LKLIAM..............DPY.........EYFQQg.W...NIFDSIIVTLSLVELGLA.................
ENSCJAP00000011251  IKILAR..............GFCled......FTFLRdpW...NWLDFTVITFAYVTEFV-.................
ENSCJAP00000011518  IKILAR..............GFCled......FTFLRdpW...NWLDFTVITFAYVTEFV-.................
ENSCJAP00000032944  LKWTAY..............GFV.........KFFTNa.W...CWLDFLIVAVV-------.................
ENSCJAP00000011705  IKIIAR..............GFCled......FTFLRdpW...NWLDFTVITFAYVTEFV-.................
ENSCJAP00000018484  VKILAR..............GFClha......FTFLRdpW...NWLDFSVIVMAYTTEFV-.................
ENSCJAP00000018413  FKIIAL..............DPY.........YYFQQg.W...NIFDSIIVVLSLMELGLS.................
ENSCJAP00000036134  IKILAR..............GFCvdd......FTFLRdpW...NWLDFSVIMMAYLTEFV-.................
ENSCJAP00000000428  LIQPRIqfirggdiivdsn.ELR.........KHYRS..Stk.FQLDVASIIPFDVCYLF-.................
ENSCJAP00000018440  FKIIAL..............DPY.........YYFQQg.W...NIFDSIIVVLSLMELGLS.................
ENSCJAP00000018484  FKIIAL..............DPY.........YYFQQg.W...NIFDSIIVVLSLMELGLS.................
ENSCJAP00000018438  FKIIAL..............DPY.........YYFQQg.W...NIFDSIIVVLSLMELGLS.................
ENSCJAP00000005022  LKLYGL..............GPS.........AYVSS..Ff..NRFDCFVVCGGILETTLV.................
ENSCJAP00000018471  LKWVAY..............GFK.........KYFTNa.W...CWLDFLIVNVSGSVGTCGckr..............
ENSCJAP00000051432  LKVIAF..............KPK.........HYFTDa.W...NTFDALIVVGSVVDIAITevnptese.........
ENSCJAP00000011510  IKILAR..............GFCled......FTFLRdpW...NWLDFTVITFAYVTEFV-.................
ENSCJAP00000028522  ------..............---.........-----..-...------------------.................
ENSCJAP00000005008  LKMTVFgaf...........LHR.........GSFCRs.Wf..NMLDLLVVSVSLISFGIH.................
ENSCJAP00000008130  IKMIDL..............GLVlhq......GAYFRdlW...NILDFIVVSGALVAFAFTgnskg............
ENSCJAP00000005022  LKMTVFgaf...........LHR.........GSFCRs.Wf..NMLDLLVVSVSLISFGIH.................
ENSCJAP00000036148  LKLIAM..............DPY.........EYFQQg.W...NIFDSIIVTLSLVELGLA.................
ENSCJAP00000009776  MKIIAY..............GFLfhq......DAYLRsgW...NVLDFTIVFLGVFTVILEqvnviqsntapmssk..
ENSCJAP00000018471  IKILAR..............GFClne......FTYLRdpW...NWLDFSVITLAYVGTAI-.................
ENSCJAP00000036144  IKILAR..............GFCvdd......FTFLRdpW...NWLDFSVIMMAYLTEFV-.................
ENSCJAP00000018471  FKIIAF..............DPY.........YYFQKk.W...NIFDCIIVTVSLLELGVA.................
ENSCJAP00000036148  IKILAR..............GFCvdd......FTFLRdpW...NWLDFSVIMMAYLTEFV-.................
ENSCJAP00000001539  LKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGILETILV.................
ENSCJAP00000001544  LKMYSL..............GLQ.........AYFVS..Lf..NRFDCFVVCGGILETILV.................
ENSCJAP00000015632  ------..............---.........-----..-...------------------.................
ENSCJAP00000045673  ------..............---.........-----..-...------------------.................
ENSCJAP00000017214  ------..............---.........-----..-...------------------.................
ENSCJAP00000030676  ------..............---.........-----..-...------------------.................
ENSCJAP00000048251  ------..............---.........-----..-...------------------.................
ENSCJAP00000019483  ------..............---.........-----..-...------------------.................
ENSCJAP00000017218  ------..............---.........-----..-...------------------.................
ENSCJAP00000031810  ------..............---.........-----..-...------------------.................
ENSCJAP00000031809  ------..............---.........-----..-...------------------.................
ENSCJAP00000031817  ------..............---.........-----..-...------------------.................
ENSCJAP00000018110  IKILAR..............GFIlde......FSFLRdpW...NWLDSLVIGTAMVSYWC-.................
ENSCJAP00000025797  ------..............---.........-----..-...------------------.................
ENSCJAP00000047563  ------..............---.........-----..-...------------------.................
ENSCJAP00000025796  ------..............---.........-----..-...------------------.................
ENSCJAP00000036144  LKLIAM..............DPY.........EYFQQg.W...NIFDSIIVTLSLVELGLA.................
ENSCJAP00000001539  LKMTAYgaf...........LHK.........GSFCR..Nyf.NILDLLVVSVSLISFGIQ.................
ENSCJAP00000015636  ------..............---.........-----..-...------------------.................
ENSCJAP00000001544  LKMTAYgaf...........LHK.........GSFCR..Nyf.NILDLLVVSVSLISFGIQ.................
ENSCJAP00000044387  LKLIAF..............RCF.........YFTIA..W...NIFDFMVVIFSITGLCLPmtv..............
ENSCJAP00000051406  ------..............---.........-----..-...------------------.................
ENSCJAP00000017751  LGWLNG..............FWI.........FWKDG..W...NILNFIIVFELLLGFFIN.................
ENSCJAP00000001424  LKMTAYgaf...........LHK.........GSFCR..Nyf.NILDLLVVSVSLISFGIQ.................
ENSCJAP00000028312  ------..............---.........-----..-...------------------.................
ENSCJAP00000039183  LKIMAD..............GLFftp......TAVIR..Dfg.GVMDIFIYLVSLIFLCWM.................
ENSCJAP00000018110  LKIIAL..............DPY.........HYFRRg.W...NVFDSIVALLSFADVLNGi................
ENSCJAP00000039178  LKIMAD..............GLFftp......TAVIR..Dfg.GVMDIFIYLVSLIFLCWM.................
ENSCJAP00000011922  LKLIAF..............RCF.........YFTIA..W...NIFDFMVVIFSITGKILNniiq.............
ENSCJAP00000007663  ------..............---.........-----..-...------------------.................
ENSCJAP00000032603  ------..............---.........-----..-...------------------.................
ENSCJAP00000009758  ------..............---.........-YFCDa.W...NTFDALIVVGSIVDIAITevnnaee..........
ENSCJAP00000025602  ------..............---.........-----..-...------------------.................
ENSCJAP00000048019  ------..............---.........-----..-...------------------.................
ENSCJAP00000010880  ------..............---.........-----..-...------------------.................
ENSCJAP00000028254  ------..............---.........-----..-...------------------.................
ENSCJAP00000024637  ------..............---.........-----..-...------------------.................
ENSCJAP00000028292  ------..............---.........-----..-...------------------.................
ENSCJAP00000021660  VFQIRLqfvrggdiitdkk.DMR.........NNYLK..Srr.FKMDLLSLLPLDFLYLK-.................
ENSCJAP00000021649  VFQIRLqfvrggdiitdkk.DMR.........NNYLK..Srr.FKMDLLSLLPLDFLYLK-.................
ENSCJAP00000028286  ------..............---.........-----..-...------------------.................
ENSCJAP00000036223  ------..............---.........-----..-...------------------.................
ENSCJAP00000010869  ------..............---.........-----..-...------------------.................
ENSCJAP00000044387  LKWMAY..............GFK.........AYFSNs.W...YRLDFMVVIVFCLSLIGK.................
ENSCJAP00000033717  ------..............---.........-----..-...------------------.................
ENSCJAP00000000198  ------..............---.........-----..-...------------------.................
ENSCJAP00000051538  ------..............---.........-----..-...------------------.................
ENSCJAP00000011266  IKILAR..............GFCled......FTFLRdpW...NWLDFSVIVMAYICNFQ-.................
ENSCJAP00000036144  LKMLAL..............RQY.........YFTVG..W...NIFDFVVVILSIVGAHVL.................
ENSCJAP00000031810  ------..............---.........-----..-...------------------.................
ENSCJAP00000031809  ------..............---.........-----..-...------------------.................
ENSCJAP00000031817  ------..............---.........-----..-...------------------.................
ENSCJAP00000004803  LMWLSS..............FSL.........FWKSA..W...NVFDFVVTMLSLLPEVVLlagvt............
ENSCJAP00000011922  LKWMAY..............GFK.........AYFSNs.W...YRLDFMVVIVFCLSLIGK.................
ENSCJAP00000010847  ------..............---.........-----..-...------------------.................
ENSCJAP00000010844  ------..............---.........-----..-...------------------.................
ENSCJAP00000034853  ------..............---.........-----..-...------------------.................
ENSCJAP00000004793  LMWLSS..............FSL.........FWKSA..W...NVFDFVVTMLSLLPEVVLlagvt............
ENSCJAP00000007663  ------..............---.........-----..-...------------------.................
ENSCJAP00000032603  ------..............---.........-----..-...------------------.................
ENSCJAP00000042788  ------..............---.........-----..-...------------------.................
ENSCJAP00000033365  ------..............---.........-----..-...------------------.................
ENSCJAP00000004804  LMWLSS..............FSL.........FWKSA..W...NVFDFVVTMLSLLPEVVLlagvt............
ENSCJAP00000028286  ------..............---.........-----..-...------------------.................
ENSCJAP00000028292  ------..............---.........-----..-...------------------.................
ENSCJAP00000025789  ------..............---.........-----..-...------------------.................
ENSCJAP00000028254  ------..............---.........-----..-...------------------.................
ENSCJAP00000033361  ------..............---.........-----..-...------------------.................
ENSCJAP00000016635  ------..............---.........-----..-...------------------.................
ENSCJAP00000044520  ------..............---.........-----..-...------------------.................
ENSCJAP00000004712  ------..............---.........-----..-...------------------.................
ENSCJAP00000004717  ------..............---.........-----..-...------------------.................
ENSCJAP00000033717  ------..............---.........-----..-...------------------.................
ENSCJAP00000028312  ------..............---.........-----..-...------------------.................
ENSCJAP00000000665  ------..............---.........-----..-...------------------.................
ENSCJAP00000010822  ------..............---.........-----..-...------------------.................
ENSCJAP00000011922  LKIIAM..............HPY.........GYFQVg.W...NIFDSIIVFLGLAELFLA.................
ENSCJAP00000030680  ------..............---.........-----..-...------------------.................
ENSCJAP00000036134  LKMLAL..............RQY.........YFTVG..W...NIFDFVVVILSIVAMTFA.................
ENSCJAP00000036148  LKMLAL..............RQY.........YFTVG..W...NIFDFVVVILSIVAMTFA.................
ENSCJAP00000041691  ------..............---.........-----..-...------------------.................
ENSCJAP00000043961  ------..............---.........-----..-...------------------.................
ENSCJAP00000050339  ------..............---.........-----..-...------------------.................
ENSCJAP00000032611  ------..............---.........-----..-...------------------.................
ENSCJAP00000036223  ------..............---.........-----..-...------------------.................
ENSCJAP00000006678  ------..............---.........-----..-...------------------.................
ENSCJAP00000002449  ------..............---.........-----..-...------------------.................
ENSCJAP00000028533  ------..............---.........-----..-...------------------.................
ENSCJAP00000008130  ------..............---.........-----..-...------------------.................
ENSCJAP00000033335  ------..............---.........-----..-...------------------.................
ENSCJAP00000044017  LGWLNG..............FWI.........FWKDG..W...NILNFIIVFELLLGFFIN.................
ENSCJAP00000002449  ------..............---.........-----..-...------------------.................
ENSCJAP00000008352  ------..............---.........-----..-...--MDFIVVLSGILATAGThf...............
ENSCJAP00000010847  ------..............---.........-----..-...------------------.................
ENSCJAP00000010844  ------..............---.........-----..-...------------------.................
ENSCJAP00000032608  ------..............---.........-----..-...------------------.................
ENSCJAP00000001064  ------..............---.........-----..-...------------------.................
ENSCJAP00000044773  ------..............---.........-----..-...------------------.................
ENSCJAP00000015112  ------..............---.........-----..-...------------------.................
ENSCJAP00000042307  ------..............---.........-----..-...------------------.................
ENSCJAP00000044603  ------..............---.........-----..-...------------------.................
ENSCJAP00000032611  ------..............---.........-----..-...------------------.................
ENSCJAP00000024941  ------..............---.........-----..-...------------------.................
ENSCJAP00000039178  LKIWCL..............GFT.........GYISS..Sl..HKFELLLVIGTTLHVYP-.................
ENSCJAP00000010822  ------..............---.........-----..-...------------------.................
ENSCJAP00000010657  MKVYVD..............PTD.........YWKDG..Y...NVMDVVIIIIIFLPYTTRrflg.............
ENSCJAP00000045969  VKLFAR..............GVWags......FSFLGdpW...NWLDFSVTVFEIIIRYS-.................
ENSCJAP00000010880  ------..............---.........-----..-...------------------.................
ENSCJAP00000047810  MKVYVD..............PTD.........YWKDG..Y...NVMDVVIIIIIFLPYTTRrflg.............
ENSCJAP00000032608  ------..............---.........-----..-...------------------.................
ENSCJAP00000024941  ------..............---.........-----..-...------------------.................
ENSCJAP00000016592  ------..............---.........-----..-...------------------.................
ENSCJAP00000001064  ------..............---.........-----..-...------------------.................
ENSCJAP00000039183  LKIWCL..............GFT.........GYISS..Sl..HKFELLLVIGTTLHVYP-.................
ENSCJAP00000029287  LKVFAL..............GLR.........GYLSYp.S...NVFDGLLTIVLLVLEISTlavyrlphpgwrp....
ENSCJAP00000010869  ------..............---.........-----..-...------------------.................
ENSCJAP00000003851  ------..............---.........-----..-...------------------.................
ENSCJAP00000018351  LKVAGL..............GPV.........EYLSSg.W...NLFDFSVTVFAFLGLLALa................
ENSCJAP00000011922  VKLFAR..............GVWags......FSFLGdpW...NWLDFSVTVFEIIIRYS-.................
ENSCJAP00000039178  AKMHIR..............GIVkgd......SSYVKdrW...CVFDGFMVFCLWVSLVLQvfeiadivdqm......
ENSCJAP00000034731  ------..............---.........-----..-...------------------.................
ENSCJAP00000011191  ------..............---.........-----..-...------------------.................
ENSCJAP00000040639  ------..............---.........-----..-...------------------.................
ENSCJAP00000000427  LIQPRIqfirggdiivdsn.ELR.........KHYRS..Stk.FQLDVASIIPFDVCYLFF.................
ENSCJAP00000039183  MKIIAM..............SPA.........GFWQS..Rr..NRYDLLVTSLGVVWVVLHfal..............
ENSCJAP00000009758  LKLIAF..............KPK.........GYFSDp.W...NVFDFLIVIGSIIDVIL-.................
ENSCJAP00000039178  MKIIAM..............SPA.........GFWQS..Rr..NRYDLLVTSLGVVWVVLHfal..............
ENSCJAP00000043591  VKILAR..............GFClha......FTFLRdpW...NWLDFSVIVM--------.................
ENSCJAP00000018307  LKVAGL..............GPV.........EYLSSg.W...NLFDFSVTVFAFLGLLALa................
ENSCJAP00000003851  ------..............---.........-----..-...------------------.................
ENSCJAP00000018358  LKVAGL..............GPV.........EYLSSg.W...NLFDFSVTVFAFLGLLALa................
ENSCJAP00000016835  FKLYVF..............RLE.........FFHHK..F...EILDAVVVVVSFVLDIVLlfre.............
ENSCJAP00000016824  FKLYVF..............RLE.........FFHHK..F...EILDAVVVVVSFVLDIVLlfre.............
ENSCJAP00000018307  MKLRWL..............GLH.........TFIRH..KrtmVKTSVLVVQFVEAIVVLV.................
ENSCJAP00000018358  MKLRWL..............GLH.........TFIRH..KrtmVKTSVLVVQFVEAIVVLV.................
ENSCJAP00000023858  ------..............---.........-----..-...------------------.................
ENSCJAP00000023857  ------..............---.........-----..-...------------------.................
ENSCJAP00000011719  LEIRIH..............KLH.........YFRSF..W...NCLDVLIIVLSVVAIGINiyrtsnvdvllqfledq
ENSCJAP00000023869  ------..............---.........-----..-...------------------.................
ENSCJAP00000011724  LEIRIH..............KLH.........YFRSF..W...NCLDVLIIVLSVVAIGINiyrtsnvdvllqfledq
ENSCJAP00000031891  LELHIH..............RLH.........YLRSI..W...NILDLVVILLSIVAVGFHifrtlevnrlmgkllqq
ENSCJAP00000032813  LRVFVD..............GRQ.........HYFSG..Lc..NILDIAIIVITLLTDVIYiffdfkfls........
ENSCJAP00000018176  ------..............---.........-----..-...------------------.................
ENSCJAP00000029682  ------..............---.........-----..-...------------------.................
ENSCJAP00000029731  ------..............---.........-----..-...------------------.................
ENSCJAP00000029720  ------..............---.........-----..-...------------------.................
ENSCJAP00000029725  ------..............---.........-----..-...------------------.................
ENSCJAP00000016830  FKLYVF..............RLE.........FFHHK..F...EILDAVVVVVSFVLDIVLlfre.............
ENSCJAP00000026317  VRFHT-..............---.........-----..-...------------------.................
ENSCJAP00000031883  LELHIH..............RLH.........YLRSI..W...NILDLVVILLSIVAVGFHifrtlevnrlmgkllqq
ENSCJAP00000008550  ------..............---.........-----..-...------------------.................
ENSCJAP00000008592  ------..............---.........-----..-...------------------.................
ENSCJAP00000019881  VRIVVL..............GIW.........DYIEN..Ki..EVFDGAVIILSLAPMVAStva..............
ENSCJAP00000018165  ------..............---.........-----..-...------------------.................
ENSCJAP00000008585  ------..............---.........-----..-...------------------.................
ENSCJAP00000051777  ------..............---.........-----..-...------------------.................
ENSCJAP00000008594  ------..............---.........-----..-...------------------.................
ENSCJAP00000043053  ------..............---.........-----..-...------------------.................
ENSCJAP00000018166  ------..............---.........-----..-...------------------.................
ENSCJAP00000043051  CRLK--..............RQK.........WRFFTr.Kr..NILDTSIILISFIILGLDmksislhkknmaryhhd


                                                                      100        110                
                                                                        |          |                
d1orqc_               .....G...HLAG.................................LGLFRLVRLLRFLR.ILLIISR.GS.K.....
ENSCJAP00000001034  .....G...---Qqamslai..........................LRVIRLVRVFRIFK.LSRHSKG.LQ.I.....
ENSCJAP00000006275  .....G...Q--Qamslai...........................LRVIRLVRVFRIFK.LSRHSKG.LQ.I.....
ENSCJAP00000011257  .....Q...---Qqqamsfai.........................LRIIRLVRVFRIFK.LSRHSKG.LQ.I.....
ENSCJAP00000051240  .....Q...---Qqqamsfai.........................LRIIRLVRVFRIFK.LSRHSKG.LQ.I.....
ENSCJAP00000040816  .....N...---Gqqamslai.........................LRVIRLVRVFRIFK.LSRHSKG.LQ.I.....
ENSCJAP00000041201  .....N...VRRV.................................VQIFRIMRILRILK.LARHSTG.LQ.S.....
ENSCJAP00000041491  .....N...VQQA.................................VQALRIMRIARIFK.LARHSSG.LQ.T.....
ENSCJAP00000000350  .....P...--AMslai.............................LRVIRLVRVFRIFK.LSRHSKG.LQ.I.....
ENSCJAP00000002245  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000006280  .....G...---Qqamslai..........................LRVIRLVRVFRIFK.LSRHSKG.LQ.I.....
ENSCJAP00000000354  .....P...--AMslai.............................LRVIRLVRVFRIFK.LSRHSKG.LQ.I.....
ENSCJAP00000002246  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000002252  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000043218  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000002244  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000006178  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000006190  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000011362  .....N...VGRI.................................VQVLRLLRALRMLK.LGRHSTG.LR.S.....
ENSCJAP00000042235  .....N...VGRI.................................VQVLRLLRALRMLK.LGRHSTG.LR.S.....
ENSCJAP00000006168  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000020121  .....K...VGQV.................................LRIMRLMRIFRILK.LARHSTG.LR.A.....
ENSCJAP00000006183  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000013687  .....N...MGKV.................................VQILRLMRIFRILK.LARHSVG.LR.S.....
ENSCJAP00000007967  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000013573  .....D...VLGF.................................LRVVRFVRILRIFK.LTRHFVG.LR.V.....
ENSCJAP00000020116  .....K...VGQV.................................LRIMRLMRIFRILK.LARHSTG.LR.A.....
ENSCJAP00000028718  .....N...LGRV.................................AQVLRLMRIFRILK.LARHSTG.LR.S.....
ENSCJAP00000000985  .....K...VGLV.................................LRVLRALRILYVMR.LARHSLG.LQ.T.....
ENSCJAP00000049469  .....K...VGLV.................................LRVLRALRILYVMR.LARHSLG.LQ.T.....
ENSCJAP00000014952  .....E...---Fghlgkv...........................VQVFRLMRIFRVLK.LARHSTG.LR.S.....
ENSCJAP00000032384  .....E...---Fghlgkv...........................VQVFRLMRIFRVLK.LARHSTG.LR.S.....
ENSCJAP00000007249  .....K...VGLV.................................LRVLRALRILYVMR.LARHSLG.LQ.T.....
ENSCJAP00000027043  .....R...AGVT.................................LRVLRMMRIFWVIK.LARHFIG.LQ.T.....
ENSCJAP00000050058  .....G...SEEL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000037509  .....G...SEEL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000014024  .....G...SEEL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000037518  .....G...SEEL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000037477  .....G...SEEL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000037521  .....G...SEEL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000018246  .....T...QGNIfatsa............................LRSLRFLQILRMVR.MDRRGGT.WK.L.....
ENSCJAP00000011046  .....E...TTTL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000036726  .....E...TTTL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000003807  .....E...TTTL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000011055  .....E...TTTL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000035788  .....N...VDEGissl.............................FSSLKVVRLLRLGR.VARKLDH.YL.E.....
ENSCJAP00000035791  .....N...VDEGissl.............................FSSLKVVRLLRLGR.VARKLDH.YL.E.....
ENSCJAP00000035786  .....N...VDEGissl.............................FSSLKVVRLLRLGR.VARKLDH.YL.E.....
ENSCJAP00000035785  .....N...VDEVsflnspgkrnecreqktdaqgeteegissl...FSSLKVVRLLRLGR.VARKLDH.YL.E.....
ENSCJAP00000005433  .....T...QGNIfatsa............................LRSMRFLQILRMVR.MDRRGGT.WK.L.....
ENSCJAP00000018820  .....S...QGNVfatsa............................LRSLRFLQILRMIR.MDRRGGT.WK.L.....
ENSCJAP00000032952  .....S...ELGA.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000032909  .....S...ELGA.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000005420  .....T...QGNIfatsa............................LRSMRFLQILRMVR.MDRRGGT.WK.L.....
ENSCJAP00000021515  .....S...KGQVfatsa............................IRGIRFLQILRMLH.VDRQGGT.WR.L.....
ENSCJAP00000018413  .....T...LGFAemgp.............................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000036144  .....S...ELGP.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000018484  .....T...LGFAemgp.............................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000018438  .....T...LGFAemgp.............................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000034755  .....K...ILGM.................................LRVLRLLRTLRPLR.VISRAQG.LK.L.....
ENSCJAP00000011266  .....S...ELGA.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000034722  .....K...ILGM.................................LRVLRLLRTLRPLR.VISRAQG.LK.L.....
ENSCJAP00000011510  .....S...ELGA.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000011251  .....S...ELGA.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000011518  .....S...ELGA.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000011461  .....S...ELGA.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000035750  .....N...VDEGissl.............................FSSLKVVRLLRLGR.VARKLDH.YL.E.....
ENSCJAP00000011705  .....S...ELGA.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000024714  .....D...VSGA.................................FVTLRVFRVFRIFK.FSRHSQG.LR.I.....
ENSCJAP00000032944  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000032952  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000032909  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000040782  .....D...VSGA.................................FVTLRVFRVFRIFK.FSRHSQG.LR.I.....
ENSCJAP00000011510  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000011251  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000011518  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000011461  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000035768  .....N...VDEL.................................LTSLKVVRLLRLGR.VARKLDH.YL.E.....
ENSCJAP00000038945  .....N...VYFG.................................AHLLKTVRLLRLLR.LLPRLDR.YS.Q.....
ENSCJAP00000038937  .....N...VYFG.................................AHLLKTVRLLRLLR.LLPRLDR.YS.Q.....
ENSCJAP00000024617  .....K...ILGV.................................LRVLRLLRTLRPLR.VISRAPG.LK.L.....
ENSCJAP00000011705  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000035074  .....-...LGWN.................................YPEIRLNRLLRISR.MFEFFQR.TE.T.....
ENSCJAP00000035079  .....-...LGWN.................................YPEIRLNRLLRISR.MFEFFQR.TE.T.....
ENSCJAP00000008124  .....N...QGNVlats.............................LRSLRFLQILRMLR.MDRRGGT.WK.L.....
ENSCJAP00000011222  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000011864  .....S...DLGP.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000011864  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000024578  .....G...HNVS.................................LSAIRTVRVLRPLR.AINRVPS.MR.I.....
ENSCJAP00000018242  .....T...QGNIfatsa............................LRSLRFLQILRMVR.MDRRGGT.WK.L.....
ENSCJAP00000024617  .....-...ADGG.................................LSVLRTFRLLRVLK.LVRFLPA.LR.R.....
ENSCJAP00000000792  .....T...VTSL.................................VHLLKTVRLLRLLR.LLQKLER.YS.Q.....
ENSCJAP00000008119  .....N...QGNVlats.............................LRSLRFLQILRMLR.MDRRGGT.WK.L.....
ENSCJAP00000014021  .....S...GGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000001539  .....N...SRIS.................................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000006710  .....T...VVSL.................................VHLLKTVRLLRLLR.LLQKLDR.YS.Q.....
ENSCJAP00000048898  .....S...LVHL.................................LKTVRLLRLLRLLN.LERYSQC.SA.V.....
ENSCJAP00000011266  .....V...SPTL.................................FRVIRLARIGRILR.LIKGAKG.IR.T.....
ENSCJAP00000001544  gnaeeN...SRIS.................................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000018110  .....-...--KE.................................LKSFRTLRALRPLR.ALSQFEG.MK.V.....
ENSCJAP00000008393  .....G...TSFG.................................ISVLRALRLLRIFK.ITKYWAS.LR.N.....
ENSCJAP00000018413  .....F...SPTL.................................FRVIRLARIGRILR.LIRGAKG.IR.T.....
ENSCJAP00000008410  .....G...TSFG.................................ISVLRALRLLRIFK.ITKYWAS.LR.N.....
ENSCJAP00000018484  .....F...SPTL.................................FRVIRLARIGRILR.LIRGAKG.IR.T.....
ENSCJAP00000018438  .....F...SPTL.................................FRVIRLARIGRILR.LIRGAKG.IR.T.....
ENSCJAP00000018440  .....F...SPTL.................................FRVIRLARIGRILR.LIRGAKG.IR.T.....
ENSCJAP00000014011  .....S...GGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000013976  .....S...GGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000050238  .....S...GGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000013508  .....-...VGMN.................................FPELRFNRLLKFAR.LFEFFDR.TE.T.....
ENSCJAP00000050035  .....-...VGMN.................................FPELRFNRLLKFAR.LFEFFDR.TE.T.....
ENSCJAP00000013510  .....-...VGMN.................................FPELRFNRLLKFAR.LFEFFDR.TE.T.....
ENSCJAP00000013487  .....-...VGMN.................................FPELRFNRLLKFAR.LFEFFDR.TE.T.....
ENSCJAP00000008406  .....G...TSFG.................................ISVLRALRLLRIFK.ITKYWAS.LR.N.....
ENSCJAP00000001452  ....eN...SRIS.................................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000007056  .....-...VGIH.................................SPEVRFNRLLHFAR.MFEFFDR.TE.T.....
ENSCJAP00000007061  .....-...VGIH.................................SPEVRFNRLLHFAR.MFEFFDR.TE.T.....
ENSCJAP00000024932  .....G...SSFG.................................ISVLRALRLLRIFK.VTKYWSS.LR.N.....
ENSCJAP00000024922  .....G...SSFG.................................ISVLRALRLLRIFK.VTKYWSS.LR.N.....
ENSCJAP00000005022  .....P...GGFD.................................VKALRAFRVLRPLR.LVSGVPS.LH.I.....
ENSCJAP00000015533  .....K...---Taralrivrf........................TKILSLLRLLRLSR.LIRYIHQ.WE.E.....
ENSCJAP00000015531  .....K...---Taralrivrf........................TKILSLLRLLRLSR.LIRYIHQ.WE.E.....
ENSCJAP00000036148  .....S...ELGP.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000018471  .....F...SPTL.................................FRVIRLARIGRILR.LIRAAKG.IR.T.....
ENSCJAP00000036134  .....S...ELGP.................................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000051809  .....S...NRIS.................................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000018440  .....T...LGFAemgp.............................IKSLRTLRALRPLR.ALSRFEG.MR.V.....
ENSCJAP00000051772  ....eN...SRIS.................................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000001522  ....eN...SRIS.................................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000043192  ....eN...SRIS.................................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000002533  .....E...KGMDsevyktaralrivrf..................TKILSLLRLLRLSR.LIRYIHQ.WE.E.....
ENSCJAP00000008130  .....G...TSFG.................................ISVLRALRLLRIFK.VTKYWAS.LR.N.....
ENSCJAP00000014011  .....S...NRIS.................................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000001328  .....R...SWLG.................................LRFLRALRLIQFSE.ILQFLNI.LK.T.....
ENSCJAP00000001906  .....R...SWLG.................................LRFLRALRLIQFSE.ILQFLNI.LK.T.....
ENSCJAP00000049896  .....R...SWLG.................................LRFLRALRLIQFSE.ILQFLNI.LK.T.....
ENSCJAP00000042093  .....R...SWLG.................................LRFLRALRLIQFSE.ILQFLNI.LK.T.....
ENSCJAP00000014021  .....G...---Nseesnris.........................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000013976  .....G...---Nseesnris.........................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000050238  .....G...---Nseesnris.........................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000024617  .....AlpiNPTI.................................IRIMRVLRIARVLK.LLKMATG.MR.A.....
ENSCJAP00000051772  .....E...TKIMsplg.............................ISVLRCVRLLRIFK.ITRYWNS.LS.N.....
ENSCJAP00000001522  .....E...TKIMsplg.............................ISVLRCVRLLRIFK.ITRYWNS.LS.N.....
ENSCJAP00000008352  .....G...TSFG.................................ISVLRALRLLRIFK.ITKYWAS.LR.N.....
ENSCJAP00000043192  .....E...TKIMsplg.............................ISVLRCVRLLRIFK.ITRYWNS.LS.N.....
ENSCJAP00000001452  .....E...TKIMsplg.............................ISVLRCVRLLRIFK.ITRYWNS.LS.N.....
ENSCJAP00000009758  .....E...TKIMsplg.............................ISVLRCVRLLRIFK.ITRYWNS.LS.N.....
ENSCJAP00000001424  .....E...TKIMsplg.............................ISVLRCVRLLRIFK.ITRYWNS.LS.N.....
ENSCJAP00000001424  .....I...---VvgsivdiaitevnpaehtqcspsmnaeensrisITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000009782  .....G...---Lsfmgqavggtdpdesaris..............SAFFRLFRVMRLIK.LLSRAEG.VR.T.....
ENSCJAP00000009782  .....E...VGAMtplg.............................ISVLRCIRLLRIFK.ITKYWTS.LS.N.....
ENSCJAP00000008130  .....N...NFIN.................................LSFLRLFRAARLIK.LLRQGYT.IR.I.....
ENSCJAP00000005022  .....G...---Hlgessedssris.....................ITFFRLFRVMRLVK.LLSKGEG.IR.T.....
ENSCJAP00000004594  .....D...VSGA.................................FVTLRVFRVFRIFK.FSRHSQ-.LR.I.....
ENSCJAP00000036717  .....E...TTTL.................................IGLLKTARLLRLVR.VARKLDR.YS.E.....
ENSCJAP00000001901  .....R...SWLG.................................LRFLRALRLIQFSE.ILQFLNI.LK.T.....
ENSCJAP00000034755  .....S...---Lpinpti...........................IRIMRVLRIARVLK.LLKMAVG.MR.A.....
ENSCJAP00000011864  .....-...NLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000005008  .....G...---Hlgessedssris.....................ITFFRLFRVMRLVK.LLSKGEG.IR.T.....
ENSCJAP00000034722  .....S...---Lpinpti...........................IRIMRVLRIARVLK.LLKMAVG.MR.A.....
ENSCJAP00000034731  .....S...---Lpinpti...........................IRIMRVLRIARVLK.LLKMAVG.MR.A.....
ENSCJAP00000024932  .....K...DINT.................................IKSLRVLRVLRPLK.TIKRLPK.LK.A.....
ENSCJAP00000024922  .....K...DINT.................................IKSLRVLRVLRPLK.TIKRLPK.LK.A.....
ENSCJAP00000008393  .....T...SGFN.................................MSFLKLFRAARLIK.LLRQGYT.IR.I.....
ENSCJAP00000008406  .....T...SGFN.................................MSFLKLFRAARLIK.LLRQGYT.IR.I.....
ENSCJAP00000008410  .....T...SGFN.................................MSFLKLFRAARLIK.LLRQGYT.IR.I.....
ENSCJAP00000024922  .....N...NFIN.................................LSFLRLFRAARLIK.LLRQGYT.IR.I.....
ENSCJAP00000018110  .....F...PPTL.................................FRIVRLARIGRILR.LVRAARG.IR.T.....
ENSCJAP00000024932  .....N...NFIN.................................LSFLRLFRAARLIK.LLRQGYT.IR.I.....
ENSCJAP00000014011  .....E...LEIMsplg.............................ISVFRCVRLLRIFK.VTRHWTS.LS.N.....
ENSCJAP00000009782  .....G...AGLD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000008352  .....N...ALGTnkgrdikt.........................IKSLRVLRVLRPLK.TIKRLPK.LK.A.....
ENSCJAP00000011251  .....N...VEG-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000011518  .....N...VEG-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000011461  .....N...VEG-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000009782  .....S...SAISv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000032909  .....D...VEG-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000011510  .....N...VEG-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000051432  .....E...LEIMsplg.............................ISVFRCVRLLRIFK.VTRHWTS.LS.N.....
ENSCJAP00000011266  .....N...VEG-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000024922  .....-...TDFD.................................LRTLRAVRVLRPLK.LVSGIPS.LQ.V.....
ENSCJAP00000003065  .....N...---Lfriikv...........................FKSLRVLRAIRVLR.RLSFLNS.VQ.E.....
ENSCJAP00000049104  .....N...---Lfriikv...........................FKSLRVLRAIRVLR.RLSFLNS.VQ.E.....
ENSCJAP00000032944  .....D...VEG-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000032952  .....D...VEG-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000008393  .....N...THVD.................................LRTLRAVRVLRPLK.LVSGIPS.LQ.I.....
ENSCJAP00000008406  .....N...THVD.................................LRTLRAVRVLRPLK.LVSGIPS.LQ.I.....
ENSCJAP00000008410  .....N...THVD.................................LRTLRAVRVLRPLK.LVSGIPS.LQ.I.....
ENSCJAP00000013976  .....E...LEIMsplg.............................ISVFRCVRLLRIFK.VTRHWTS.LS.N.....
ENSCJAP00000050238  .....E...LEIMsplg.............................ISVFRCVRLLRIFK.VTRHWTS.LS.N.....
ENSCJAP00000008406  .....R...---Dikt..............................IKSLRVLRVLRPLK.TIKRLPK.LK.A.....
ENSCJAP00000008410  .....R...---Dikt..............................IKSLRVLRVLRPLK.TIKRLPK.LK.A.....
ENSCJAP00000008393  .....R...---Dikt..............................IKSLRVLRVLRPLK.TIKRLPK.LK.A.....
ENSCJAP00000051012  .....E...LEIMsplg.............................ISVFRCVRLLRIFK.VTRHWTS.LS.N.....
ENSCJAP00000011705  .....N...VEG-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000024932  .....-...TDFD.................................LRTLRAVRVLRPLK.LVSGIPS.LQ.V.....
ENSCJAP00000051772  .....G...AGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000014021  .....E...LEIMsplg.............................ISVFRCVRLLRIFK.VTRHWTS.LS.N.....
ENSCJAP00000001522  .....G...AGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000026361  .....G...PH--.................................TPTLRLNRFLRVPR.LFEAFDR.TE.T.....
ENSCJAP00000023649  .....S...SQQG.................................RAIRFWVGLQWHME.WARQGQG.MR.V.....
ENSCJAP00000043192  .....G...AGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000009758  .....G...AGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000001424  .....G...AGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000024617  .....G...HNVS.................................LSAIRTVRVLRPLR.AINRVPT.LL.G.....
ENSCJAP00000051012  .....E...ADGDvsssrvsv.........................TFSLRGFRMMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000009776  .....E...VGAMtplg.............................ISVLRCIRLLRIFK.ITKYWTS.LS.N.....
ENSCJAP00000047289  .....-...NLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000049465  .....-...DLGN.................................VSALRTFRVLRALK.TISVISG.LK.T.....
ENSCJAP00000011864  .....D...VEG-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000014011  .....S...SAISv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000013976  .....S...SAISv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000050238  .....S...SAISv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000014021  .....S...SAISv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000001452  .....G...AGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000051012  .....S...SAISv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000024578  .....-...ADGG.................................LSVLRTFRLLRVLK.LVRFLPA.LR.R.....
ENSCJAP00000043192  .....S...SAINv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000001539  .....G...AGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000001452  .....S...SAINv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000001544  .....G...AGFD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000051432  .....S...SAISv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000011693  .....-...DLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000032944  .....-...NLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000032952  .....-...NLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000032909  .....-...NLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000018413  .....-...KLGN.................................LSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000018438  .....-...KLGN.................................LSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000018440  .....-...KLGN.................................LSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000005090  .....S...NWLG.................................LRFLRALRLLELPQ.ILQILQV.TK.T.....
ENSCJAP00000011860  .....-...DLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000051772  .....S...SAINv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000001522  .....S...SAINv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000009758  .....S...SAINv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000011461  .....-...NLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000008352  .....T...SGFN.................................MSFLKLFRAARLIK.LLRQGYT.IR.I.....
ENSCJAP00000036134  .....N...VQG-.................................LSVLRSFPLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000011251  .....-...DLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000011518  .....-...DLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000032944  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000011705  .....-...DLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000018484  .....-...DLGN.................................VSALRTFRVLRALK.TISVISG.LK.T.....
ENSCJAP00000018413  .....R...M-SN.................................LSVLRSFRLLRVFK.LAKSWPT.LN.T.....
ENSCJAP00000036134  .....-...DLGN.................................ISALRTFRVLRALK.TITVIPG.LK.T.....
ENSCJAP00000000428  .....-...----.................................FGFNPIFRANRMLK.YTSFFEF.-N.H.....
ENSCJAP00000018440  .....R...M-SN.................................LSVLRSFRLLRVFK.LAKSWPT.LN.T.....
ENSCJAP00000018484  .....R...M-SN.................................LSVLRSFRLLRVFK.LAKSWPT.LN.T.....
ENSCJAP00000018438  .....R...M-SN.................................LSVLRSFRLLRVFK.LAKSWPT.LN.T.....
ENSCJAP00000005022  .....E...VGAMqplg.............................ISVLRCVRLLRIFK.VTRHWAS.LS.N.....
ENSCJAP00000018471  .....S...SETWp................................PSWATTKKSFEHLS.AESFSVS.HQ.V.....
ENSCJAP00000051432  .....T...---Vpvptatpgnsvcsacns................SFHIMLFKVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000011510  .....-...DLGN.................................VSALRTFRVLRALK.TISVIPG.LK.T.....
ENSCJAP00000028522  .....-...----.................................--------------.-----RY.LS.D.....
ENSCJAP00000005008  .....S...SAISv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000008130  .....K...---Dint..............................IKSFRVLRVLRPLK.TIKRLPK.LK.A.....
ENSCJAP00000005022  .....S...SAISv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000036148  .....N...VQG-.................................LSVLRSFPLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000009776  .....G...AGLD.................................VKALRAFRVLRPLR.LVSGVPS.LQ.V.....
ENSCJAP00000018471  .....-...DLRG.................................ISGLRTFRVLRALK.TVSVIPG.LK.V.....
ENSCJAP00000036144  .....-...DLGN.................................ISALRTFRVLRALK.TITVIPG.LK.T.....
ENSCJAP00000018471  .....R...KGS-.................................LSVLRSFRLLRVFK.LAKSWPT.LN.T.....
ENSCJAP00000036148  .....-...DLGN.................................ISALRTFRVLRALK.TITVIPG.LK.T.....
ENSCJAP00000001539  .....E...TKIMsplg.............................ISVLRCVRLLRIFK.ITRYWNS.LS.N.....
ENSCJAP00000001544  .....E...TKIMsplg.............................ISVLRCVRLLRIFK.ITRYWNS.LS.N.....
ENSCJAP00000015632  .....-...----.................................-------FIPVFLN.CWLAKHA.LE.N.....
ENSCJAP00000045673  .....-...----.................................------LRLYLIAR.VMLLHSK.LF.Tdassr
ENSCJAP00000017214  .....-...----.................................------LRLYLIAR.VMLLHSK.LF.Tdassr
ENSCJAP00000030676  .....-...----.................................------LRLYLIAR.VMLLHSK.LF.Tdassr
ENSCJAP00000048251  .....-...----.................................------LRLYLIAR.VMLLHSK.LF.Tdassr
ENSCJAP00000019483  .....-...----.................................-------FIPVFLN.CWLAKHA.LE.N.....
ENSCJAP00000017218  .....-...----.................................------LRLYLIAR.VMLLHSK.LF.Tdassr
ENSCJAP00000031810  .....-...----.................................----------RVEK.VFRKKQV.SQ.T.....
ENSCJAP00000031809  .....-...----.................................----------RVEK.VFRKKQV.SQ.T.....
ENSCJAP00000031817  .....-...----.................................----------RVEK.VFRKKQV.SQ.T.....
ENSCJAP00000018110  .....-...ISIN.................................LLSLRTFRVLRALK.AISVVSR.LK.V.....
ENSCJAP00000025797  .....-...----.................................--------------.-------.--.Kitfn.
ENSCJAP00000047563  .....-...----.................................--------------.-------.--.Kitfn.
ENSCJAP00000025796  .....-...----.................................--------------.-------.--.Kitfn.
ENSCJAP00000036144  .....N...VQG-.................................LSVLRSFPLLRVFK.LAKSWPT.LN.M.....
ENSCJAP00000001539  .....S...SAINv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000015636  .....-...----.................................-------FVPVFLN.CWLAKHA.LE.N.....
ENSCJAP00000001544  .....S...SAINv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000044387  .....G...YYLVppsl.............................VKLILLSRIIHILR.LGKGPKV.FH.N.....
ENSCJAP00000051406  .....-...----.................................--------------.-------.--.Kitfn.
ENSCJAP00000017751  .....E...INI-.................................PSINYTLRALRLVH.LCMAVEP.LA.R.....
ENSCJAP00000001424  .....S...SAINv................................VKILRVLRVLRPLR.AINRAKG.LK.H.....
ENSCJAP00000028312  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000039183  .....P...QNVPaesg.............................AQLLMVLRCLRPLR.IFKLVPQ.MR.K.....
ENSCJAP00000018110  .....F...QKRS.................................WPFLRSFRVLRVFK.LAKSWPT.LN.T.....
ENSCJAP00000039178  .....P...QNVPaesg.............................AQLLMVLRCLRPLR.IFKLVPQ.MR.K.....
ENSCJAP00000011922  .....K...SYYLvppsl............................VKLILLSRIIHILR.LGKGPKV.FH.N.....
ENSCJAP00000007663  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000032603  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000009758  .....N...SRIS.................................ITFFRLFRVMRLVK.LLSRGEG.IR.T.....
ENSCJAP00000025602  .....-...----.................................--------------.------Y.LR.D.....
ENSCJAP00000048019  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000010880  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000028254  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000024637  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000028292  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000021660  .....-...----.................................VGVNPLLRLPRCLK.YMAFFEF.NN.R.....
ENSCJAP00000021649  .....-...----.................................VGVNPLLRLPRCLK.YMAFFEF.NN.R.....
ENSCJAP00000028286  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000036223  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000010869  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000044387  .....T...REE-.................................LQPLISIKFLRPLR.VLSQFER.MK.V.....
ENSCJAP00000033717  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000000198  .....-...----.................................--------------.------Y.LA.D.....
ENSCJAP00000051538  .....-...----.................................--------------.------Y.LA.D.....
ENSCJAP00000011266  .....-...HYGT.................................LRILFSFELLLLGDdHSSLSSG.LK.T.....
ENSCJAP00000036144  .....S...----.................................EKYKRWFQCLPMSR.TGTLVPI.LQ.V.....
ENSCJAP00000031810  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000031809  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000031817  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000004803  .....G...QPVW.................................LQFLRICRVLRSLK.FFARFRQ.IR.V.....
ENSCJAP00000011922  .....T...REE-.................................LQPLISIKFLRPLR.VLSQFER.MK.V.....
ENSCJAP00000010847  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000010844  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000034853  .....-...----.................................--------------.------Y.LA.D.....
ENSCJAP00000004793  .....G...QPVW.................................LQFLRICRVLRSLK.FFARFRQ.IR.V.....
ENSCJAP00000007663  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000032603  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000042788  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000033365  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000004804  .....G...QPVW.................................LQFLRICRVLRSLK.FFARFRQ.IR.V.....
ENSCJAP00000028286  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000028292  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000025789  .....-...----.................................--------------.-------.--.Kitfn.
ENSCJAP00000028254  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000033361  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000016635  .....-...----.................................--------------.-----RY.LS.D.....
ENSCJAP00000044520  .....-...----.................................--------------.-----RY.LS.D.....
ENSCJAP00000004712  .....-...----.................................--------------.-----RY.LT.D.....
ENSCJAP00000004717  .....-...----.................................--------------.-----RY.LT.D.....
ENSCJAP00000033717  .....-...----.................................--------------.-------.-S.K.....
ENSCJAP00000028312  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000000665  .....-...----.................................--------------.-----RY.LS.D.....
ENSCJAP00000010822  .....-...----.................................--------------.AKRLGQF.LT.K.....
ENSCJAP00000011922  .....-...YIEG.................................LAVFQSFRMLRIFK.LGKYWPT.FQ.I.....
ENSCJAP00000030680  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000036134  .....N...SIENgalpsptssyltsssigak..............L-------------.-QPLAPRpLG.E.....
ENSCJAP00000036148  .....N...SIENgalpsptssylts....................SSIGAKLQPLAPRP.LGEPSHH.LF.S.....
ENSCJAP00000041691  .....-...----.................................--------------.-------.--.D.....
ENSCJAP00000043961  .....-...----.................................--------------.-------.--.D.....
ENSCJAP00000050339  .....-...----.................................--------------.-------.--.D.....
ENSCJAP00000032611  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000036223  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000006678  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000002449  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000028533  .....-...----.................................--------------.-----RY.LS.D.....
ENSCJAP00000008130  .....-...--FD.................................LRTLRAVRVLRPLK.LVSGIPS.LQ.V.....
ENSCJAP00000033335  .....-...----.................................-------------R.DLWPWQR.IF.H.....
ENSCJAP00000044017  .....E...INI-.................................PSINYTLRALRLVH.LCMAVEP.LA.R.....
ENSCJAP00000002449  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000008352  .....N...THVD.................................LRTLRAVRVLRPLK.LVSGIPS.LQ.I.....
ENSCJAP00000010847  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000010844  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000032608  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000001064  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000044773  .....-...----.................................--------------.----FLY.LK.D.....
ENSCJAP00000015112  .....-...----.................................--------------.-------.LQ.D.....
ENSCJAP00000042307  .....-...----.................................--------------.-------.LQ.D.....
ENSCJAP00000044603  .....-...----.................................--------------.-------.LQ.D.....
ENSCJAP00000032611  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000024941  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000039178  .....-...-DLY.................................HSQFTYFQVLRVVR.LIKISPA.LE.D.....
ENSCJAP00000010822  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000010657  .....K...QFTY.................................LYVADGMQSLRILK.IIRYSQG.IR.M.....
ENSCJAP00000045969  .....-...PLSF.................................IPMLQTVRTLRILK.IIYLNQG.LK.S.....
ENSCJAP00000010880  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000047810  .....K...QFTY.................................LYVADGMQSLRILK.IIRYSQG.IR.M.....
ENSCJAP00000032608  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000024941  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000016592  .....-...----.................................--------------.-------.--.D.....
ENSCJAP00000001064  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000039183  .....-...-DLY.................................HSQFTYFQVLRVVR.LIKISPA.LE.D.....
ENSCJAP00000029287  .....E...---Mlgllslwdm........................TRMLNMLIVFRFLR.IIPNMKP.MA.V.....
ENSCJAP00000010869  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000003851  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000018351  .....L...NMEP.................................FYFIVVLRPLQLLR.LFKLKER.YR.N.....
ENSCJAP00000011922  .....-...PLSF.................................IPMLQTVRTLQEVK.LIQVLSS.LK.S.....
ENSCJAP00000039178  .....S...PWGM.................................LRIPRPLIMIRAFR.IYFRFEL.PRtR.....
ENSCJAP00000034731  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000011191  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000040639  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000000427  .....G...FNPI.................................FRANRML-------.-------.--.-.....
ENSCJAP00000039183  .....L...NAYT.................................YMMGACVIVFRFFS.ICGKHVT.LK.M.....
ENSCJAP00000009758  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000039178  .....L...NAYT.................................YMMGACVIVFRFFS.ICGKHVT.LK.M.....
ENSCJAP00000043591  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000018307  .....L...NMEP.................................FYFIVVLRPLQLLR.LFKLKER.YR.N.....
ENSCJAP00000003851  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000018358  .....L...NMEP.................................FYFIVVLRPLQLLR.LFKLKER.YR.N.....
ENSCJAP00000016835  .....H...EFEA.................................LGLLILLRLWRVAR.II-----.--.-.....
ENSCJAP00000016824  .....H...EFEA.................................LGLLILLRLWRVAR.II-----.--.-.....
ENSCJAP00000018307  .....R...QTSH.................................VRVTRALRCIFLVD.CR-YCGG.VR.R.....
ENSCJAP00000018358  .....R...QTSH.................................VRVTRALRCIFLVD.CR-YCGG.VR.R.....
ENSCJAP00000023858  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000023857  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000011719  ....nT...---Fpnfehlaywqiqfnnv.................AAVIVFFVWIKLFK.FINFNRT.MS.Q.....
ENSCJAP00000023869  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000011724  ....nT...---Fpnfehlaywqiqfnnv.................AAVIVFFVWIKLFK.FINFNRT.MS.Q.....
ENSCJAP00000031891  .pnmyA...---Dfeflafwqtqynnm...................NAVNLFFAWIKIFK.YISFNKT.MT.Q.....
ENSCJAP00000032813  .....D...IPRWtpv..............................VRHLRLIILTRIVH.LVHQKRQ.LE.K.....
ENSCJAP00000018176  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000029682  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000029731  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000029720  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000029725  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000016830  .....H...EFEA.................................LGLLILLRLWRVAR.II-----.--.-.....
ENSCJAP00000026317  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000031883  .pnmyA...---Dfeflafwqtqynnm...................NAVNLFFAWIKIFK.YISFNKT.MT.Q.....
ENSCJAP00000008550  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000008592  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000019881  .....N...---Gprspwda..........................ISLIIMLRIWRVKR.VI-----.--.-.....
ENSCJAP00000018165  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000008585  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000051777  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000008594  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000043053  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000018166  .....-...----.................................--------------.-------.--.-.....
ENSCJAP00000043051  ...rdR...---Fisfyeavkvnsaathl.................VGFLVLLATVQLWN.LLRHSPR.LW.V.....


                               120       130              140        150                            
                                 |         |                |          |                            
d1orqc_               ...........FLSAIADAADKI.......RFYHLFGAVMLTVL.YGAFAI...........................
ENSCJAP00000001034  ...........LGKTLQASMRE-.......-LGLLIFFLFIGVI.LFSSAV...........................
ENSCJAP00000006275  ...........LGQTLKASMRE-.......-LGLLIFFLFIGVI.LFSSAV...........................
ENSCJAP00000011257  ...........LGHTLRASMRE-.......-LGLLIFFLFIGVI.LFSSAV...........................
ENSCJAP00000051240  ...........LGHTLRASMRE-.......-LGLLIFFLFIGVI.LFSSAV...........................
ENSCJAP00000040816  ...........LGKTLQASMRE-.......-LGLLIFFLFIGVI.LFSSAV...........................
ENSCJAP00000041201  ...........LGFTLRRSYNE-.......-LGLLILFLAMGIM.IFSSLV...........................
ENSCJAP00000041491  ...........LTYALKRSFKE-.......-LGLLLMYLAVGIF.VFSALG...........................
ENSCJAP00000000350  ...........LGQTLRASMRE-.......-LGLLIFFLFIGVV.LFSSAV...........................
ENSCJAP00000002245  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000006280  ...........LGQTLKASMRE-.......-LGLLIFFLFIGVI.LFSSAV...........................
ENSCJAP00000000354  ...........LGQTLRASMRE-.......-LGLLIFFLFIGVV.LFSSAV...........................
ENSCJAP00000002246  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000002252  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000043218  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000002244  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000006178  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000006190  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000011362  ...........LGMTITQCYEE-.......-VGLLLLFLSVGIS.IFSTVE...........................
ENSCJAP00000042235  ...........LGMTITQCYEE-.......-VGLLLLFLSVGIS.IFSTVE...........................
ENSCJAP00000006168  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000020121  ...........FGFTLRQCYQQ-.......-VGCLLLFITMGIL.TFAAAV...........................
ENSCJAP00000006183  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000013687  ...........LGATLRHSYHE-.......-VGLLLLFLSVGIS.IFSVLI...........................
ENSCJAP00000007967  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000013573  ...........LGHTLRASTNE-.......-FLLLIIFLALGVL.IFATMI...........................
ENSCJAP00000020116  ...........FGFTLRQCYQQ-.......-VGCLLLFITMGIL.TFAAAV...........................
ENSCJAP00000028718  ...........LGATLKYSYKE-.......-VGLLLLYLSVGIS.IFSVVA...........................
ENSCJAP00000000985  ...........LGLTARRCTRE-.......-FGLLLLFLCVAIA.LFAPLL...........................
ENSCJAP00000049469  ...........LGLTARRCTRE-.......-FGLLLLFLCVAIA.LFAPLL...........................
ENSCJAP00000014952  ...........LGATLKHSYRE-.......-VGILLLYLAVGVS.VFSGVA...........................
ENSCJAP00000032384  ...........LGATLKHSYRE-.......-VGILLLYLAVGVS.VFSGVA...........................
ENSCJAP00000007249  ...........LGLTVRRCTRE-.......-FGLLLLFLAVAVT.LFSPLV...........................
ENSCJAP00000027043  ...........LGLTLKRCYRE-.......-MVMLLVFICVAMA.IFSALS...........................
ENSCJAP00000050058  ...........YGAAV-------.......-LFLLMCTFALIAH.WLACIW...........................
ENSCJAP00000037509  ...........YGAAV-------.......-LFLLMCTFALIAH.WLACIW...........................
ENSCJAP00000014024  ...........YGAAV-------.......-LFLLMCTFALIAH.WLACIW...........................
ENSCJAP00000037518  ...........YGAAV-------.......-LFLLMCTFALIAH.WLACIW...........................
ENSCJAP00000037477  ...........YGAAV-------.......-LFLLMCTFALIAH.WLACIW...........................
ENSCJAP00000037521  ...........YGAAV-------.......-LFLLMCTFALIAH.WLACIW...........................
ENSCJAP00000018246  ...........LGSVVYAHSKE-.......-LITAWYIGFLVLI.FSSFLV...........................
ENSCJAP00000011046  ...........YGAAV-------.......-LFLLMCTFALIAH.WLACIW...........................
ENSCJAP00000036726  ...........YGAAV-------.......-LFLLMCTFALIAH.WLACIW...........................
ENSCJAP00000003807  ...........YGAAV-------.......-LFLLMCTFALIAH.WLACIW...........................
ENSCJAP00000011055  ...........YGAAV-------.......-LMLLMCIFALIAH.WLACIW...........................
ENSCJAP00000035788  ...........YGAAV-------.......-LVLLVCVFGLVAH.WLACIW...........................
ENSCJAP00000035791  ...........YGAAV-------.......-LVLLVCVFGLVAH.WLACIW...........................
ENSCJAP00000035786  ...........YGAAV-------.......-LVLLVCVFGLVAH.WLACIW...........................
ENSCJAP00000035785  ...........YGAAV-------.......-LVLLVCVFGLVAH.WLACIW...........................
ENSCJAP00000005433  ...........LGSVVYAHSKE-.......-LITAWYIGFLVLI.FASFLV...........................
ENSCJAP00000018820  ...........LGSVVYAHSKE-.......-LVTAWYIGFLCLI.LASFLV...........................
ENSCJAP00000032952  ...........VVNALVGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000032909  ...........VVNALVGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000005420  ...........LGSVVYAHSKE-.......-LITAWYIGFLVLI.FASFLV...........................
ENSCJAP00000021515  ...........LGSVVFIHRQE-.......-LITTLYIGFLGLI.FSSYFV...........................
ENSCJAP00000018413  ...........VVNALVGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000036144  ...........VVNALLGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000018484  ...........VVNALVGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000018438  ...........VVNALVGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000034755  ...........VVETLMSSLKP-.......-IGNIVVICCAFFI.IFGILG...........................
ENSCJAP00000011266  ...........VVNALVGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000034722  ...........VVETLMSSLKP-.......-IGNIVVICCAFFI.IFGILG...........................
ENSCJAP00000011510  ...........VVNALLGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000011251  ...........VVNALLGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000011518  ...........VVNALLGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000011461  ...........VVNALLGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000035750  ...........YGAAV-------.......-LVLLVCVFGLVAH.WLACIW...........................
ENSCJAP00000011705  ...........VVNALLGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000024714  ...........LGYTLKSCASE-.......-LGFLLFSLTMAII.IFATVM...........................
ENSCJAP00000032944  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IFSIFG...........................
ENSCJAP00000032952  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IFSIFG...........................
ENSCJAP00000032909  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IFSIFG...........................
ENSCJAP00000040782  ...........LGYTLKSCASE-.......-LGFLLFSLTMAII.IFATVM...........................
ENSCJAP00000011510  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYAIFG...........................
ENSCJAP00000011251  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYAIFG...........................
ENSCJAP00000011518  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYAIFG...........................
ENSCJAP00000011461  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYAIFG...........................
ENSCJAP00000035768  ...........YGAAV-------.......-LVLLVCVFGLVAH.WLACIW...........................
ENSCJAP00000038945  ...........YSAVV-------.......-LTLLMAVFALLAH.WVACIW...........................
ENSCJAP00000038937  ...........YSAVV-------.......-LTLLMAVFALLAH.WVACIW...........................
ENSCJAP00000024617  ...........VVETLISSLRP-.......-IGNIVLICCAFFI.IFGILG...........................
ENSCJAP00000011705  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYAIFG...........................
ENSCJAP00000035074  ...........RTNYP--NIFR-.......-ISNLVMYIVIIIH.WNACVF...........................
ENSCJAP00000035079  ...........RTNYP--NIFR-.......-ISNLVMYIVIIIH.WNACVF...........................
ENSCJAP00000008124  ...........LGSAICAHSKE-.......-LITAWYIGFLTLI.LSSFLV...........................
ENSCJAP00000011222  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYAIFG...........................
ENSCJAP00000011864  ...........VVNALIGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000011864  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYAIFG...........................
ENSCJAP00000024578  ...........LVTLLLDTLPM-.......-LGNVLLLCFFVFF.IFGIVG...........................
ENSCJAP00000018242  ...........LGSVVYAHSKE-.......-LITAWYIGFLVLI.FSSFLV...........................
ENSCJAP00000024617  ...........QLVVLVKTMDN-.......-VATFCTLLMLFIF.IFSILG...........................
ENSCJAP00000000792  ...........CSAVV-------.......-LTLLMSVFALLAH.WMACIW...........................
ENSCJAP00000008119  ...........LGSAICAHSKE-.......-LITAWYIGFLTLI.LSSFLV...........................
ENSCJAP00000014021  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000001539  ...........LLWTFIKSFQA-.......-LPYVALLIVMLFF.IYAVIG...........................
ENSCJAP00000006710  ...........HSTIV-------.......-LTLLMSMFALLAH.WMACIW...........................
ENSCJAP00000048898  ...........------------.......-VLTLLMSVFALLH.WMACIW...........................
ENSCJAP00000011266  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYAIFG...........................
ENSCJAP00000001544  ...........LLWTFIKSFQA-.......-LPYVALLIVMLFF.IYAVIG...........................
ENSCJAP00000018110  ...........VVNALIGAIPA-.......-ILNVLLVCLIFWL.IFCILG...........................
ENSCJAP00000008393  ...........LVVSLMSSMKS-.......-IISLLFLLFLFIV.VFALLG...........................
ENSCJAP00000018413  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYSIFG...........................
ENSCJAP00000008410  ...........LVVSLMSSMKS-.......-IISLLFLLFLFIV.VFALLG...........................
ENSCJAP00000018484  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYSIFG...........................
ENSCJAP00000018438  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYSIFG...........................
ENSCJAP00000018440  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYSIFG...........................
ENSCJAP00000014011  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000013976  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000050238  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000013508  ...........RTNYP--NIFR-.......-IGNLVLYILIIIH.WNACIY...........................
ENSCJAP00000050035  ...........RTNYP--NIFR-.......-IGNLVLYILIIIH.WNACIY...........................
ENSCJAP00000013510  ...........RTNYP--NIFR-.......-IGNLVLYILIIIH.WNACIY...........................
ENSCJAP00000013487  ...........RTNYP--NIFR-.......-IGNLVLYILIIIH.WNACIY...........................
ENSCJAP00000008406  ...........LVVSLMSSMKS-.......-IISLLFLLFLFIV.VFALLG...........................
ENSCJAP00000001452  ...........LLWTFIKSFQA-.......-LPYVALLIVMLFF.IYAVIG...........................
ENSCJAP00000007056  ...........RTSYP--NIFR-.......-ISNLVLYILVIIH.WNACIY...........................
ENSCJAP00000007061  ...........RTSYP--NIFR-.......-ISNLVLYILVIIH.WNACIY...........................
ENSCJAP00000024932  ...........LVVSLLNSMKS-.......-IISLLFLLFLFIV.VFALLG...........................
ENSCJAP00000024922  ...........LVVSLLNSMKS-.......-IISLLFLLFLFIV.VFALLG...........................
ENSCJAP00000005022  ...........VLNSIMKALVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000015533  ...........IFHMTYDLASAVv......RIFNLIGMMLLLCH.WDGCLQ...........................
ENSCJAP00000015531  ...........IFHMTYDLASAVv......RIFNLIGMMLLLCH.WDGCLQ...........................
ENSCJAP00000036148  ...........VVNALLGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000018471  ...........LLFALMMSLPA-.......-LFNIGLLLFLVMF.IYSIFG...........................
ENSCJAP00000036134  ...........VVNALLGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000051809  ...........LLWTFIKSFQA-.......-LPYVALLIAMLFF.IYAVIG...........................
ENSCJAP00000018440  ...........VVNALVGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000051772  ...........LLWTFIKSFQA-.......-LPYVALLIVMLFF.IYAVIG...........................
ENSCJAP00000001522  ...........LLWTFIKSFQA-.......-LPYVALLIVMLFF.IYAVIG...........................
ENSCJAP00000043192  ...........LLWTFIKSFQA-.......-LPYVALLIVMLFF.IYAVIG...........................
ENSCJAP00000002533  ...........IFHMTYDLASAVv......RIFNLIGMMLLLCH.WDGCLQ...........................
ENSCJAP00000008130  ...........LVVSLLNSMKS-.......-IISLLFLLFLFIV.VFALLG...........................
ENSCJAP00000014011  ...........LLWTFIKSFQA-.......-LPYVALLIAMLFF.IYAVIG...........................
ENSCJAP00000001328  ...........SNSIK-------.......-LVNLLSIFISTWL.TAAGFI...........................
ENSCJAP00000001906  ...........SNSIK-------.......-LVNLLSIFISTWL.TAAGFI...........................
ENSCJAP00000049896  ...........SNSIK-------.......-LVNLLSIFISTWL.TAAGFI...........................
ENSCJAP00000042093  ...........SNSIK-------.......-LVNLLSIFISTWL.TAAGFI...........................
ENSCJAP00000014021  ...........LLWTFIKSFQA-.......-LPYVALLIAMLFF.IYAVIG...........................
ENSCJAP00000013976  ...........LLWTFIKSFQA-.......-LPYVALLIAMLFF.IYAVIG...........................
ENSCJAP00000050238  ...........LLWTFIKSFQA-.......-LPYVALLIAMLFF.IYAVIG...........................
ENSCJAP00000024617  ...........LLDTVMQALPQ-.......-VGNLGLLFMLLFF.IYAALG...........................
ENSCJAP00000051772  ...........LVASLLNSVRS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000001522  ...........LVASLLNSVRS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000008352  ...........LVVSLMSSMKS-.......-IISLLFLLFLFIV.VFALLG...........................
ENSCJAP00000043192  ...........LVASLLNSVRS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000001452  ...........LVASLLNSVRS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000009758  ...........LVASLLNSVRS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000001424  ...........LVASLLNSVRS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000001424  ...........LLWTFIKSFQA-.......-LPYVALLIVMLFF.IYAVIG...........................
ENSCJAP00000009782  ...........LLWTFIKSFQA-.......-LPYVALLIVMLFF.IYAVIG...........................
ENSCJAP00000009782  ...........LVASLLNSIRS-.......-IASLLLLLFLFIV.IFALLG...........................
ENSCJAP00000008130  ...........LLWTFVQSFKA-.......-LPYVCLLIAMLFF.IYAIIG...........................
ENSCJAP00000005022  ...........LLWTFIKSFQA-.......-LPYVALLIAMIFF.IYAVIG...........................
ENSCJAP00000004594  ...........LGYTLKSCQSA-.......--------------.------...........................
ENSCJAP00000036717  ...........YGAAV-------.......-LFLLMCTFALIAH.WLACI-...........................
ENSCJAP00000001901  ...........SNSIK-------.......-LVNLLSIFISTWL.TAAGFI...........................
ENSCJAP00000034755  ...........LLDTVMQALPQ-.......-VGNLGLLFMLLFF.IFAALG...........................
ENSCJAP00000011864  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000005008  ...........LLWTFIKSFQA-.......-LPYVALLIAMIFF.IYAVIG...........................
ENSCJAP00000034722  ...........LLDTVMQALPQ-.......-VGNLGLLFMLLFF.IFAALG...........................
ENSCJAP00000034731  ...........LLDTVMQALPQ-.......-VGNLGLLFMLLFF.IFAALG...........................
ENSCJAP00000024932  ...........VFDCVVNSLKN-.......-VLNILIVYMLFMF.IFAVIA...........................
ENSCJAP00000024922  ...........VFDCVVNSLKN-.......-VLNILIVYMLFMF.IFAVIA...........................
ENSCJAP00000008393  ...........LLWTFVQSFKA-.......-LPYVCLLIAMLFF.IYAIIG...........................
ENSCJAP00000008406  ...........LLWTFVQSFKA-.......-LPYVCLLIAMLFF.IYAIIG...........................
ENSCJAP00000008410  ...........LLWTFVQSFKA-.......-LPYVCLLIAMLFF.IYAIIG...........................
ENSCJAP00000024922  ...........LLWTFVQSFKA-.......-LPYVCLLIAMLFF.IYAIIG...........................
ENSCJAP00000018110  ...........LLFALMMSLPS-.......-LFNIGLLLFLVMF.IYAILG...........................
ENSCJAP00000024932  ...........LLWTFVQSFKA-.......-LPYVCLLIAMLFF.IYAIIG...........................
ENSCJAP00000014011  ...........LVASLLNSMKS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000009782  ...........VLNSIFKAMLP-.......-LFHIALLVLFMVI.IYAIIG...........................
ENSCJAP00000008352  ...........VFDCVVTSLKN-.......-VFNILIVYKLFMF.IFAVIA...........................
ENSCJAP00000011251  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000011518  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000011461  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000009782  ...........VVQCMFVAIST-.......-IGNIVLVTTLLQF.MFACIG...........................
ENSCJAP00000032909  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000011510  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000051432  ...........LVASLLNSMKS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000011266  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000024922  ...........VLKSIMKAMVP-.......-LLQIGLLLFFAIL.MFAIIG...........................
ENSCJAP00000003065  ...........VTGTLGQSLPS-.......-IAAILILMFTCLL.LFSVVL...........................
ENSCJAP00000049104  ...........VTGTLGQSLPS-.......-IAAILILMFTCLL.LFSVVL...........................
ENSCJAP00000032944  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000032952  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000008393  ...........VLKSIMKAMVP-.......-LLQIGLLLFFAIL.MFAIIG...........................
ENSCJAP00000008406  ...........VLKSIMKAMVP-.......-LLQIGLLLFFAIL.MFAIIG...........................
ENSCJAP00000008410  ...........VLKSIMKAMVP-.......-LLQIGLLLFFAIL.MFAIIG...........................
ENSCJAP00000013976  ...........LVASLLNSMKS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000050238  ...........LVASLLNSMKS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000008406  ...........VFDCVVTSLKN-.......-VFNILIVYKLFMF.IFAVIA...........................
ENSCJAP00000008410  ...........VFDCVVTSLKN-.......-VFNILIVYKLFMF.IFAVIA...........................
ENSCJAP00000008393  ...........VFDCVVTSLKN-.......-VFNILIVYKLFMF.IFAVIA...........................
ENSCJAP00000051012  ...........LVASLLNSMKS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000011705  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000024932  ...........VLKSIMKAMVP-.......-LLQIGLLLFFAIL.MFAIIG...........................
ENSCJAP00000051772  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000014021  ...........LVASLLNSMKS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000001522  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000026361  ...........RTAYP--NAFR-.......-IAKLMLYIFVVIH.WNSCLY...........................
ENSCJAP00000023649  ...........LGQWGHIFHMTYdlasavmRICNLISMMLLLCH.WDGCLQ...........................
ENSCJAP00000043192  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000009758  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000001424  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000024617  ...........LCTAPPSLPHM-.......-QGESLSLCFFVFF.IFGIVG...........................
ENSCJAP00000051012  ...........LLWTFIKSFQA-.......-LPYVALLIAMLFF.IYAVIG...........................
ENSCJAP00000009776  ...........LVASLLNSIRS-.......-IASLLLLLFLFIV.IFALLG...........................
ENSCJAP00000047289  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000049465  ...........IVGALIQSVKK-.......-LADVMVLTVFCLS.VFALIG...........................
ENSCJAP00000011864  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000014011  ...........VVQCVFVAIRT-.......-IGNIMIVTTLLQF.MFACIG...........................
ENSCJAP00000013976  ...........VVQCVFVAIRT-.......-IGNIMIVTTLLQF.MFACIG...........................
ENSCJAP00000050238  ...........VVQCVFVAIRT-.......-IGNIMIVTTLLQF.MFACIG...........................
ENSCJAP00000014021  ...........VVQCVFVAIRT-.......-IGNIMIVTTLLQF.MFACIG...........................
ENSCJAP00000001452  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000051012  ...........VVQCVFVAIRT-.......-IGNIMIVTTLLQF.MFACIG...........................
ENSCJAP00000024578  ...........QLVVLVKTMDN-.......-VATFCTLLMLFIF.IFSILG...........................
ENSCJAP00000043192  ...........VVQCVFVAIRT-.......-IGNIVIVTTLLQF.MFACIG...........................
ENSCJAP00000001539  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000001452  ...........VVQCVFVAIRT-.......-IGNIVIVTTLLQF.MFACIG...........................
ENSCJAP00000001544  ...........VLNSIIKAMVP-.......-LLHIALLVLFVII.IYAIIG...........................
ENSCJAP00000051432  ...........VVQCVFVAIRT-.......-IGNIMIVTTLLQF.MFACIG...........................
ENSCJAP00000011693  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000032944  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000032952  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000032909  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000018413  ...........IVGALIQSVKK-.......-LADVMVLTVFCLS.VFALIG...........................
ENSCJAP00000018438  ...........IVGALIQSVKK-.......-LADVMVLTVFCLS.VFALIG...........................
ENSCJAP00000018440  ...........IVGALIQSVKK-.......-LADVMVLTVFCLS.VFALIG...........................
ENSCJAP00000005090  ...........SDSVK-------.......-FSKLLSVTLSTWF.TAAGVI...........................
ENSCJAP00000011860  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000051772  ...........VVQCVFVAIRT-.......-IGNIVIVTTLLQF.MFACIG...........................
ENSCJAP00000001522  ...........VVQCVFVAIRT-.......-IGNIVIVTTLLQF.MFACIG...........................
ENSCJAP00000009758  ...........VVQCVFVAIRT-.......-IGNIVIVTTLLQF.MFACIG...........................
ENSCJAP00000011461  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000008352  ...........LLWTFVQSFKA-.......-LPYVCLLIAMLFF.IYAIIG...........................
ENSCJAP00000036134  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000011251  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000011518  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000032944  ...........-VNALVGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000011705  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000018484  ...........IVGALIQSVKK-.......-LADVMVLTVFCLS.VFALIG...........................
ENSCJAP00000018413  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000036134  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALVG...........................
ENSCJAP00000000428  ...........HLESRMDKAYIY.......RVIRTTGYLLFILH.INACVY...........................
ENSCJAP00000018440  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000018484  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000018438  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000005022  ...........LVASLLNSMKS-.......-IASLLLLLFLFII.IFSLLG...........................
ENSCJAP00000018471  ...........VVDALVGAIPS-.......-IMNVLLVCLIFWL.IFSIMG...........................
ENSCJAP00000051432  ...........LLWTFIKSFQA-.......-LPYVALLIAMLFF.IYAVIG...........................
ENSCJAP00000011510  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000028522  ...........LFTTLVDLKWRW.......NLFIFILTYTVAWL.FMASMW...........................
ENSCJAP00000005008  ...........VVQCVFVAIRT-.......-IGNIMIVTTLLQF.MFACIG...........................
ENSCJAP00000008130  ...........VFDCVVNSLKN-.......-VFNILIVYMLFMF.IFAVVA...........................
ENSCJAP00000005022  ...........VVQCVFVAIRT-.......-IGNIMIVTTLLQF.MFACIG...........................
ENSCJAP00000036148  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000009776  ...........VLNSIFKAMLP-.......-LFHIALLVLFMVI.IYAIIG...........................
ENSCJAP00000018471  ...........IVGALIHSVKK-.......-LADVTILTIFCLS.VFALVG...........................
ENSCJAP00000036144  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALVG...........................
ENSCJAP00000018471  ...........LIKIIGNSVGA-.......-LGNLTIILAIIVF.VFALVG...........................
ENSCJAP00000036148  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALVG...........................
ENSCJAP00000001539  ...........LVASLLNSVRS-.......--------IALGMQ.LFGGKF...........................
ENSCJAP00000001544  ...........LVASLLNSVRS-.......--------IALGMQ.LFGGKF...........................
ENSCJAP00000015632  ...........MINDFHRAILRTqsamfn.QVLILFCTLLCLVF.TGTCGI...........................
ENSCJAP00000045673  sigalnkinfnTRFVMKTLMTIC.......PGTVLLVFSISLWI.IAAWTV...........................
ENSCJAP00000017214  sigalnkinfnTRFVMKTLMTIC.......PGTVLLVFSISLWI.IAAWTV...........................
ENSCJAP00000030676  sigalnkinfnTRFVMKTLMTIC.......PGTVLLVFSISLWI.IAAWTV...........................
ENSCJAP00000048251  sigalnkinfnTRFVMKTLMTIC.......PGTVLLVFSISLWI.IAAWTV...........................
ENSCJAP00000019483  ...........MINDFHRAILRTqsamfn.QVLILFCTLLCLVF.TGTCGI...........................
ENSCJAP00000017218  sigalnkinfnTRFVMKTLMTIC.......PGTVLLVFSISLWI.IAAWTV...........................
ENSCJAP00000031810  ...........KIRVIST-----.......-ILFILAGCIVFVT.IPAVIF...........................
ENSCJAP00000031809  ...........KIRVIST-----.......-ILFILAGCIVFVT.IPAVIF...........................
ENSCJAP00000031817  ...........KIRVIST-----.......-ILFILAGCIVFVT.IPAVIF...........................
ENSCJAP00000018110  ...........IVGALLRSVKK-.......-LINVIILTLFCLS.IFALVG...........................
ENSCJAP00000025797  ...........TRFVMKTLMTIC.......PGTVLLVFSISSWI.IAAWTV...........................
ENSCJAP00000047563  ...........TRFVMKTLMTIC.......PGTVLLVFSISSWI.IAAWTV...........................
ENSCJAP00000025796  ...........TRFVMKTLMTIC.......PGTVLLVFSISSWI.IAAWTV...........................
ENSCJAP00000036144  ...........LIKIIGNSVGA-.......-LGNLTLVLAIIVF.IFAVVG...........................
ENSCJAP00000001539  ...........VVQCVFVAIRT-.......-IGNIVIVTTLLQF.MFACIG...........................
ENSCJAP00000015636  ...........MINDLHRAIQRTqsamfn.QVLILISTLLCLIF.TCICGI...........................
ENSCJAP00000001544  ...........VVQCVFVAIRT-.......-IGNIVIVTTLLQF.MFACIG...........................
ENSCJAP00000044387  ...........LMLPLMLSLPA-.......-LLNLILLIFLVMF.IYAIFG...........................
ENSCJAP00000051406  ...........TRFVMKTLMTIC.......PGTVLLVFSISSWI.IAAWTV...........................
ENSCJAP00000017751  ...........IIRVILQSVPD-.......-LANIMVLILFFML.VFSVFG...........................
ENSCJAP00000001424  ...........VVQCVFVAIRT-.......-IGNIVIVTTLLQF.MFACIG...........................
ENSCJAP00000028312  ...........---TKIRIIS--.......TIIFILFGCVLFVA.LPAIIF...........................
ENSCJAP00000039183  ...........VVRELFSGFKE-.......-IFLVSILLLTLML.VFASFG...........................
ENSCJAP00000018110  ...........LIKIIGNSVGA-.......-LGSLTVVLAIVIF.IFSVAG...........................
ENSCJAP00000039178  ...........VVRELFSGFKE-.......-IFLVSILLLTLML.VFASFG...........................
ENSCJAP00000011922  ...........LMLPLMLSLPA-.......-LLNLILLIFLVMF.IYAIFG...........................
ENSCJAP00000007663  ...........------------.......--LSLIVCTFTYLL.VGAAVF...........................
ENSCJAP00000032603  ...........------------.......--LSLIVCTFTYLL.VGAAVF...........................
ENSCJAP00000009758  ...........LLWTFIKSFQA-.......-LPYVALLIVMLFF.IYAVIG...........................
ENSCJAP00000025602  ...........AWGILMDMRWRW.......MILVFSASFVVHWL.VFAVLW...........................
ENSCJAP00000048019  ...........------------.......-LVNLLSIFISTWL.TAAGFI...........................
ENSCJAP00000010880  ...........------------.......-VLPLLLAYVCYLL.LGATIF...........................
ENSCJAP00000028254  ...........-----IRIIST-.......-IIFILFGCVLFVA.LPAIIF...........................
ENSCJAP00000024637  ...........------MNTH--.......PGRLLLGLTLGLWL.TTAWVL...........................
ENSCJAP00000028292  ...........-----IRIIST-.......-IIFILFGCVLFVA.LPAIIF...........................
ENSCJAP00000021660  ...........LESVL-SKAYVY.......RVIRTTAYLLYSLH.LNSCLY...........................
ENSCJAP00000021649  ...........LESVL-SKAYVY.......RVIRTTAYLLYSLH.LNSCLY...........................
ENSCJAP00000028286  ...........-----IRIIST-.......-IIFILFGCVLFVA.LPAIIF...........................
ENSCJAP00000036223  ...........------------.......-GLCFLCFLVTYAL.VGAVLF...........................
ENSCJAP00000010869  ...........------------.......-VLPLLLAYVCYLL.LGATIF...........................
ENSCJAP00000044387  ...........VVRALIKTTLP-.......-TLNVFLVCLMIWL.TFSIMG...........................
ENSCJAP00000033717  ...........-----HRSAWC-.......-FGFLVLGYLLYLV.FGAVVF...........................
ENSCJAP00000000198  ...........IFTTCVDIRWRW.......MLVIFCLAFVLSWL.FFGCVF...........................
ENSCJAP00000051538  ...........IFTTCVDIRWRW.......MLVIFCLAFVLSWL.FFGCVF...........................
ENSCJAP00000011266  ...........IVGALIQSVKK-.......-LSDVMILTVFCLS.VFALIG...........................
ENSCJAP00000036144  ...........RKFRHKQVNHA-.......AVLSLSLSLSLYIY.IYIYIY...........................
ENSCJAP00000031810  ...........-------VMKWK.......TVVAIFVVVVVYLV.SGGLVF...........................
ENSCJAP00000031809  ...........-------VMKWK.......TVVAIFVVVVVYLV.SGGLVF...........................
ENSCJAP00000031817  ...........-------VMKWK.......TVVAIFVVVVVYLV.SGGLVF...........................
ENSCJAP00000004803  ...........IILALVRALKSM.......TFLLILLLIFFYIF.AVAGVY...........................
ENSCJAP00000011922  ...........VVRALIKTTLP-.......-TLNVFLVCLMIWL.TFSIMG...........................
ENSCJAP00000010847  ...........------------.......--VLLLLAYLAYLA.LGTGVF...........................
ENSCJAP00000010844  ...........------------.......--VLLLLAYLAYLA.LGTGVF...........................
ENSCJAP00000034853  ...........MFTTCVDIRWRY.......MLLIFSLAFLASWL.LFGIIF...........................
ENSCJAP00000004793  ...........IILALVRALKSM.......TFLLILLLIFFYIF.AVAGVY...........................
ENSCJAP00000007663  ...........----------EN.......MVTVGFFSCMGTLC.IGAAAF...........................
ENSCJAP00000032603  ...........----------EN.......MVTVGFFSCMGTLC.IGAAAF...........................
ENSCJAP00000042788  ...........---------KWK.......TVSTIFLVVVLYLI.IGATVF...........................
ENSCJAP00000033365  ...........--------MRST.......TLLALLALVLLYLV.SGALVF...........................
ENSCJAP00000004804  ...........IILALVRALKSM.......TFLLILLLIFFYIF.AVAGVY...........................
ENSCJAP00000028286  ...........---------KWK.......TVSTIFLVVVLYLI.IGATVF...........................
ENSCJAP00000028292  ...........---------KWK.......TVSTIFLVVVLYLI.IGATVF...........................
ENSCJAP00000025789  ...........TRFVMKTLMTIC.......PGTVLLVFSISSWI.IAAWTV...........................
ENSCJAP00000028254  ...........---------KWK.......TVSTIFLVVVLYLI.IGATVF...........................
ENSCJAP00000033361  ...........------------.......-LLALLALVLLYLV.SGALVF...........................
ENSCJAP00000016635  ...........LFTTLVDLKWRF.......NLLVFTMVYTVTWL.FFGFIW...........................
ENSCJAP00000044520  ...........LFTTLVDLKWRF.......NLLVFTMVYTVTWL.FFGFIW...........................
ENSCJAP00000004712  ...........IFTTLVDLKWRF.......NLLIFVMVYTVTWL.FFGMIW...........................
ENSCJAP00000004717  ...........IFTTLVDLKWRF.......NLLIFVMVYTVTWL.FFGMIW...........................
ENSCJAP00000033717  ...........QVVAIVH-----.......AVLLGFVTVSCFFF.IPAAVF...........................
ENSCJAP00000028312  ...........---------KWK.......TVSTIFLVVVLYLI.IGATVF...........................
ENSCJAP00000000665  ...........LFTTCVDVRWRW.......MCLLFSCSFLASWL.LFGLAF...........................
ENSCJAP00000010822  ...........RGVSLRKAQITC.......TVIFIVWGVLVHLV.IPPFVF...........................
ENSCJAP00000011922  ...........LMWSLSNSWVA-.......-LKDLVLLLFTFIF.FSAAFG...........................
ENSCJAP00000030680  ...........------------.......--------------.----LA...........................
ENSCJAP00000036134  ...........PSHHLFSHLPQWwhp....RYLLTVGLGLSDLN.QKYFVY...........................
ENSCJAP00000036148  ...........HVGPL--PQWWHp......RYLLTVGLGLSDLN.QKYFVY...........................
ENSCJAP00000041691  ...........IFTTLVDTKWRH.......MFVIFSLSYILSWL.IFGSVF...........................
ENSCJAP00000043961  ...........IFTTLVDTKWRH.......MFVIFSLSYILSWL.IFGSVF...........................
ENSCJAP00000050339  ...........IFTTLVDTKWRH.......MFVIFSLSYILSWL.IFGSVF...........................
ENSCJAP00000032611  ...........------------.......-FLLLAALIVLYLL.GGAAVF...........................
ENSCJAP00000036223  ...........------------.......PLPIVVLIVFAYIS.CAAAIL...........................
ENSCJAP00000006678  ...........------------.......-------MFALLAH.WMACIW...........................
ENSCJAP00000002449  ...........---------MAN.......MVLIGFFSCISTLC.IGAAAF...........................
ENSCJAP00000028533  ...........LFTTLVDLKWRW.......NLFIFILTYTVAWL.FMASMW...........................
ENSCJAP00000008130  ...........VLKSIMKAMIP-.......-LLQIGLLLFFAIL.IFAIIGlefymgkfhttcfeegtddiqsespap
ENSCJAP00000033335  ...........MTYDLASAVVR-.......-IVNLIGMMLLLCH.WDGCLQ...........................
ENSCJAP00000044017  ...........IIRVILQSVPD-.......-LANIMVLILFFML.HF----...........................
ENSCJAP00000002449  ...........------------.......--------------.------...........................
ENSCJAP00000008352  ...........VLKSIMKAMVP-.......-LLQIGLLLFFAIL.MFAIIG...........................
ENSCJAP00000010847  ...........---------WLA.......GSGALLSGLLLFLL.LPPLLF...........................
ENSCJAP00000010844  ...........---------WLA.......GSGALLSGLLLFLL.LPPLLF...........................
ENSCJAP00000032608  ...........-----------V.......RAAGLVLCTLCYRL.VGAAVF...........................
ENSCJAP00000001064  ...........------------.......-YVVLAALIGLYLV.AGATVF...........................
ENSCJAP00000044773  ...........LWTTFIDMQWRY.......KLLLFSATFAGTWF.LFGVVW...........................
ENSCJAP00000015112  ...........LWTTVIDMKWRY.......KLTLFAATFVMTWF.LFGVIY...........................
ENSCJAP00000042307  ...........LWTTVIDMKWRY.......KLTLFAATFVMTWF.LFGVIY...........................
ENSCJAP00000044603  ...........LWTTVIDMKWRY.......KLTLFAATFVMTWF.LFGVIY...........................
ENSCJAP00000032611  ...........------------.......-MLILCTASVLISC.CASAMY...........................
ENSCJAP00000024941  ...........--WDPWRAARWH.......LVALLGVVVTICFL.VPAVIF...........................
ENSCJAP00000039178  ...........FVYKIFGPGKKG.......SLVVFTSLLIVMSA.ISLQMF...........................
ENSCJAP00000010822  ...........------------.......--------------.------...........................
ENSCJAP00000010657  ...........MISAMRQTVYT-.......-VASVLLLLFLLMY.IFGILG...........................
ENSCJAP00000045969  ...........LVGVLICCVKK-.......-LTGVIILTLFFLS.IFSLIG...........................
ENSCJAP00000010880  ...........-----------G.......LALFLTLGTLVILI.FPPMVF...........................
ENSCJAP00000047810  ...........MISAMRQTVYT-.......-VASVLLLLFLLMY.IFGILG...........................
ENSCJAP00000032608  ...........------------.......LVVAGLLACATTLA.LGAVAF...........................
ENSCJAP00000024941  ...........------------.......-----LAAYTAYMV.RGALLV...........................
ENSCJAP00000016592  ...........IWTTILDLKWRY.......KMTIFITAFLGSWF.FFGLLW...........................
ENSCJAP00000001064  ...........----------V-.......-LLILGLFAVLLSC.CASAMY...........................
ENSCJAP00000039183  ...........FVYKIFGPGKK-.......-AGELLPSLLIVMSaISLQMF...........................
ENSCJAP00000029287  ...........VASTVLGLVQN-.......-MRAFGGILVVVYY.VFAIIG...........................
ENSCJAP00000010869  ...........-----------G.......LALFLTLGTLVILI.FPPMVF...........................
ENSCJAP00000003851  ...........---------PWA.......RYGLLVVGHLLALG.LGATVF...........................
ENSCJAP00000018351  ...........VLDTMFELLPR-.......-MASLGLTLLIFYY.SFAIVG...........................
ENSCJAP00000011922  ...........LVGVLICCVKK-.......-LTGVIILTLFFLS.IFSLIG...........................
ENSCJAP00000039178  ...........ITNILKRSGEQ-.......-IWSVSIFLLFFLL.LYGILG...........................
ENSCJAP00000034731  ...........----------P-.......-IGNIVVICCAFFI.IFGILG...........................
ENSCJAP00000011191  ...........------------.......--------------.------...........................
ENSCJAP00000040639  ...........------------.......--------------.------...........................
ENSCJAP00000000427  ...........------------.......--------------.------...........................
ENSCJAP00000039183  ...........LLLTVVVSMYK-.......-SFFIIVGMFLLLL.CYAFAG...........................
ENSCJAP00000009758  ...........------------.......--------------.------...........................
ENSCJAP00000039178  ...........LLLTVVVSMYK-.......-SFFIIVGMFLLLL.CYAFAG...........................
ENSCJAP00000043591  ...........------------.......--------------.------...........................
ENSCJAP00000018307  ...........VLDTMFELLPR-.......-MASLGLTLLIFYY.SFAIVG...........................
ENSCJAP00000003851  ...........------------.......-PARAILLQAVFVL.LPALVL...........................
ENSCJAP00000018358  ...........VLDTMFELLPR-.......-MASLGLTLLIFYY.SFAIVG...........................
ENSCJAP00000016835  ...........------------.......--------------.------...........................
ENSCJAP00000016824  ...........------------.......--------------.------...........................
ENSCJAP00000018307  ...........NLRQIFQSLPP-.......-FMDILLLLLFFMI.IFAILG...........................
ENSCJAP00000018358  ...........NLRQIFQSLPP-.......-FMDILLLLLFFMI.IFAILG...........................
ENSCJAP00000023858  ...........------------.......--STLWLLVGLSVH.VVAVML...........................
ENSCJAP00000023857  ...........------------.......--STLWLLVGLSVH.VVAVML...........................
ENSCJAP00000011719  ...........LSTTMSRCAKD-.......-LFGFAIMFFIIFL.AYAQLA...........................
ENSCJAP00000023869  ...........------------.......--STLWLLVGLSVH.VVAVML...........................
ENSCJAP00000011724  ...........LSTTMSRCAKD-.......-LFGFAIMFFIIFL.AYAQLA...........................
ENSCJAP00000031891  ...........LSSTLARCAKD-.......-ILGFAVMFFIVFF.AYAQLG...........................
ENSCJAP00000032813  ...........LIRRLVSENKR-.......--------------.------...........................
ENSCJAP00000018176  ...........------------.......-AYIGVSVVLFLVS.RFSPYE...........................
ENSCJAP00000029682  ...........------------.......-----VSVVLFLVS.RFSPYE...........................
ENSCJAP00000029731  ...........------------.......-----VSVVLFLVS.RFSPYE...........................
ENSCJAP00000029720  ...........------------.......-----VSVVLFLVS.RFSPYE...........................
ENSCJAP00000029725  ...........------------.......-----VSVVLFLVS.RFSPYE...........................
ENSCJAP00000016830  ...........------------.......--------------.------...........................
ENSCJAP00000026317  ...........------------.......--------------.------...........................
ENSCJAP00000031883  ...........LSSTLARCAKD-.......-ILGFAVMFFIVFF.AYAQLG...........................
ENSCJAP00000008550  ...........------------.......-------MCIVFAY.IGVSVV...........................
ENSCJAP00000008592  ...........------------.......-------MCIVFAY.IGVSVV...........................
ENSCJAP00000019881  ...........------------.......--------------.------...........................
ENSCJAP00000018165  ...........------------.......-AYIGVSVVLFLVS.RFSPYE...........................
ENSCJAP00000008585  ...........------------.......-------MCIVFAY.IGVSVV...........................
ENSCJAP00000051777  ...........------------.......-------MCIVFAY.IGVSVV...........................
ENSCJAP00000008594  ...........------------.......-------MCIVFAY.IGVSVV...........................
ENSCJAP00000043053  ...........------------.......-------MCIVFAY.IGVSVV...........................
ENSCJAP00000018166  ...........------------.......-------MCIVFAY.IGVSVV...........................
ENSCJAP00000043051  ...........ISRTLSRAWDE-.......-VLGFLLIILILLT.GYAIAF...........................


                                                                                                    
                                                                                                    
d1orqc_               .................YI......VEYPD................................................
ENSCJAP00000001034  .................YF......AEADN................................................
ENSCJAP00000006275  .................YF......AEADD................................................
ENSCJAP00000011257  .................YF......AEADE................................................
ENSCJAP00000051240  .................YF......AEADE................................................
ENSCJAP00000040816  .................YF......AEADD................................................
ENSCJAP00000041201  .................FF......AEKDE................................................
ENSCJAP00000041491  .................YT......MEQSH................................................
ENSCJAP00000000350  .................YF......AEVDR................................................
ENSCJAP00000002245  .................YY......AERVGaqpndpsas.......................................
ENSCJAP00000006280  .................YF......AEADE................................................
ENSCJAP00000000354  .................YF......AEVDR................................................
ENSCJAP00000002246  .................YY......AERVGaqpndpsas.......................................
ENSCJAP00000002252  .................YY......AERVGaqpndpsas.......................................
ENSCJAP00000043218  .................YY......AERVGaqpndpsas.......................................
ENSCJAP00000002244  .................YY......AERVGaqpndpsas.......................................
ENSCJAP00000006178  .................YY......AERIGarpsdprgn.......................................
ENSCJAP00000006190  .................YY......AERIGarpsdprgn.......................................
ENSCJAP00000011362  .................YF......AEQSI................................................
ENSCJAP00000042235  .................YF......AEQSI................................................
ENSCJAP00000006168  .................YY......AERIGarpsdprgn.......................................
ENSCJAP00000020121  .................YS......VEYDV................................................
ENSCJAP00000006183  .................YY......AERIGaqpndpsas.......................................
ENSCJAP00000013687  .................YS......VEKDD................................................
ENSCJAP00000007967  .................YY......AERIGadpddilgs.......................................
ENSCJAP00000013573  .................YY......AERIGaqpndpsas.......................................
ENSCJAP00000020116  .................YS......VEYDV................................................
ENSCJAP00000028718  .................YT......IEKEE................................................
ENSCJAP00000000985  .................YV......IENEM................................................
ENSCJAP00000049469  .................YV......IENEM................................................
ENSCJAP00000014952  .................YT......AEKE-................................................
ENSCJAP00000032384  .................YT......AEKE-................................................
ENSCJAP00000007249  .................YV......AEKES................................................
ENSCJAP00000027043  .................QL......LEHGLdlet............................................
ENSCJAP00000050058  .................YA......IGNMEqphvdsrigwlhnlgdqigkpynssglg....................
ENSCJAP00000037509  .................YA......IGNMEqphvdsrigwlhnlgdqigkpynssglg....................
ENSCJAP00000014024  .................YA......IGNMEqphvdsrigwlhnlgdqigkpynssglg....................
ENSCJAP00000037518  .................YA......IGNMEqphvdsrigwlhnlgdqigkpynssglg....................
ENSCJAP00000037477  .................YA......IGNMEqphvdsrigwlhnlgdqigkpynssglg....................
ENSCJAP00000037521  .................YA......IGNMEqphvdsrigwlhnlgdqigkpynssglg....................
ENSCJAP00000018246  .................YL......VEKDA................................................
ENSCJAP00000011046  .................YA......IGNVErpylehkigwldslgvqlgkryngsdpas...................
ENSCJAP00000036726  .................YA......IGNVErpylehkigwldslgvqlgkryngsdpas...................
ENSCJAP00000003807  .................YA......IGNVErpylehkigwldslgvqlgkryngsdpas...................
ENSCJAP00000011055  .................YA......IGNVErpyltdkigwldslgqqigkryndsdsss...................
ENSCJAP00000035788  .................YS......IGDYEvidevtntiqidswlyqlalsigtpyryntsagiweg...........
ENSCJAP00000035791  .................YS......IGDYEvidevtntiqidswlyqlalsigtpyryntsagiweg...........
ENSCJAP00000035786  .................YS......IGDYEvidevtntiqidswlyqlalsigtpyryntsagiweg...........
ENSCJAP00000035785  .................YS......IGDYEvidevtntiqidswlyqlalsigtpyryntsagiweg...........
ENSCJAP00000005433  .................YL......AEKDA................................................
ENSCJAP00000018820  .................YL......AEKG-................................................
ENSCJAP00000032952  .................VN......LFAGKyhycfnetseirfeiedvnnkteceklmeg..................
ENSCJAP00000032909  .................VN......LFAGKyhycfnetseirfeiedvnnkteceklmeg..................
ENSCJAP00000005420  .................YL......AEKDA................................................
ENSCJAP00000021515  .................YL......AEKDAvnes............................................
ENSCJAP00000018413  .................VN......LFAGKfgrcinqtegdlplnytivnnksqceslnmtgelywtk..........
ENSCJAP00000036144  .................VN......LFAGKfyycintttserfdisevnnkseceslmhtgqvrwln...........
ENSCJAP00000018484  .................VN......LFAGKfgrcinqtegdlplnytivnnksqceslnmtgelywtk..........
ENSCJAP00000018438  .................VN......LFAGKfgrcinqtegdlplnytivnnksqceslnmtgelywtk..........
ENSCJAP00000034755  .................VQ......LFKGKffvcqgedtrnitnksdcaeasyrwvr.....................
ENSCJAP00000011266  .................VN......LFAGKfyhcvnmttgnmfnvsevnnfsdcqalgkqarwkn.............
ENSCJAP00000034722  .................VQ......LFKGKffvcqgedtrnitnksdcaeasyrwvr.....................
ENSCJAP00000011510  .................VN......LFAGKfyhcinyttgemfdvsvvnnyseckaliesnqtarwkn..........
ENSCJAP00000011251  .................VN......LFAGKfyhcinyttgemfdvsvvnnyseckaliesnqtarwkn..........
ENSCJAP00000011518  .................VN......LFAGKfyhcinyttgemfdvsvvnnyseckaliesnqtarwkn..........
ENSCJAP00000011461  .................VN......LFAGKfyhcinyttgemfdvsvvnnyseckaliesnqtarwkn..........
ENSCJAP00000035750  .................YS......IGDYEvidevtntiqidswlyqlalsigtpyryntsagiweg...........
ENSCJAP00000011705  .................VN......LFAGKfyhcintttgdrfdveevnnhsdclkliernetarwkn..........
ENSCJAP00000024714  .................FY......AEKGS................................................
ENSCJAP00000032944  .................MS......NFAYV................................................
ENSCJAP00000032952  .................MS......NFAYV................................................
ENSCJAP00000032909  .................MS......NFAYV................................................
ENSCJAP00000040782  .................FY......AEKGS................................................
ENSCJAP00000011510  .................MS......NFAYV................................................
ENSCJAP00000011251  .................MS......NFAYV................................................
ENSCJAP00000011518  .................MS......NFAYV................................................
ENSCJAP00000011461  .................MS......NFAYV................................................
ENSCJAP00000035768  .................YS......IGDYEvidevtntiqidswlyqlalsigtpyryntsagiweg...........
ENSCJAP00000038945  .................FY......IGQREiesseselpeigwlqelarrletpyylvgrspaggnsssqsdncssss
ENSCJAP00000038937  .................FY......IGQREiesseselpelgwlqelarrletpyylvgrspaggnsssqsdneangt
ENSCJAP00000024617  .................VQ......LFKGKfyycegadtrnistkaecraahyrwvr.....................
ENSCJAP00000011705  .................MS......NFAYV................................................
ENSCJAP00000035074  .................YS......ISKAIgfgndtwvypdindpe................................
ENSCJAP00000035079  .................YS......ISKAIgfgndtwvypdindpe................................
ENSCJAP00000008124  .................YL......VEKDV................................................
ENSCJAP00000011222  .................MS......NFAYV................................................
ENSCJAP00000011864  .................VN......LFAGKfyecinttdgsrfpasqvpnrsecfalmnv..................
ENSCJAP00000011864  .................MS......NFAYV................................................
ENSCJAP00000024578  .................VQ......LWAGLlrnrcfldsafvrnnnltflrpyyqteegeenpficssrrdngmqkcs
ENSCJAP00000018242  .................YL......VEKDA................................................
ENSCJAP00000024617  .................MH......LFGCKfslqtdsgdtvp....................................
ENSCJAP00000000792  .................YV......IGRREmeandpllwdigwlhelgkrlevpyvngsvg.................
ENSCJAP00000008119  .................YL......VEKDV................................................
ENSCJAP00000014021  .................LE......LFIGKmhktcffadsdivaeedpapcafsgngrqctangtecrsgwvgpng..
ENSCJAP00000001539  .................MQ......VFGKIalndttein.......................................
ENSCJAP00000006710  .................YV......IGKMErednsllkwevgwlhelgkrlespyygnntlg................
ENSCJAP00000048898  .................YV......IGRREmeaqetlhppagwlhelgkrlevpyvngsvg.................
ENSCJAP00000011266  .................MS......NFAYV................................................
ENSCJAP00000001544  .................MQ......VFGKIalndttein.......................................
ENSCJAP00000018110  .................VY......FFSGKfwrcingtdsvinytivpnknqcesgnfswln................
ENSCJAP00000008393  .................MQ......LFGGRfnfndgt.........................................
ENSCJAP00000018413  .................MA......NFAYVkweagi..........................................
ENSCJAP00000008410  .................MQ......LFGGRfnfndgt.........................................
ENSCJAP00000018484  .................MA......NFAYVkweagi..........................................
ENSCJAP00000018438  .................MA......NFAYVkweagi..........................................
ENSCJAP00000018440  .................MA......NFAYVkweagi..........................................
ENSCJAP00000014011  .................LE......LFIGKmhktcffadsdivaeedpapcafsgngrqctangtecrsgwvgpng..
ENSCJAP00000013976  .................LE......LFIGKmhktcffadsdivaeedpapcafsgngrqctangtecrsgwvgpng..
ENSCJAP00000050238  .................LE......LFIGKmhktcffadsdivaeedpapcafsgngrqctangtecrsgwvgpng..
ENSCJAP00000013508  .................FA......ISKFIgfgtdswvypnisipe................................
ENSCJAP00000050035  .................FA......ISKFIgfgtdswvypnisipe................................
ENSCJAP00000013510  .................FA......ISKFIgfgtdswvypnisipe................................
ENSCJAP00000013487  .................FA......ISKFIgfgtdswvypnisipe................................
ENSCJAP00000008406  .................MQ......LFGGRfnfndgt.........................................
ENSCJAP00000001452  .................MQ......VFGKIalndttein.......................................
ENSCJAP00000007056  .................YA......ISKSIgfgvdtwvypnitdpe................................
ENSCJAP00000007061  .................YA......ISKSIgfgvdtwvypnitdpe................................
ENSCJAP00000024932  .................MQ......LFGGQfnfqdet.........................................
ENSCJAP00000024922  .................MQ......LFGGQfnfqdet.........................................
ENSCJAP00000005022  .................LE......LFLGRmhktcyflgsdveaeedpspcassgsgractmnqtecrgrwpgpng..
ENSCJAP00000015533  .................FL......VPMLQdfppdcwvsinhmv..................................
ENSCJAP00000015531  .................FL......VPMLQdfppdcwvsinhmv..................................
ENSCJAP00000036148  .................VN......LFAGKfyycintttserfdisevnnkseceslmhtgqvrwln...........
ENSCJAP00000018471  .................MTsfphvrWEAGI................................................
ENSCJAP00000036134  .................VN......LFAGKfyycintttserfdisevnnkseceslmhtgqvrwln...........
ENSCJAP00000051809  .................MQ......MFGKVamkdnnqin.......................................
ENSCJAP00000018440  .................VN......LFAGKfgrcinqtegdlplnytivnnksqceslnmtgelywtkvkvnfdnvga
ENSCJAP00000051772  .................MQ......VFGKIalndttein.......................................
ENSCJAP00000001522  .................MQ......VFGKIalndttein.......................................
ENSCJAP00000043192  .................MQ......VFGKIalndttein.......................................
ENSCJAP00000002533  .................FL......VPLLQdfppdcwvslnemv..................................
ENSCJAP00000008130  .................MQ......LFGGQfnfdegt.........................................
ENSCJAP00000014011  .................MQ......MFGKVamkdnnqin.......................................
ENSCJAP00000001328  .................HL......VENSG................................................
ENSCJAP00000001906  .................HL......VENSG................................................
ENSCJAP00000049896  .................HL......VENSG................................................
ENSCJAP00000042093  .................HL......VENSG................................................
ENSCJAP00000014021  .................MQ......MFGKVamkdnnqin.......................................
ENSCJAP00000013976  .................MQ......MFGKVamkdnnqin.......................................
ENSCJAP00000050238  .................MQ......MFGKVamkdnnqin.......................................
ENSCJAP00000024617  .................VE......LFGRLecsednpcegls....................................
ENSCJAP00000051772  .................MQ......LFGGK................................................
ENSCJAP00000001522  .................MQ......LFGGK................................................
ENSCJAP00000008352  .................MQ......LFGGRfnfndgt.........................................
ENSCJAP00000043192  .................MQ......LFGGK................................................
ENSCJAP00000001452  .................MQ......LFGGK................................................
ENSCJAP00000009758  .................MQ......LFGGK................................................
ENSCJAP00000001424  .................MQ......LFGGK................................................
ENSCJAP00000001424  .................MQ......VFGKIalndttein.......................................
ENSCJAP00000009782  .................MQ......MFGKIalvdgtqin.......................................
ENSCJAP00000009782  .................MQ......LFGGR................................................
ENSCJAP00000008130  .................MQ......VFGNIgidvededsdeddfqit...............................
ENSCJAP00000005022  .................MQ......MFGKValqdgtqin.......................................
ENSCJAP00000004594  .................--......-----................................................
ENSCJAP00000036717  .................--......-----................................................
ENSCJAP00000001901  .................HL......VENSG................................................
ENSCJAP00000034755  .................VE......LFGDLecdethpceglg....................................
ENSCJAP00000011864  .................LQ......LFMGNlkhkcfrdslennetlesimdtledeedfrkyfyylegskdallcgfs
ENSCJAP00000005008  .................MQ......ASMFGkvalqdgtqin.....................................
ENSCJAP00000034722  .................VE......LFGDLecdethpceglg....................................
ENSCJAP00000034731  .................VE......LFGDLecdethpceglg....................................
ENSCJAP00000024932  .................VQ......LFKGKffyctdeskelerdcrgqyldyekeeveaqprqwkk............
ENSCJAP00000024922  .................VQ......LFKGKffyctdeskelerdcrgqyldyekeeveaqprqwkk............
ENSCJAP00000008393  .................MQ......VFGNIkldeeshin.......................................
ENSCJAP00000008406  .................MQ......VFGNIkldeeshin.......................................
ENSCJAP00000008410  .................MQ......VFGNIkldeeshin.......................................
ENSCJAP00000024922  .................MQ......VFGNIaldddtsin.......................................
ENSCJAP00000018110  .................MN......WFSKV................................................
ENSCJAP00000024932  .................MQ......VFGNIaldddtsin.......................................
ENSCJAP00000014011  .................MQ......LFGGK................................................
ENSCJAP00000009782  .................LE......LFKGKmhktcyftgtdivatveneepspcartgsgrrctingsecqggwpgpn
ENSCJAP00000008352  .................VQ......LFKGKffyctdsskdtekecignyvdheknkmevkgrewkr............
ENSCJAP00000011251  .................MQ......LFGKSykecvckisndcelprwhmhdffhsflivfrvl...............
ENSCJAP00000011518  .................MQ......LFGKSykecvckisndcelprwhmhdffhsflivfrvl...............
ENSCJAP00000011461  .................MQ......LFGKSykecvckisndcelprwhmhdffhsflivfrvl...............
ENSCJAP00000009782  .................VQ......LFKGKffrctdlskmteeecrgyyyvykdgdpeqielhhrewvh.........
ENSCJAP00000032909  .................MQ......LFGKSykecvckinqdcelprwhmhdffhsflivfrvl...............
ENSCJAP00000011510  .................MQ......LFGKSykecvckisndcelprwhmhdffhsflivfrvl...............
ENSCJAP00000051432  .................MQ......LFGGK................................................
ENSCJAP00000011266  .................MQ......LFGKSykecvckinddctlprwhmndffhsflivfrvl...............
ENSCJAP00000024922  .................LE......FYMGKfhkacfpnstdaepvgdfpcgkeaparlcegdtecreywpgpnf....
ENSCJAP00000003065  .................RA......LFLKS................................................
ENSCJAP00000049104  .................RA......LFLKS................................................
ENSCJAP00000032944  .................MQ......LFGKSykecvckinqdcelprwhmhdffhsflivfrvl...............
ENSCJAP00000032952  .................MQ......LFGKSykecvckinqdcelprwhmhdffhsflivfrvl...............
ENSCJAP00000008393  .................LE......FYSGKlhracfmnnsgilegfdpphpcgvqgcpagyeckdwigpnd.......
ENSCJAP00000008406  .................LE......FYSGKlhracfmnnsgilegfdpphpcgvqgcpagyeckdwigpnd.......
ENSCJAP00000008410  .................LE......FYSGKlhracfmnnsgilegfdpphpcgvqgcpagyeckdwigpnd.......
ENSCJAP00000013976  .................MQ......LFGGK................................................
ENSCJAP00000050238  .................MQ......LFGGK................................................
ENSCJAP00000008406  .................VQ......LFKGKffyctdsskdtekecignyvdheknkmevkgrewkr............
ENSCJAP00000008410  .................VQ......LFKGKffyctdsskdtekecignyvdheknkmevkgrewkr............
ENSCJAP00000008393  .................VQ......LFKGKffyctdsskdtekecignyvdheknkmevkgrewkr............
ENSCJAP00000051012  .................MQ......LFGGK................................................
ENSCJAP00000011705  .................MQ......LFGKSykdcvckiasdcqlprwhmndffhsflivfrvl...............
ENSCJAP00000024932  .................LE......FYMGKfhkacfpnstdaepvgdfpcgkeaparlcegdtecreywpgpnf....
ENSCJAP00000051772  .................LE......LFMGKmhktcynqegiadvpaeddpspcaletghgrqcqngtvcrpgwdgpkh
ENSCJAP00000014021  .................MQ......LFGGK................................................
ENSCJAP00000001522  .................LE......LFMGKmhktcynqegiadvpaeddpspcaletghgrqcqngtvcrpgwdgpkh
ENSCJAP00000026361  .................FA......LSRYLgfgrdvwvypdpaqpg................................
ENSCJAP00000023649  .................FL......VPMLQdfprncwvsingmv..................................
ENSCJAP00000043192  .................LE......LFMGKmhktcynqegiadvpaeddpspcaletghgrqcqngtvcrpgwdgpkh
ENSCJAP00000009758  .................LE......LFMGKmhktcynqegiadvpaeddpspcaletghgrqcqngtvcrpgwdgpkh
ENSCJAP00000001424  .................LE......LFMGKmhktcynqegiadvpaeddpspcaletghgrqcqngtvcrpgwdgpkh
ENSCJAP00000024617  .................VQ......LWAGLlrnrcfldsafvrnnnltflrpyyqteegeenpficssrrdngmqkcs
ENSCJAP00000051012  .................MQ......MFGKVamkdnnqin.......................................
ENSCJAP00000009776  .................MQ......LFGGR................................................
ENSCJAP00000047289  .................LQ......LFMGNlkhkcfrdslennetlerngtkgtnwfilknnrkyfyylegskdallc
ENSCJAP00000049465  .................LQ......LFMGNlrhkcvrnftalngtngsveadgsvwesldlylsdpenyllkngtsdv
ENSCJAP00000011864  .................MQ......LFGKSykecvckinddctlprwhmndffhsflivfrvl...............
ENSCJAP00000014011  .................VQ......LFKGKfyrctdeaksnpeecrglfilykdgdvdspvvreriwqn.........
ENSCJAP00000013976  .................VQ......LFKGKfyrctdeaksnpeecrglfilykdgdvdspvvreriwqn.........
ENSCJAP00000050238  .................VQ......LFKGKfyrctdeaksnpeecrglfilykdgdvdspvvreriwqn.........
ENSCJAP00000014021  .................VQ......LFKGKfyrctdeaksnpeecrglfilykdgdvdspvvreriwqn.........
ENSCJAP00000001452  .................LE......LFMGKmhktcynqegiadvpaeddpspcaletghgrqcqngtvcrpgwdgpkh
ENSCJAP00000051012  .................VQ......LFKGKfyrctdeaksnpeecrglfilykdgdvdspvvreriwqn.........
ENSCJAP00000024578  .................MH......LFGCKfslqtdsg........................................
ENSCJAP00000043192  .................VQ......LFKGKlytcsdsskqteaeckgnyitykdgevdhpiiqprswen.........
ENSCJAP00000001539  .................LE......LFMGKmhktcynqegiaaeddpspcaletghgrqcqngtvcrpgwdgpkh...
ENSCJAP00000001452  .................VQ......LFKGKlytcsdsskqteaeckgnyitykdgevdhpiiqprswen.........
ENSCJAP00000001544  .................LE......LFMGKmhktcynqegiaaeddpspcaletghgrqcqngtvcrpgwdgpkh...
ENSCJAP00000051432  .................VQ......LFKGKfyrctdeaksnpeecrglfilykdgdvdspvvreriwqn.........
ENSCJAP00000011693  .................LQ......LFMGNlrnkclqwppdnssfeinitsffnnsldgngttfnrtvsmfnwdeyie
ENSCJAP00000032944  .................LQ......LFMGNlrnkcvvwpinfnesylengtkgfdweeyinnktnfytvpgmlepllc
ENSCJAP00000032952  .................LQ......LFMGNlrnkcvvwpinfnesylengtkgfdweeyinnktnfytvpgmlepllc
ENSCJAP00000032909  .................LQ......LFMGNlrnkcvvwpinfnesylengtkgfdweeyinnknfytvpgmlepllcg
ENSCJAP00000018413  .................LQ......LFMGNlrhkcvrnftalngtngsveadgsvwesldlylsdpenyllkngtsdv
ENSCJAP00000018438  .................LQ......LFMGNlrhkcvrnftalngtngsveadgsvwesldlylsdpenyllkngtsdv
ENSCJAP00000018440  .................LQ......LFMGNlrhkcvrnftalngtngsveadgsvwesldlylsdpenyllkngtsdv
ENSCJAP00000005090  .................HL......VENSG................................................
ENSCJAP00000011860  .................LQ......LFMGNlkhkcfrdslennetlflenfisqfsnwfilknnrkyfyylegskdal
ENSCJAP00000051772  .................VQ......LFKGKlytcsdsskqteaeckgnyitykdgevdhpiiqprswen.........
ENSCJAP00000001522  .................VQ......LFKGKlytcsdsskqteaeckgnyitykdgevdhpiiqprswen.........
ENSCJAP00000009758  .................VQ......LFKGKlytcsdsskqteaeckgnyitykdgevdhpiiqprswen.........
ENSCJAP00000011461  .................LQ......LFMGNlrnkclqwppdnssfeinitsffnnsldgngttfnrtvsmfnwdeyie
ENSCJAP00000008352  .................MQ......VFGNIkldeeshin.......................................
ENSCJAP00000036134  .................MQ......LFGKSykecvckiasdcslprwhmhdffhsflivfril...............
ENSCJAP00000011251  .................LQ......LFMGNlrnkclqwppdnssfeinitsffnnsldgngttfnrtvsmfnwdeyie
ENSCJAP00000011518  .................LQ......LFMGNlrnkclqwppdnssfeinitsffnnsldgngttfnrtvsmfnwdeyie
ENSCJAP00000032944  .................VN......LFAGKyhycfnetseirfeiedvnnkteceklmeg..................
ENSCJAP00000011705  .................LQ......LFMGNlrnkcvqwpptnasleehsieknitvnyngtlinetvfefdwksyiqd
ENSCJAP00000018484  .................LQ......LFMGNlrhkcvrnftalngtngsveadgsvwesldlylsdpenyllkngtsdv
ENSCJAP00000018413  .................MQ......LFGKNyselrhsdsgllprwhmmdffhafliifril.................
ENSCJAP00000036134  .................LQ......LFMGNlrhkcvrwpppfndtnttwysndswygndtchaswatndtfdwdayin
ENSCJAP00000000428  .................YW......ASNYEgigstrwvy.......................................
ENSCJAP00000018440  .................MQ......LFGKNyselrhsdsgllprwhmmdffhafliifril.................
ENSCJAP00000018484  .................MQ......LFGKNyselrhsdsgllprwhmmdffhafliifril.................
ENSCJAP00000018438  .................MQ......LFGKNyselrhsdsgllprwhmmdffhafliifril.................
ENSCJAP00000005022  .................MQ......LFGGK................................................
ENSCJAP00000018471  .................VN......LFAGKfwrcinytdgefslvplsivnnkteceiqnstrsffwvn.........
ENSCJAP00000051432  .................MQ......MFGKVamkdnnqin.......................................
ENSCJAP00000011510  .................LQ......LFMGNlrnkclqwppdnssfeinitsffnnsldgngttfnrtvsmfnwdeyie
ENSCJAP00000028522  .................WV......IAYTR................................................
ENSCJAP00000005008  .................VQ......LFKGKfytctdeakhtpqeckgsflvypdgdvsrplvrerlwvn.........
ENSCJAP00000008130  .................VQ......LFKGKffhctdeskefekdcrgkyllyeknevkardrewkk............
ENSCJAP00000005022  .................VQ......LFKGKfytctdeakhtpqeckgsflvypdgdvsrplvrerlwvn.........
ENSCJAP00000036148  .................MQ......LFGKSykecvckiasdcslprwhmhdffhsflivfril...............
ENSCJAP00000009776  .................LE......LFKGKmhktcyftgtdivatveneepspcartgsgrrctingsecqggwpgpn
ENSCJAP00000018471  .................LQ......LFKGNlknkcvknamavnettnysshgkyifinkrgtsdpllcgngsdsghcp
ENSCJAP00000036144  .................LQ......LFMGNlrhkcvrwpppfndtnttwysndswygndtwygdamwhtndswyandt
ENSCJAP00000018471  .................KQ......LLGENyrskrktisapheew.................................
ENSCJAP00000036148  .................LQ......LFMGNlrhkcvrwpppfndtnttwysndswygndtwygdamwhtndswyandt
ENSCJAP00000001539  .................NF......DEMQT................................................
ENSCJAP00000001544  .................NF......DEMQT................................................
ENSCJAP00000015632  .................QH......LERAG................................................
ENSCJAP00000045673  .................RV......CERYH................................................
ENSCJAP00000017214  .................RV......CERYH................................................
ENSCJAP00000030676  .................RA......CERYH................................................
ENSCJAP00000048251  .................RV......CERYH................................................
ENSCJAP00000019483  .................QH......LERAG................................................
ENSCJAP00000017218  .................RV......CERYH................................................
ENSCJAP00000031810  .................KY......IEG--................................................
ENSCJAP00000031809  .................KY......IEG--................................................
ENSCJAP00000031817  .................KY......IEG--................................................
ENSCJAP00000018110  .................QQ......LFMGSlnlkcvrsdcknvsnqeacdycfekkenstefrmcgtwmgnsscssqy
ENSCJAP00000025797  .................RV......CERYH................................................
ENSCJAP00000047563  .................RV......CERYH................................................
ENSCJAP00000025796  .................RV......CERYH................................................
ENSCJAP00000036144  .................MQ......LFGKSykecvckiasdcslprwhmhdffhsflivfril...............
ENSCJAP00000001539  .................VQ......LFKGKlytcsdsskqteaeckgnyitykdgevdhpiiqprswen.........
ENSCJAP00000015636  .................QH......LERIG................................................
ENSCJAP00000001544  .................VQ......LFKGKlytcsdsskqteaeckgnyitykdgevdhpiiqprswen.........
ENSCJAP00000044387  .................MY......NFAYVkkeagi..........................................
ENSCJAP00000051406  .................RV......CERYH................................................
ENSCJAP00000017751  .................VT......LFGAF................................................
ENSCJAP00000001424  .................VQ......LFKGKlytcsdsskqteaeckgnyitykdgevdhpiiqprswen.........
ENSCJAP00000028312  .................KH......IEG--................................................
ENSCJAP00000039183  .................VQ......LFAGKlakcndpniirredcngifrinvsvsknlnlklrpgekkpgfwvprvw
ENSCJAP00000018110  .................MQ......LFGSSfnslksaklcdptdptvsclrhwhmgdfwhsflvvfril.........
ENSCJAP00000039178  .................VQ......LFAGKlakcndpniirredcngifrinvsvsknlnlklrpgekkpgfwvprvw
ENSCJAP00000011922  .................MY......NFAYVkkeagi..........................................
ENSCJAP00000007663  .................DA......LESDHemreeeklkaeeirikgkynissedyrqlelvilqseph.........
ENSCJAP00000032603  .................DA......LESDHemreeeklkaeeirikgkynissedyrqlelvilqseph.........
ENSCJAP00000009758  .................MQ......VFGKIalndttein.......................................
ENSCJAP00000025602  .................YV......LAEMN................................................
ENSCJAP00000048019  .................HL......VENSG................................................
ENSCJAP00000010880  .................QL......LEKQAeaqsrnefqleklrflenytcldqwaleqfvqvimeawvkgvnpkgns
ENSCJAP00000028254  .................KH......IEG--................................................
ENSCJAP00000024637  .................SV......AERQA................................................
ENSCJAP00000028292  .................KH......IEG--................................................
ENSCJAP00000021660  .................YW......ASAYQglgsthwv........................................
ENSCJAP00000021649  .................YW......ASAYQglgsthwv........................................
ENSCJAP00000028286  .................KH......IEG--................................................
ENSCJAP00000036223  .................SA......IEDGQvllaaddgefeefleelcrilncsetvvedrkqdlqghlqkvkpqwf.
ENSCJAP00000010869  .................QL......LEKQAeaqsrnefqleklrflenytcldqwaleqfvqvimeawvkgvnpkgns
ENSCJAP00000044387  .................IH......LFAGTfyecidptsgerfpssevmnkgqcesllfndsmpwen...........
ENSCJAP00000033717  .................SS......VELPYedllrqelrklkrrfleeheclseqqleqflgrvleasnygvsvlsna
ENSCJAP00000000198  .................WL......IALLH................................................
ENSCJAP00000051538  .................WL......IALLH................................................
ENSCJAP00000011266  .................LQ......LFMGNlrnkclqwppsdsafeinttsyfngtmdsngtfvnvtmstfnwkdyig
ENSCJAP00000036144  .................IY......IDTHThtpmtfansiengalp................................
ENSCJAP00000031810  .................RA......LEQPFessqkntialekaeflrdhvcvspqeletliqhaldadnagvspigns
ENSCJAP00000031809  .................RA......LEQPFessqkntialekaeflrdhvcvspqeletliqhaldadnagvspigns
ENSCJAP00000031817  .................RA......LEQPFessqkntialekaeflrdhvcvspqeletliqhaldadnagvspigns
ENSCJAP00000004803  .................FF......AEYTR................................................
ENSCJAP00000011922  .................IH......LFAGTfyecidptsgerfpssevmnkgqcesllfndsmpwen...........
ENSCJAP00000010847  .................WT......LEGRAaqdsshsfqrdkwallenftcldrpaldslirdiihaykngasllsnt
ENSCJAP00000010844  .................WT......LEGRAaqdsshsfqrdkwallenftcldrpaldslirdiihaykngasllsnt
ENSCJAP00000034853  .................WV......IAVAH................................................
ENSCJAP00000004793  .................FF......AEYTR................................................
ENSCJAP00000007663  .................SQ......CEE--................................................
ENSCJAP00000032603  .................SQ......CEE--................................................
ENSCJAP00000042788  .................KA......LEQPHeisqrttiviqkqtfisqhscvnsteldeliqqivaainagiiplgnt
ENSCJAP00000033365  .................RA......LEQPHeqqaqrelgevrekflrahpcvsdqelgllikevadalgggadpetns
ENSCJAP00000004804  .................FF......AEYTR................................................
ENSCJAP00000028286  .................KA......LEQPHeisqrttiviqkqtfisqhscvnsteldeliqqivaainagiiplgnt
ENSCJAP00000028292  .................KA......LEQPHeisqrttiviqkqtfisqhscvnsteldeliqqivaainagiiplgnt
ENSCJAP00000025789  .................RV......CERYH................................................
ENSCJAP00000028254  .................KA......LEQPHeisqrttiviqkqtfisqhscvnsteldeliqqivaainagiiplgnt
ENSCJAP00000033361  .................RA......LEQPHeqqaqrelgevrekflrahpcvsdqelgllikevadalgggadpetns
ENSCJAP00000016635  .................WL......IAYIR................................................
ENSCJAP00000044520  .................WL......IAYIR................................................
ENSCJAP00000004712  .................WL......IAYIR................................................
ENSCJAP00000004717  .................WL......IAYIR................................................
ENSCJAP00000033717  .................SV......LEDD-................................................
ENSCJAP00000028312  .................KA......LEQPHeisqrttiviqkqtfisqhscvnsteldeliqqivaainagiiplgnt
ENSCJAP00000000665  .................WL......IASLH................................................
ENSCJAP00000010822  .................MV......TEG--................................................
ENSCJAP00000011922  .................MR......LFGQNyekfvchidrdcqlprwhmhdffhsflnvfrii...............
ENSCJAP00000030680  .................HQ......FFRYH................................................
ENSCJAP00000036134  .................PR......CAACI................................................
ENSCJAP00000036148  .................PR......CAACI................................................
ENSCJAP00000041691  .................WL......IALHH................................................
ENSCJAP00000043961  .................WL......IALHH................................................
ENSCJAP00000050339  .................WL......IALHH................................................
ENSCJAP00000032611  .................SA......LELAHerqakqrweerlanfsrchnlsrdelrgflrhyeeatragirvd....
ENSCJAP00000036223  .................PF......WETE-................................................
ENSCJAP00000006678  .................YV......IGKMErednsllkwevgwlhelgkrlespyygnntlg................
ENSCJAP00000002449  .................SH......YEH--................................................
ENSCJAP00000028533  .................WV......IAYTR................................................
ENSCJAP00000008130  cgteepartcpngtkcqPY......WEGPN................................................
ENSCJAP00000033335  .................FL......VPMLQdfpddcwvsinnmv..................................
ENSCJAP00000044017  .................--......-----................................................
ENSCJAP00000002449  .................--......-----................................................
ENSCJAP00000008352  .................LE......FYSGKlhracfmnnsgilegfdpphpcgvqgcpagyeckdwigpnd.......
ENSCJAP00000010847  .................SH......MEG--................................................
ENSCJAP00000010844  .................SH......MEG--................................................
ENSCJAP00000032608  .................DA......LESKAesgrqrllvqkrgalrgkfgfsaedcrelerlalgrap..........
ENSCJAP00000001064  .................SA......LESPGeaeararwgatlrnfsaahgvaepelraflrhyeaalaagvra.....
ENSCJAP00000044773  .................YL......VAVAH................................................
ENSCJAP00000015112  .................YA......IAFIH................................................
ENSCJAP00000042307  .................YA......IAFIH................................................
ENSCJAP00000044603  .................YA......IAFIH................................................
ENSCJAP00000032611  .................TP......IEG--................................................
ENSCJAP00000024941  .................AH......LEEA-................................................
ENSCJAP00000039178  .................CF......VEEL-................................................
ENSCJAP00000010822  .................--......-----................................................
ENSCJAP00000010657  .................FC......LFGSQ................................................
ENSCJAP00000045969  .................MG......LFMGNlkhkcfrwpqenenetlhnrtgnpyyiretenfyylegeryallcgnr
ENSCJAP00000010880  .................SH......VEG--................................................
ENSCJAP00000047810  .................FC......LFGSQ................................................
ENSCJAP00000032608  .................TH......FEG--................................................
ENSCJAP00000024941  .................AR......REGPQearlraelgtlraqllqrspcvaapaldafvervlaagrlgrvvlana
ENSCJAP00000016592  .................YA......VAYIHkdlpefh.........................................
ENSCJAP00000001064  .................TI......VEG--................................................
ENSCJAP00000039183  .................CF......VEEL-................................................
ENSCJAP00000029287  .................IN......LFRGVivaplgnsslapangsapcgsfeqley.....................
ENSCJAP00000010869  .................SH......VEG--................................................
ENSCJAP00000003851  .................QA......LEGPPahrlqaelraelaafqakhgaclppgvleellgtalatqahgvsnlgn
ENSCJAP00000018351  .................ME......FFCGIlfpnccntstvadayrwrnhtvgnrtvveegyy...............
ENSCJAP00000011922  .................MG......LFMGNlkhkcfrwpqenenetlhnrtgnpyyirgknhlalyiketenfyyleg
ENSCJAP00000039178  .................VQ......MFGTFtyhcvvndtkpgnvtwnslaipdthcspeleegyqcppgfkcmdledl
ENSCJAP00000034731  .................VQ......LFKGKffvcqgedtrnitnksdcaeasyrwvr.....................
ENSCJAP00000011191  .................--......-----................................................
ENSCJAP00000040639  .................--......-----................................................
ENSCJAP00000000427  .................--......-----................................................
ENSCJAP00000039183  .................VV......LFGTVkygenin.........................................
ENSCJAP00000009758  .................--......-----................................................
ENSCJAP00000039178  .................VV......LFGTVkygenin.........................................
ENSCJAP00000043591  .................--......-----................................................
ENSCJAP00000018307  .................ME......FFCGIlfpnccntstvadayrwrnhtvgnrtvveegyy...............
ENSCJAP00000003851  .................WG......LQGD-................................................
ENSCJAP00000018358  .................ME......FFCGIlfpnccntstvadayrwrnhtvgnrtvveegyy...............
ENSCJAP00000016835  .................--......-----................................................
ENSCJAP00000016824  .................--......-----................................................
ENSCJAP00000018307  .................FY......LFSPD................................................
ENSCJAP00000018358  .................FY......LFSPD................................................
ENSCJAP00000023858  .................YL......LDRFSpfgrfkvnsed.....................................
ENSCJAP00000023857  .................YL......LDRFSpfgrfkvnsed.....................................
ENSCJAP00000011719  .................YL......VFGTQ................................................
ENSCJAP00000023869  .................YL......LDRFSpfgrfkvnsed.....................................
ENSCJAP00000011724  .................YL......VFGTQ................................................
ENSCJAP00000031891  .................YL......LFGT-................................................
ENSCJAP00000032813  .................--......-----................................................
ENSCJAP00000018176  .................WH......TEEPEdgkegpsd........................................
ENSCJAP00000029682  .................WH......LEDNNeeprdpqspp......................................
ENSCJAP00000029731  .................WH......LEDNNeeprdpqspp......................................
ENSCJAP00000029720  .................WH......LEDNNeeprdpqspp......................................
ENSCJAP00000029725  .................WH......LEDNNeeprdpqspp......................................
ENSCJAP00000016830  .................--......-----................................................
ENSCJAP00000026317  .................--......-----................................................
ENSCJAP00000031883  .................YL......LFGT-................................................
ENSCJAP00000008550  .................LF......LVSRFspyewhseeleegrdqtts.............................
ENSCJAP00000008592  .................LF......LVSRFspyewhseeleegrdqtts.............................
ENSCJAP00000019881  .................--......-----................................................
ENSCJAP00000018165  .................WH......TEEPEdgkegpsd........................................
ENSCJAP00000008585  .................LF......LVSRFspyewhseeleegrdqtts.............................
ENSCJAP00000051777  .................LF......LVSRFspyewhseeleegrdqtts.............................
ENSCJAP00000008594  .................LF......LVSRFspyewhseeleegrdqtts.............................
ENSCJAP00000043053  .................LF......LVSRFspyewhseeleegrdqtts.............................
ENSCJAP00000018166  .................LF......LVSRFspyewhseeleegrdqtts.............................
ENSCJAP00000043051  .................NL......LFGCN................................................


                                                                                  160               
                                                                                    |               
d1orqc_               .............................................................PN...........S...
ENSCJAP00000001034  .............................................................QG...........T...
ENSCJAP00000006275  .............................................................PT...........S...
ENSCJAP00000011257  .............................................................PT...........T...
ENSCJAP00000051240  .............................................................PT...........T...
ENSCJAP00000040816  .............................................................DD...........S...
ENSCJAP00000041201  .............................................................DD...........T...
ENSCJAP00000041491  .............................................................PE...........T...
ENSCJAP00000000350  .............................................................VD...........S...
ENSCJAP00000002245  .............................................................EH...........T...
ENSCJAP00000006280  .............................................................RE...........S...
ENSCJAP00000000354  .............................................................VD...........S...
ENSCJAP00000002246  .............................................................EH...........T...
ENSCJAP00000002252  .............................................................EH...........T...
ENSCJAP00000043218  .............................................................EH...........T...
ENSCJAP00000002244  .............................................................EH...........T...
ENSCJAP00000006178  .............................................................DH...........T...
ENSCJAP00000006190  .............................................................DH...........T...
ENSCJAP00000011362  .............................................................PD...........T...
ENSCJAP00000042235  .............................................................PD...........T...
ENSCJAP00000006168  .............................................................DH...........T...
ENSCJAP00000020121  .............................................................PG...........T...
ENSCJAP00000006183  .............................................................EH...........T...
ENSCJAP00000013687  .............................................................HT...........S...
ENSCJAP00000007967  .............................................................NH...........T...
ENSCJAP00000013573  .............................................................EH...........T...
ENSCJAP00000020116  .............................................................PG...........T...
ENSCJAP00000028718  .............................................................N-...........E...
ENSCJAP00000000985  .............................................................ADs..........P...
ENSCJAP00000049469  .............................................................ADs..........P...
ENSCJAP00000014952  .............................................................EH...........V...
ENSCJAP00000032384  .............................................................EH...........V...
ENSCJAP00000007249  .............................................................GRv..........L...
ENSCJAP00000027043  .............................................................SN...........K...
ENSCJAP00000050058  .............................................................GP...........S...
ENSCJAP00000037509  .............................................................GP...........S...
ENSCJAP00000014024  .............................................................GP...........S...
ENSCJAP00000037518  .............................................................GP...........S...
ENSCJAP00000037477  .............................................................GP...........S...
ENSCJAP00000037521  .............................................................GP...........S...
ENSCJAP00000018246  .............................................................NK...........E...
ENSCJAP00000011046  .............................................................GP...........S...
ENSCJAP00000036726  .............................................................GP...........S...
ENSCJAP00000003807  .............................................................GP...........S...
ENSCJAP00000011055  .............................................................GP...........S...
ENSCJAP00000035788  .............................................................GP...........S...
ENSCJAP00000035791  .............................................................GP...........S...
ENSCJAP00000035786  .............................................................GP...........S...
ENSCJAP00000035785  .............................................................GP...........S...
ENSCJAP00000005433  .............................................................-N...........S...
ENSCJAP00000018820  .............................................................EN...........D...
ENSCJAP00000032952  .............................................................N-...........Ntei
ENSCJAP00000032909  .............................................................N-...........Ntei
ENSCJAP00000005420  .............................................................-N...........S...
ENSCJAP00000021515  .............................................................GH...........V...
ENSCJAP00000018413  .............................................................VK...........V...
ENSCJAP00000036144  .............................................................VK...........V...
ENSCJAP00000018484  .............................................................VK...........V...
ENSCJAP00000018438  .............................................................VK...........V...
ENSCJAP00000034755  .............................................................HK...........Y...
ENSCJAP00000011266  .............................................................VK...........V...
ENSCJAP00000034722  .............................................................HK...........Y...
ENSCJAP00000011510  .............................................................VK...........V...
ENSCJAP00000011251  .............................................................VK...........V...
ENSCJAP00000011518  .............................................................VK...........V...
ENSCJAP00000011461  .............................................................VK...........V...
ENSCJAP00000035750  .............................................................GP...........S...
ENSCJAP00000011705  .............................................................VK...........V...
ENSCJAP00000024714  .............................................................SA...........S...
ENSCJAP00000032944  .............................................................KHeagiddm....F...
ENSCJAP00000032952  .............................................................KHeagiddm....F...
ENSCJAP00000032909  .............................................................KHeagiddm....F...
ENSCJAP00000040782  .............................................................SA...........S...
ENSCJAP00000011510  .............................................................KRevgiddm....F...
ENSCJAP00000011251  .............................................................KRevgiddm....F...
ENSCJAP00000011518  .............................................................KRevgiddm....F...
ENSCJAP00000011461  .............................................................KRevgiddm....F...
ENSCJAP00000035768  .............................................................GP...........S...
ENSCJAP00000038945  ...............................................ssseangtglellgGP...........S...
ENSCJAP00000038937  .......................................................glellgGP...........S...
ENSCJAP00000024617  .............................................................RK...........Y...
ENSCJAP00000011705  .............................................................KRevgiddm....F...
ENSCJAP00000035074  .............................................................FG...........R...
ENSCJAP00000035079  .............................................................FG...........R...
ENSCJAP00000008124  .............................................................PEvdaqgeemk..E...
ENSCJAP00000011222  .............................................................KKeagiddm....F...
ENSCJAP00000011864  .............................................................S-...........Qnvr
ENSCJAP00000011864  .............................................................KKedgindm....F...
ENSCJAP00000024578  ........hipsrrelrvpctlgweayaqpqaegvgaaanacinwnqyynvcrsgasnphnGA...........I...
ENSCJAP00000018242  .............................................................NK...........E...
ENSCJAP00000024617  .............................................................DR...........K...
ENSCJAP00000000792  .............................................................GP...........S...
ENSCJAP00000008119  .............................................................PEvdaqgeemk..E...
ENSCJAP00000014021  .............................................................GI...........T...
ENSCJAP00000001539  .............................................................RN...........N...
ENSCJAP00000006710  .............................................................GP...........S...
ENSCJAP00000048898  .............................................................GP...........S...
ENSCJAP00000011266  .............................................................KKeagiddm....F...
ENSCJAP00000001544  .............................................................RN...........N...
ENSCJAP00000018110  .............................................................QK...........V...
ENSCJAP00000008393  .............................................................PS...........A...
ENSCJAP00000018413  .............................................................DDm..........F...
ENSCJAP00000008410  .............................................................PS...........A...
ENSCJAP00000018484  .............................................................DDm..........F...
ENSCJAP00000018438  .............................................................DDm..........F...
ENSCJAP00000018440  .............................................................DDm..........F...
ENSCJAP00000014011  .............................................................GI...........T...
ENSCJAP00000013976  .............................................................GI...........T...
ENSCJAP00000050238  .............................................................GI...........T...
ENSCJAP00000013508  .............................................................HG...........R...
ENSCJAP00000050035  .............................................................HG...........R...
ENSCJAP00000013510  .............................................................HG...........R...
ENSCJAP00000013487  .............................................................HG...........R...
ENSCJAP00000008406  .............................................................PS...........A...
ENSCJAP00000001452  .............................................................RN...........N...
ENSCJAP00000007056  .............................................................YG...........Y...
ENSCJAP00000007061  .............................................................YG...........Y...
ENSCJAP00000024932  .............................................................PT...........T...
ENSCJAP00000024922  .............................................................PT...........T...
ENSCJAP00000005022  .............................................................GI...........T...
ENSCJAP00000015533  .............................................................NH...........S...
ENSCJAP00000015531  .............................................................NH...........S...
ENSCJAP00000036148  .............................................................VK...........V...
ENSCJAP00000018471  .............................................................DDm..........F...
ENSCJAP00000036134  .............................................................VK...........V...
ENSCJAP00000051809  .............................................................RN...........N...
ENSCJAP00000018440  ....................................................gylallqvyEE...........Q...
ENSCJAP00000051772  .............................................................RN...........N...
ENSCJAP00000001522  .............................................................RN...........N...
ENSCJAP00000043192  .............................................................RN...........N...
ENSCJAP00000002533  .............................................................ND...........S...
ENSCJAP00000008130  .............................................................PP...........T...
ENSCJAP00000014011  .............................................................RN...........N...
ENSCJAP00000001328  .............................................................DPwenfqn.....N...
ENSCJAP00000001906  .............................................................DPwenfqn.....N...
ENSCJAP00000049896  .............................................................DPwenfqn.....N...
ENSCJAP00000042093  .............................................................DPwenfqn.....N...
ENSCJAP00000014021  .............................................................RN...........N...
ENSCJAP00000013976  .............................................................RN...........N...
ENSCJAP00000050238  .............................................................RN...........N...
ENSCJAP00000024617  .............................................................RH...........A...
ENSCJAP00000051772  .............................................................FNfdemqtrr...S...
ENSCJAP00000001522  .............................................................FNfdemqtrr...S...
ENSCJAP00000008352  .............................................................PS...........A...
ENSCJAP00000043192  .............................................................FNfdemqtrr...S...
ENSCJAP00000001452  .............................................................FNfdemqtrr...S...
ENSCJAP00000009758  .............................................................FNfdemqtrr...S...
ENSCJAP00000001424  .............................................................FNfdemqtrr...S...
ENSCJAP00000001424  .............................................................RN...........N...
ENSCJAP00000009782  .............................................................RN...........N...
ENSCJAP00000009782  .............................................................YDfedtevrr...S...
ENSCJAP00000008130  .............................................................EH...........N...
ENSCJAP00000005022  .............................................................RN...........N...
ENSCJAP00000004594  .............................................................--...........S...
ENSCJAP00000036717  .............................................................--...........-...
ENSCJAP00000001901  .............................................................DPwenfqn.....N...
ENSCJAP00000034755  .............................................................RH...........A...
ENSCJAP00000011864  ........................................tdsgqcpegytcvkagrnpdyGY...........T...
ENSCJAP00000005008  .............................................................RN...........N...
ENSCJAP00000034722  .............................................................RH...........A...
ENSCJAP00000034731  .............................................................RH...........A...
ENSCJAP00000024932  .............................................................YD...........F...
ENSCJAP00000024922  .............................................................YD...........F...
ENSCJAP00000008393  .............................................................RH...........N...
ENSCJAP00000008406  .............................................................RH...........N...
ENSCJAP00000008410  .............................................................RH...........N...
ENSCJAP00000024922  .............................................................RH...........N...
ENSCJAP00000018110  .............................................................NP...........Esgi
ENSCJAP00000024932  .............................................................RH...........N...
ENSCJAP00000014011  .............................................................FNfdetqtkr...S...
ENSCJAP00000009782  ............................................................hGI...........T...
ENSCJAP00000008352  .............................................................HE...........F...
ENSCJAP00000011251  .............................................................CG...........E...
ENSCJAP00000011518  .............................................................CG...........E...
ENSCJAP00000011461  .............................................................CG...........E...
ENSCJAP00000009782  .............................................................SD...........F...
ENSCJAP00000032909  .............................................................CG...........E...
ENSCJAP00000011510  .............................................................CG...........E...
ENSCJAP00000051432  .............................................................FNfdetqtkr...S...
ENSCJAP00000011266  .............................................................CG...........E...
ENSCJAP00000024922  .............................................................GI...........T...
ENSCJAP00000003065  .............................................................DP...........K...
ENSCJAP00000049104  .............................................................DP...........K...
ENSCJAP00000032944  .............................................................CG...........E...
ENSCJAP00000032952  .............................................................CG...........E...
ENSCJAP00000008393  .............................................................GI...........T...
ENSCJAP00000008406  .............................................................GI...........T...
ENSCJAP00000008410  .............................................................GI...........T...
ENSCJAP00000013976  .............................................................FNfdetqtkr...S...
ENSCJAP00000050238  .............................................................FNfdetqtkr...S...
ENSCJAP00000008406  .............................................................HE...........F...
ENSCJAP00000008410  .............................................................HE...........F...
ENSCJAP00000008393  .............................................................HE...........F...
ENSCJAP00000051012  .............................................................FNfdetqtkr...S...
ENSCJAP00000011705  .............................................................CG...........E...
ENSCJAP00000024932  .............................................................GI...........T...
ENSCJAP00000051772  .............................................................GI...........T...
ENSCJAP00000014021  .............................................................FNfdetqtkr...S...
ENSCJAP00000001522  .............................................................GI...........T...
ENSCJAP00000026361  .............................................................FE...........R...
ENSCJAP00000023649  .............................................................NH...........S...
ENSCJAP00000043192  .............................................................GI...........T...
ENSCJAP00000009758  .............................................................GI...........T...
ENSCJAP00000001424  .............................................................GI...........T...
ENSCJAP00000024617  ........hipsrrelrvpctlgweayaqpqaegvgaaanacinwnqyynvcrsgasnphnGA...........I...
ENSCJAP00000051012  .............................................................RN...........N...
ENSCJAP00000009776  .............................................................YDfedtevrr...S...
ENSCJAP00000047289  .....................................gfstdsgqcpegytcvkagrnpdyGY...........T...
ENSCJAP00000049465  ..................................llcgnssdagtcpegyrclkagenpdhGY...........T...
ENSCJAP00000011864  .............................................................CG...........E...
ENSCJAP00000014011  .............................................................SD...........F...
ENSCJAP00000013976  .............................................................SD...........F...
ENSCJAP00000050238  .............................................................SD...........F...
ENSCJAP00000014021  .............................................................SD...........F...
ENSCJAP00000001452  .............................................................GI...........T...
ENSCJAP00000051012  .............................................................SD...........F...
ENSCJAP00000024578  .............................................................DT...........V...
ENSCJAP00000043192  .............................................................SK...........F...
ENSCJAP00000001539  .............................................................GI...........T...
ENSCJAP00000001452  .............................................................SK...........F...
ENSCJAP00000001544  .............................................................GI...........T...
ENSCJAP00000051432  .............................................................SD...........F...
ENSCJAP00000011693  ....................dkshfyflegqndallcgnssdagqcpegyicvkagrnpnyGY...........T...
ENSCJAP00000032944  .....................................gnssdagqcpegyqcmkagrnpnyGY...........T...
ENSCJAP00000032952  .....................................gnssdagqcpegyqcmkagrnpnyGY...........T...
ENSCJAP00000032909  ......................................nssdagqcpegyqcmkagrnpnyGY...........T...
ENSCJAP00000018413  ..................................llcgnssdagtcpegyrclkagenpdhGY...........T...
ENSCJAP00000018438  ..................................llcgnssdagtcpegyrclkagenpdhGY...........T...
ENSCJAP00000018440  ..................................llcgnssdagtcpegyrclkagenpdhGY...........T...
ENSCJAP00000005090  .............................................................DPwlegrn.....S...
ENSCJAP00000011860  ...................................lcgfstdsgqcpegytcvkagrnpdyGY...........T...
ENSCJAP00000051772  .............................................................SK...........F...
ENSCJAP00000001522  .............................................................SK...........F...
ENSCJAP00000009758  .............................................................SK...........F...
ENSCJAP00000011461  ....................dkshfyflegqndallcgnssdagqcpegyicvkagrnpnyGY...........T...
ENSCJAP00000008352  .............................................................RH...........N...
ENSCJAP00000036134  .............................................................CG...........E...
ENSCJAP00000011251  ....................dkshfyflegqndallcgnssdagqcpegyicvkagrnpnyGY...........T...
ENSCJAP00000011518  ....................dkshfyflegqndallcgnssdagqcpegyicvkagrnpnyGY...........T...
ENSCJAP00000032944  .............................................................N-...........Ntei
ENSCJAP00000011705  .....................sryhyflegfldallcgnssdagqcpegyicvkagrnpnyGY...........T...
ENSCJAP00000018484  ..................................llcgnssdagtcpegyrclkagenpdhGY...........T...
ENSCJAP00000018413  .............................................................CG...........E...
ENSCJAP00000036134  ....................degnfyflegsndallcgnssdaghcpegyecikagrnpnyGY...........T...
ENSCJAP00000000428  .............................................................DG...........E...
ENSCJAP00000018440  .............................................................CG...........E...
ENSCJAP00000018484  .............................................................CG...........E...
ENSCJAP00000018438  .............................................................CG...........E...
ENSCJAP00000005022  .............................................................FNfdqthtkr...S...
ENSCJAP00000018471  .............................................................VK...........V...
ENSCJAP00000051432  .............................................................RN...........N...
ENSCJAP00000011510  ....................dkshfyflegqndallcgnssdagqcpegyicvkagrnpnyGY...........T...
ENSCJAP00000028522  .............................................................GD...........Lnka
ENSCJAP00000005008  .............................................................SD...........F...
ENSCJAP00000008130  .............................................................YE...........F...
ENSCJAP00000005022  .............................................................SD...........F...
ENSCJAP00000036148  .............................................................CG...........E...
ENSCJAP00000009776  ............................................................hGI...........T...
ENSCJAP00000018471  ...............................................dgyiclktfdnpdfNY...........T...
ENSCJAP00000036144  wnshaswatndtfdwdayindegnfyflegsndallcgnssdaghcpegyecikagrnpnyGY...........T...
ENSCJAP00000018471  .............................................................PR...........W...
ENSCJAP00000036148  wnshaswatndtfdwdayindegnfyflegsndallcgnssdaghcpegyecikagrnpnyGY...........T...
ENSCJAP00000001539  .............................................................RR...........S...
ENSCJAP00000001544  .............................................................RR...........S...
ENSCJAP00000015632  .............................................................EN...........-...
ENSCJAP00000045673  .............................................................DQq..........D...
ENSCJAP00000017214  .............................................................DQq..........D...
ENSCJAP00000030676  .............................................................DQq..........D...
ENSCJAP00000048251  .............................................................DQq..........D...
ENSCJAP00000019483  .............................................................EN...........-...
ENSCJAP00000017218  .............................................................DQq..........D...
ENSCJAP00000031810  .............................................................--...........-...
ENSCJAP00000031809  .............................................................--...........-...
ENSCJAP00000031817  .............................................................--...........-...
ENSCJAP00000018110  ..................................................ecihtrinpdyNY...........T...
ENSCJAP00000025797  .............................................................DNq..........E...
ENSCJAP00000047563  .............................................................DNq..........E...
ENSCJAP00000025796  .............................................................DNq..........E...
ENSCJAP00000036144  .............................................................CG...........E...
ENSCJAP00000001539  .............................................................SK...........F...
ENSCJAP00000015636  .............................................................KK...........-...
ENSCJAP00000001544  .............................................................SK...........F...
ENSCJAP00000044387  .............................................................NDv..........S...
ENSCJAP00000051406  .............................................................DNq..........E...
ENSCJAP00000017751  .............................................................VP...........K...
ENSCJAP00000001424  .............................................................SK...........F...
ENSCJAP00000028312  .............................................................--...........-...
ENSCJAP00000039183  ..........................................................anpRN...........F...
ENSCJAP00000018110  .............................................................CG...........E...
ENSCJAP00000039178  ..........................................................anpRN...........F...
ENSCJAP00000011922  .............................................................NDv..........S...
ENSCJAP00000007663  .............................................................RA...........G...
ENSCJAP00000032603  .............................................................RA...........G...
ENSCJAP00000009758  .............................................................RN...........N...
ENSCJAP00000025602  .............................................................GD...........Leld
ENSCJAP00000048019  .............................................................DPwenfqn.....N...
ENSCJAP00000010880  ............................................................tNP...........S...
ENSCJAP00000028254  .............................................................--...........-...
ENSCJAP00000024637  .............................................................VN...........A...
ENSCJAP00000028292  .............................................................--...........-...
ENSCJAP00000021660  .............................................................YD...........G...
ENSCJAP00000021649  .............................................................YD...........G...
ENSCJAP00000028286  .............................................................--...........-...
ENSCJAP00000036223  .............................................................NR...........T...
ENSCJAP00000010869  ............................................................tNP...........S...
ENSCJAP00000044387  .............................................................AK...........L...
ENSCJAP00000033717  .............................................................SG...........N...
ENSCJAP00000000198  .............................................................GDldaskvgkacvS...
ENSCJAP00000051538  .............................................................GDldaskvgkacvS...
ENSCJAP00000011266  ....................ddshfyvldgqkdpllcgngsdagqcpegyicvkagrnpnyGY...........T...
ENSCJAP00000036144  .............................................................SP...........T...
ENSCJAP00000031810  ............................................................sNN...........S...
ENSCJAP00000031809  ............................................................sNN...........S...
ENSCJAP00000031817  ............................................................sNN...........S...
ENSCJAP00000004803  .............................................................SP...........Rqdl
ENSCJAP00000011922  .............................................................AK...........L...
ENSCJAP00000010847  .............................................................TS...........M...
ENSCJAP00000010844  .............................................................TS...........M...
ENSCJAP00000034853  .............................................................GD...........Lepa
ENSCJAP00000004793  .............................................................SP...........Rqdl
ENSCJAP00000007663  .............................................................--...........-...
ENSCJAP00000032603  .............................................................--...........-...
ENSCJAP00000042788  ............................................................sNQ...........I...
ENSCJAP00000033365  ..........................................................tsnSS...........H...
ENSCJAP00000004804  .............................................................SP...........Rqdl
ENSCJAP00000028286  ............................................................sNQ...........I...
ENSCJAP00000028292  ............................................................sNQ...........I...
ENSCJAP00000025789  .............................................................DNq..........E...
ENSCJAP00000028254  ............................................................sNQ...........I...
ENSCJAP00000033361  ..........................................................tsnSS...........H...
ENSCJAP00000016635  .............................................................GD...........Ldhv
ENSCJAP00000044520  .............................................................GD...........Ldhv
ENSCJAP00000004712  .............................................................GD...........Mdhi
ENSCJAP00000004717  .............................................................GD...........Mdhi
ENSCJAP00000033717  .............................................................--...........-...
ENSCJAP00000028312  ............................................................sNQ...........I...
ENSCJAP00000000665  .............................................................GDlaappppapcfS...
ENSCJAP00000010822  .............................................................--...........-...
ENSCJAP00000011922  .............................................................CG...........E...
ENSCJAP00000030680  .............................................................DQq..........D...
ENSCJAP00000036134  .............................................................DDm..........F...
ENSCJAP00000036148  .............................................................DDm..........F...
ENSCJAP00000041691  .............................................................GD...........Llnd
ENSCJAP00000043961  .............................................................GD...........Llnd
ENSCJAP00000050339  .............................................................GD...........Llnd
ENSCJAP00000032611  .............................................................NA...........R...
ENSCJAP00000036223  .............................................................--...........-...
ENSCJAP00000006678  .............................................................GP...........S...
ENSCJAP00000002449  .............................................................--...........-...
ENSCJAP00000028533  .............................................................GD...........Lnka
ENSCJAP00000008130  .............................................................NGi..........T...
ENSCJAP00000033335  .............................................................NN...........S...
ENSCJAP00000044017  .............................................................--...........-...
ENSCJAP00000002449  .............................................................--...........-...
ENSCJAP00000008352  .............................................................GI...........T...
ENSCJAP00000010847  .............................................................--...........-...
ENSCJAP00000010844  .............................................................--...........-...
ENSCJAP00000032608  .............................................................PR...........R...
ENSCJAP00000001064  .............................................................D-...........Alr.
ENSCJAP00000044773  .............................................................GD...........Llel
ENSCJAP00000015112  .............................................................GD...........Lepg
ENSCJAP00000042307  .............................................................GD...........Lepg
ENSCJAP00000044603  .............................................................GD...........Lepg
ENSCJAP00000032611  .............................................................--...........-...
ENSCJAP00000024941  .............................................................--...........-...
ENSCJAP00000039178  .............................................................--...........D...
ENSCJAP00000010822  .............................................................--...........-...
ENSCJAP00000010657  .............................................................DRgdy........D...
ENSCJAP00000045969  ........................................tdagqcpegyvcvkaginpdqGF...........T...
ENSCJAP00000010880  .............................................................--...........-...
ENSCJAP00000047810  .............................................................DRgdy........D...
ENSCJAP00000032608  .............................................................--...........-...
ENSCJAP00000024941  ........................................................sgpanAS...........D...
ENSCJAP00000016592  .............................................................P-...........Sanh
ENSCJAP00000001064  .............................................................--...........-...
ENSCJAP00000039183  .............................................................--...........D...
ENSCJAP00000029287  .............................................................WA...........N...
ENSCJAP00000010869  .............................................................--...........-...
ENSCJAP00000003851  ............................................................sSE...........A...
ENSCJAP00000018351  .............................................................YL...........N...
ENSCJAP00000011922  ..............................eryallcgnrtdagqcpegyvcvkaginpdqGF...........T...
ENSCJAP00000039178  ......................................................glsrqelGY...........S...
ENSCJAP00000034731  .............................................................HK...........Y...
ENSCJAP00000011191  .............................................................--...........-...
ENSCJAP00000040639  .............................................................--...........T...
ENSCJAP00000000427  .............................................................--...........-...
ENSCJAP00000039183  .............................................................RH...........A...
ENSCJAP00000009758  .............................................................--...........-...
ENSCJAP00000039178  .............................................................RH...........A...
ENSCJAP00000043591  .............................................................--...........-...
ENSCJAP00000018307  .............................................................YL...........N...
ENSCJAP00000003851  .............................................................--...........-...
ENSCJAP00000018358  .............................................................YL...........N...
ENSCJAP00000016835  .............................................................--...........-...
ENSCJAP00000016824  .............................................................--...........-...
ENSCJAP00000018307  .............................................................PSd..........P...
ENSCJAP00000018358  .............................................................PSd..........P...
ENSCJAP00000023858  .............................................................EE...........E...
ENSCJAP00000023857  .............................................................EE...........E...
ENSCJAP00000011719  .............................................................VD...........D...
ENSCJAP00000023869  .............................................................EE...........E...
ENSCJAP00000011724  .............................................................VD...........D...
ENSCJAP00000031891  .............................................................QV...........E...
ENSCJAP00000032813  .............................................................--...........-...
ENSCJAP00000018176  .............................................................QP...........P...
ENSCJAP00000029682  .............................................................DP...........P...
ENSCJAP00000029731  .............................................................DP...........P...
ENSCJAP00000029720  .............................................................DP...........P...
ENSCJAP00000029725  .............................................................DP...........P...
ENSCJAP00000016830  .............................................................--...........-...
ENSCJAP00000026317  .............................................................--...........-...
ENSCJAP00000031883  .............................................................QV...........E...
ENSCJAP00000008550  .............................................................DQ...........S...
ENSCJAP00000008592  .............................................................DQ...........S...
ENSCJAP00000019881  .............................................................--...........-...
ENSCJAP00000018165  .............................................................QP...........P...
ENSCJAP00000008585  .............................................................DQ...........S...
ENSCJAP00000051777  .............................................................DQ...........S...
ENSCJAP00000008594  .............................................................DQ...........S...
ENSCJAP00000043053  .............................................................DQ...........S...
ENSCJAP00000018166  .............................................................DQ...........S...
ENSCJAP00000043051  .............................................................VS...........D...


                                         170         180                           190              
                                           |           |                             |              
d1orqc_               .............SIKSVFDALWWAV..VTATTVGY.GD..VV.P................ATPIGK...........
ENSCJAP00000001034  .............HFSSIPDAFWWAV..VTMTTVGY.GD..MR.P................ITVGGK...........
ENSCJAP00000006275  .............GFSSIPDAFWWAV..VTMTTVGY.GD..MH.P................VTIGGK...........
ENSCJAP00000011257  .............HFQSIPDAFWWAV..VTMTTVGY.GD..MK.P................ITVGGK...........
ENSCJAP00000051240  .............HFQSIPDAFWWAV..VTMTTVGY.GD..MK.P................ITVGGK...........
ENSCJAP00000040816  .............LFPSIPDAFWWAV..VTMTTVGY.GD..MY.P................MTVGGK...........
ENSCJAP00000041201  .............KFKSIPASFWWAT..ITMTTVGY.GD..IY.P................KTLLGK...........
ENSCJAP00000041491  .............LFKSIPQSFWWAI..ITMTTVGY.GD..IY.P................KTTLGK...........
ENSCJAP00000000350  .............HFTSIPESFWWAV..VTMTTVGY.GD..MA.P................VTVGGK...........
ENSCJAP00000002245  .............QFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................QTWSGM...........
ENSCJAP00000006280  .............QFPSIPDAFWWAV..VSMTTVGY.GD..MV.P................TTIGGK...........
ENSCJAP00000000354  .............HFTSIPESFWWAV..VTMTTVGY.GD..MA.P................VTVGGK...........
ENSCJAP00000002246  .............QFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................QTWSGM...........
ENSCJAP00000002252  .............QFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................QTWSGM...........
ENSCJAP00000043218  .............QFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................QTWSGM...........
ENSCJAP00000002244  .............QFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................QTWSGM...........
ENSCJAP00000006178  .............DFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................KTWSGM...........
ENSCJAP00000006190  .............DFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................KTWSGM...........
ENSCJAP00000011362  .............TFTSVPCAWWWAT..TSMTTVGY.GD..IR.P................DTTTGK...........
ENSCJAP00000042235  .............TFTSVPCAWWWAT..TSMTTVGY.GD..IR.P................DTTTGK...........
ENSCJAP00000006168  .............DFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................KTWSGM...........
ENSCJAP00000020121  .............NFTTIPHSWWWAA..VSISTVGY.GD..MC.P................ETHLGR...........
ENSCJAP00000006183  .............HFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................QTWSGM...........
ENSCJAP00000013687  .............SLTSIPICWWWAT..ISMTTVGY.GD..TH.P................VTLVGK...........
ENSCJAP00000007967  .............YFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................KTWSGM...........
ENSCJAP00000013573  .............HFKNIPIGFWWAV..VTMTTLGY.GD..MY.P................QTWSGM...........
ENSCJAP00000020116  .............NFTTIPHSWWWAA..VSISTVGY.GD..MC.P................ETHLGR...........
ENSCJAP00000028718  .............GLATIPACWWWAT..VSMTTVGY.GD..VV.P................GTTAGK...........
ENSCJAP00000000985  .............EFTSIPACYWWAV..ITMTTVGY.GD..MV.P................RSTPGQ...........
ENSCJAP00000049469  .............EFTSIPACYWWAV..ITMTTVGY.GD..MV.P................RSTPGQ...........
ENSCJAP00000014952  .............GFDTIPACWWWGT..VSMTTVGY.GD..VV.P................VTVAGK...........
ENSCJAP00000032384  .............GFDTIPACWWWGT..VSMTTVGY.GD..VV.P................VTVAGK...........
ENSCJAP00000007249  .............EFTSIPASYWWAI..ISMTTVGY.GD..MV.P................RSVPGQ...........
ENSCJAP00000027043  .............DFTSIPAACWWVI..ISMTTVGY.GD..MY.P................ITVPGR...........
ENSCJAP00000050058  .............IKDKYVTALYFTF..SSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000037509  .............IKDKYVTALYFTF..SSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000014024  .............IKDKYVTALYFTF..SSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000037518  .............IKDKYVTALYFTF..SSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000037477  .............IKDKYVTALYFTF..SSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000037521  .............IKDKYVTALYFTF..SSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000018246  .............F-STYADALWWGT..ITLTTIGY.GD..KT.P................LTWLGR...........
ENSCJAP00000011046  .............VQDKYVTALYFTF..SSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000036726  .............VQDKYVTALYFTF..SSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000003807  .............VQDKYVTALYFTF..SSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000011055  .............IKDKYVTALYFTF..SSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000035788  .............KDSLYVSSLYFTM..TSLTTIGF.GN..IA.P................TTDVEK...........
ENSCJAP00000035791  .............KDSLYVSSLYFTM..TSLTTIGF.GN..IA.P................TTDVEK...........
ENSCJAP00000035786  .............KDSLYVSSLYFTM..TSLTTIGF.GN..IA.P................TTDVEK...........
ENSCJAP00000035785  .............KDSLYVSSLYFTM..TSLTTIGF.GN..IA.P................TTDVEK...........
ENSCJAP00000005433  .............DFSSYADSLWWGT..ITLTTIGY.GD..KT.P................HTWLGR...........
ENSCJAP00000018820  .............HFDTYADALWWGL..ITLTTIGY.GD..KY.P................QTWNGR...........
ENSCJAP00000032952  ......rwknvkiNFDNVGAGYLALL..QVATFKGW.MD..IM.Y................AAVDSRkpdeqpkyedn
ENSCJAP00000032909  ......rwknvkiNFDNVGAGYLALL..QVATFKGW.MD..IM.Y................AAVDSRkpdeqpkyedn
ENSCJAP00000005420  .............DFSSYADSLWWGT..ITLTTIGY.GD..KT.P................HTWLGR...........
ENSCJAP00000021515  .............EFGSYADALWWGV..VTVTTIGY.GD..KV.P................QTWVGK...........
ENSCJAP00000018413  .............NFDNVGAGYLALL..QVATFKGW.MD..IM.Y................AAVDSRgyeeqpqweyn
ENSCJAP00000036144  .............NYDNVGLGYLSLL..QVATFKGW.MD..IM.Y................AAVDSRekeeqpqyevn
ENSCJAP00000018484  .............NFDNVGAGYLALL..QVATFKGW.MD..IM.Y................AAVDSRgyeeqpqweyn
ENSCJAP00000018438  .............NFDNVGAGYLALL..QVATFKGW.MD..IM.Y................AAVDSRgyeeqpqweyn
ENSCJAP00000034755  .............NFDNLGQALMSLF..VLASKDGW.VD..IM.Y................DGLDAVgvdqqpimnhn
ENSCJAP00000011266  .............NFDNVGAGYLALL..QVATFKGW.MD..IM.Y................AAVDSRdvklqplyedn
ENSCJAP00000034722  .............NFDNLGQALMSLF..VLASKDGW.VD..IM.Y................DGLDAVgvdqqpimnhn
ENSCJAP00000011510  .............NFDNVGLGYLSLL..QVATFKGW.MD..IM.Y................AAVDSRnvelqpkyedn
ENSCJAP00000011251  .............NFDNVGLGYLSLL..QVATFKGW.MD..IM.Y................AAVDSRnvelqpkyedn
ENSCJAP00000011518  .............NFDNVGLGYLSLL..QVATFKGW.MD..IM.Y................AAVDSRnvelqpkyedn
ENSCJAP00000011461  .............NFDNVGLGYLSLL..QVATFKGW.MD..IM.Y................AAVDSRnvelqpkyedn
ENSCJAP00000035750  .............KDSLYVSSLYFTM..TSLTTIGF.GN..IA.P................TTDVEK...........
ENSCJAP00000011705  .............NFDNVGFGYLSLL..QVATFKGW.MD..IM.Y................AAVDSRnvelqpqyees
ENSCJAP00000024714  .............KFTSIPASFWYTI..VTMTTLG-.--..--.-................------...........
ENSCJAP00000032944  .............NFETFGNSMICLF..QITTSAGW.DG..LLlPilnrpp..........DCSLDKehpgsgfkgdc
ENSCJAP00000032952  .............NFETFGNSMICLF..QITTSAGW.DG..LLlPilnrpp..........DCSLDKehpgsgfkgdc
ENSCJAP00000032909  .............NFETFGNSMICLF..QITTSAGW.DG..LLlPilnrpp..........DCSLDKehpgsgfkgdc
ENSCJAP00000040782  .............KFTSIPAAFWYTI..VTMTTLG-.--..--.-................------...........
ENSCJAP00000011510  .............NFETFGNSMICLF..QITTSAGW.DG..LL.Apilnsgpp........DCDPEKdhpgssvkgdc
ENSCJAP00000011251  .............NFETFGNSMICLF..QITTSAGW.DG..LL.Apilnsgpp........DCDPEKdhpgssvkgdc
ENSCJAP00000011518  .............NFETFGNSMICLF..QITTSAGW.DG..LL.Apilnsgpp........DCDPEKdhpgssvkgdc
ENSCJAP00000011461  .............NFETFGNSMICLF..QITTSAGW.DG..LL.Apilnsgpp........DCDPEKdhpgssvkgdc
ENSCJAP00000035768  .............KDSLYVSSLYFTM..TSLTTIGF.GN..IA.P................TTDVEK...........
ENSCJAP00000038945  .............LRSAYITSLYFAL..SSLTSVGF.GN..VS.A................NTDTEK...........
ENSCJAP00000038937  .............LRSAYITSLYFAL..SSLTSVGF.GN..VS.A................NTDTEK...........
ENSCJAP00000024617  .............NFDNLGQALMSLF..VLSSKDGW.VN..IM.Y................DGLDAVgvdqqpvqnhn
ENSCJAP00000011705  .............NFETFGNSMICLF..QITTSAGW.DG..LL.A................PILNSKppdcdpnkanp
ENSCJAP00000035074  .............LARKYVYSLYWST..LTLTTIG-.ET..PP.P................VRDSEY...........
ENSCJAP00000035079  .............LARKYVYSLYWST..LTLTTIG-.ET..PP.P................VRDSEY...........
ENSCJAP00000008124  .............EFETYADALWWGL..ITLATIGY.GD..KT.P................KTWEGR...........
ENSCJAP00000011222  .............NFETFGNSMICLF..QITTSAGW.DG..LL.Apilnsapp........D----Cdpdtihpgssv
ENSCJAP00000011864  .......wknlkvNFDNVGLGYLSLL..QVATFKGW.TI..IM.YaavdsvnvdkqpeyeySLYMYI...........
ENSCJAP00000011864  .............NFETFGNSMICLF..QITTSAGW.DG..LL.A................PILNSKppdcdpkkvhp
ENSCJAP00000024578  .............NFDNIGYAWIAIF..QVITLEGW.VD..IM.Yyvmdah..........SFYNFI...........
ENSCJAP00000018242  .............F-STYADALWWGT..ITLTTIGY.GD..KT.P................LTWLGR...........
ENSCJAP00000024617  .............NFDSLLWAIVTVF..QILTQEDW.NV..VL.Yngmast..........SSWAAL...........
ENSCJAP00000000792  .............RRSAYIAALYFTL..SSLTSVGF.GN..VC.A................NTDAEK...........
ENSCJAP00000008119  .............EFETYADALWWGL..ITLATIGY.GD..KT.P................KTWEGR...........
ENSCJAP00000014021  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywvndaig.........WEWPWV...........
ENSCJAP00000001539  .............NFQTFPQAVLLLF..RCATGEAW.QD..IM.L................ACMPGKkcapesepsns
ENSCJAP00000006710  .............IRSAYIAALYFTL..SSLTSVGF.GN..VS.A................NTDAEK...........
ENSCJAP00000048898  .............RRSAYIAALYFTL..SSLTSVGF.GN..VC.A................NTDAEK...........
ENSCJAP00000011266  .............NFETFGNSMICLF..QITTSAGW.DG..LL.Apilnsapp........D----Cdpdtihpgssv
ENSCJAP00000001544  .............NFQTFPQAVLLLF..RCATGEAW.QD..IM.L................ACMPGKkcapesepsns
ENSCJAP00000018110  .............NFDDVGNAYLALL..QVATFKGW.MD..II.R................AAVDSRgkeqqpafess
ENSCJAP00000008393  .............NFDTFPAAIMTVF..QILTGEDW.NE..VM.Y................NGIRSQggvssgmwsai
ENSCJAP00000018413  .............NFQTFANSMLCLF..QITTSAGWdGL..LS.Piln.............TGPPYCdpnlpnsngsr
ENSCJAP00000008410  .............NFDTFPAAIMTVF..QILTGEDW.NE..VM.Y................NGIRSQggvssgmwsai
ENSCJAP00000018484  .............NFQTFANSMLCLF..QITTSAGWdGL..LS.Piln.............TGPPYCdpnlpnsngsr
ENSCJAP00000018438  .............NFQTFANSMLCLF..QITTSAGWdGL..LS.Piln.............TGPPYCdpnlpnsngsr
ENSCJAP00000018440  .............NFQTFANSMLCLF..QITTSAGWdGL..LS.Piln.............TGPPYCdpnlpnsngsr
ENSCJAP00000014011  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywmndamg.........FELPWV...........
ENSCJAP00000013976  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywmndamg.........FELPWV...........
ENSCJAP00000050238  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywmndamg.........FELPWV...........
ENSCJAP00000013508  .............LSRKYIYSLYWST..LTLTTIG-.ET..PP.P................VKDAEY...........
ENSCJAP00000050035  .............LSRKYIYSLYWST..LTLTTIG-.ET..PP.P................VKDAEY...........
ENSCJAP00000013510  .............LSRKYIYSLYWST..LTLTTIG-.ET..PP.P................VKDAEY...........
ENSCJAP00000013487  .............LSRKYIYSLYWST..LTLTTIG-.ET..PP.P................VKDAEY...........
ENSCJAP00000008406  .............NFDTFPAAIMTVF..QILTGEDW.NE..VM.Y................NGIRSQggvssgmwsai
ENSCJAP00000001452  .............NFQTFPQAVLLLF..RCATGEAW.QD..IM.L................ACMPGKkcapesepsns
ENSCJAP00000007056  .............LAREYIYCLYWST..LTLTTIG-.ET..PP.P................VKDEEY...........
ENSCJAP00000007061  .............LAREYIYCLYWST..LTLTTIG-.ET..PP.P................VKDEEY...........
ENSCJAP00000024932  .............NFDTFPAAILTVF..QILTGEDW.NA..VM.Y................HGIESQggvskgmfssf
ENSCJAP00000024922  .............NFDTFPAAILTVF..QILTGEDW.NA..VM.Y................HGIESQggvskgmfssf
ENSCJAP00000005022  .............NFDNFFFAMLTVF..QCVTMEGW.TD..VL.Ywmqdamg.........YELPWV...........
ENSCJAP00000015533  .............WGRQYSHALFKAM..SHMLCIGY.GQ..QA.P................VGMPDV...........
ENSCJAP00000015531  .............WGRQYSHALFKAM..SHMLCIGY.GQ..QA.P................VGMPDV...........
ENSCJAP00000036148  .............NYDNVGLGYLSLL..QVATFKGW.MD..IM.Y................AAVDSRekeeqpqyevn
ENSCJAP00000018471  .............NFQTFANSMLCLF..QITTSAGWdGL..LS.Piln.............TGPPYCdpnlpnsngsr
ENSCJAP00000036134  .............NYDNVGLGYLSLL..QVATFKGW.MD..IM.Y................AAVDSRekeeqpqyevn
ENSCJAP00000051809  .............NFQTFPQAVLLLF..RCATGEAW.QE..IM.L................ACLPGKlcdpesdynpg
ENSCJAP00000018440  .............PQWEYNLYMY---..--------.--..--.-................-----I...........
ENSCJAP00000051772  .............NFQTFPQAVLLLF..RCATGEAW.QD..IM.L................ACMPGKkcapesepsns
ENSCJAP00000001522  .............NFQTFPQAVLLLF..RCATGEAW.QD..IM.L................ACMPGKkcapesepsns
ENSCJAP00000043192  .............NFQTFPQAVLLLF..RCATGEAW.QD..IM.L................ACMPGKkcapesepsns
ENSCJAP00000002533  .............WGKQYSYALFKAM..SHMLCIGY.GA..QA.P................VSMSDL...........
ENSCJAP00000008130  .............NFDTFPAAIMTVF..QILTGEDW.NE..VM.Y................DGIKSQggvqggmvfsi
ENSCJAP00000014011  .............NFQTFPQAVLLLF..RCATGEAW.QE..IM.L................ACLPGKlcdpesdynpg
ENSCJAP00000001328  .............QALTYWECVYLLM..VTMSTVGY.GD..VY.A................KTTLGR...........
ENSCJAP00000001906  .............QALTYWECVYLLM..VTMSTVGY.GD..VY.A................KTTLGR...........
ENSCJAP00000049896  .............QALTYWECVYLLM..VTMSTVGY.GD..VY.A................KTTLGR...........
ENSCJAP00000042093  .............QALTYWECVYLLM..VTMSTVGY.GD..VY.A................KTTLGR...........
ENSCJAP00000014021  .............NFQTFPQAVLLLF..RCATGEAW.QE..IM.L................ACLPGKlcdpesdynpg
ENSCJAP00000013976  .............NFQTFPQAVLLLF..RCATGEAW.QE..IM.L................ACLPGKlcdpesdynpg
ENSCJAP00000050238  .............NFQTFPQAVLLLF..RCATGEAW.QE..IM.L................ACLPGKlcdpesdynpg
ENSCJAP00000024617  .............TFSNFGMAFLTLF..RVSTGDNW.NG..IM.K................DTLRECtredkhclsyl
ENSCJAP00000051772  .............TFDNFPQSLLTVF..QILTGEDW.NS..VM.Y................DGIMAYggpsfpgmlvc
ENSCJAP00000001522  .............TFDNFPQSLLTVF..QILTGEDW.NS..VM.Y................DGIMAYggpsfpgmlvc
ENSCJAP00000008352  .............NFDTFPAAIMTVF..QILTGEDW.NE..VM.Y................NGIRSQggvssgmwsai
ENSCJAP00000043192  .............TFDNFPQSLLTVF..QILTGEDW.NS..VM.Y................DGIMAYggpsfpgmlvc
ENSCJAP00000001452  .............TFDNFPQSLLTVF..QILTGEDW.NS..VM.Y................DGIMAYggpsfpgmlvc
ENSCJAP00000009758  .............TFDNFPQSLLTVF..QILTGEDW.NS..VM.Y................DGIMAYggpsfpgmlvc
ENSCJAP00000001424  .............TFDNFPQSLLTVF..QILTGEDW.NS..VM.Y................DGIMAYggpsfpgmlvc
ENSCJAP00000001424  .............NFQTFPQAVLLLF..RCATGEAW.QD..IM.L................ACMPGKkcapesepsns
ENSCJAP00000009782  .............NFQTFPQAVLLLF..RCATGEAW.QE..IL.L................ACSYGKlcdpeseyapg
ENSCJAP00000009782  .............NFDNFPQALISVF..QVLTGEDW.TS..MM.Y................NGIMAYggpaypgvlvc
ENSCJAP00000008130  .............NFRTFFQALMLLF..RSATGEAW.HN..IM.L................SCLSGKpcdknsgiltr
ENSCJAP00000005022  .............NFQTFPQAVLLLF..RCATGEAW.QE..IM.L................ASLPGSrcdpesdfgpg
ENSCJAP00000004594  .............GLDGVEWALFLTL..TYLPSL-Y.GD..MV.P................STIAGK...........
ENSCJAP00000036717  .............-------------..CSLTSVGF.GN..VS.P................NTNSEK...........
ENSCJAP00000001901  .............QALTYWECVYLLM..VTMSTVGY.GD..VY.A................KTTLGR...........
ENSCJAP00000034755  .............TFRNFGMAFLTLF..RVSTGDNW.NG..IM.K................DTLRDCdqestcyntvi
ENSCJAP00000011864  .............SFDTFSWAFLALF..RLMTQDYW.EN..LY.Q................QTLRAAgktymi.....
ENSCJAP00000005008  .............NFQTFPQAVLLLF..RCATGEAW.QE..IM.L................ASLPGSrcdpesdfgpg
ENSCJAP00000034722  .............TFRNFGMAFLTLF..RVSTGDNW.NG..IM.K................DTLRDCdqestcyntvi
ENSCJAP00000034731  .............TFRNFGMAFLTLF..RVSTGDNW.NG..IM.K................DTLRDCdqestcyntvi
ENSCJAP00000024932  .............HYDNVLWALLTLF..TVSTGEGW.PM..VL.K................HSVDATyeeqgpspgyr
ENSCJAP00000024922  .............HYDNVLWALLTLF..TVSTGEGW.PM..VL.K................HSVDATyeeqgpspgyr
ENSCJAP00000008393  .............NFRSFFGSLMLLF..RSATGEAW.QE..IM.L................SCLGEKgcepdttapsg
ENSCJAP00000008406  .............NFRSFFGSLMLLF..RSATGEAW.QE..IM.L................SCLGEKgcepdttapsg
ENSCJAP00000008410  .............NFRSFFGSLMLLF..RSATGEAW.QE..IM.L................SCLGEKgcepdttapsg
ENSCJAP00000024922  .............NFRTFLQALMLLF..RSATGEAW.HE..IM.L................SCLSNQacdeqanatec
ENSCJAP00000018110  .........ddifNFQTFASSMLCLF..QITTSAGW.DA..LL.S................PMLRSKescnsssench
ENSCJAP00000024932  .............NFRTFLQALMLLF..RSATGEAW.HE..IM.L................SCLSNQacdeqanatec
ENSCJAP00000014011  .............TFDNFPQALLTVF..QILTGEDW.NA..VM.Y................DGIMAYggpsssgmivc
ENSCJAP00000009782  .............HFDNFGFSMLTVY..QCITMEGW.TD..VL.Ywvndaig.........NEWPWI...........
ENSCJAP00000008352  .............HYDNIIWALLTLF..TVSTGEGW.PQ..VL.Q................HSVDVTeedrgpsrsnr
ENSCJAP00000011251  .............WIETMWDCMEVAG..QTMCL---.--..--.-................-----T...........
ENSCJAP00000011518  .............WIETMWDCMEVAG..QTMCL---.--..--.-................-----T...........
ENSCJAP00000011461  .............WIETMWDCMEVAG..QTMCL---.--..--.-................-----T...........
ENSCJAP00000009782  .............HFDNVLSAMMSLF..TVSTFEGW.PQ..LL.Y................KAIDSNgedvgpiynnr
ENSCJAP00000032909  .............WIETMWDCMEVAG..QAMCL---.--..--.-................-----I...........
ENSCJAP00000011510  .............WIETMWDCMEVAG..QTMCL---.--..--.-................-----T...........
ENSCJAP00000051432  .............TFDNFPQALLTVF..QILTGEDW.NA..VM.Y................DGIMAYggpsssgmivc
ENSCJAP00000011266  .............WIETMWDCMEVAG..QTMCL---.--..--.-................-----I...........
ENSCJAP00000024922  .............NFDNILFAILTVF..QCITMEGW.TD..IL.Yntndaag.........NTWNWL...........
ENSCJAP00000003065  .............RFQNIFTTIFTLF..TLLTLDDW.SL..VY.Mdsra............QGAWYIip.........
ENSCJAP00000049104  .............RFQNIFTTIFTLF..TLLTLDDW.SL..VY.Mdsra............QGAWYIip.........
ENSCJAP00000032944  .............WIETMWDCMEVAG..QAMCL---.--..--.-................-----I...........
ENSCJAP00000032952  .............WIETMWDCMEVAG..QAMCL---.--..--.-................-----I...........
ENSCJAP00000008393  .............QFDNILFAVLTVF..QCITMEGW.TT..VL.Yntndalg.........ATWNWL...........
ENSCJAP00000008406  .............QFDNILFAVLTVF..QCITMEGW.TT..VL.Yntndalg.........ATWNWL...........
ENSCJAP00000008410  .............QFDNILFAVLTVF..QCITMEGW.TT..VL.Yntndalg.........ATWNWL...........
ENSCJAP00000013976  .............TFDNFPQALLTVF..QILTGEDW.NA..VM.Y................DGIMAYggpsssgmivc
ENSCJAP00000050238  .............TFDNFPQALLTVF..QILTGEDW.NA..VM.Y................DGIMAYggpsssgmivc
ENSCJAP00000008406  .............HYDNIIWALLTLF..TVSTGEGW.PQ..VL.Q................HSVDVTeedrgpsrsnr
ENSCJAP00000008410  .............HYDNIIWALLTLF..TVSTGEGW.PQ..VL.Q................HSVDVTeedrgpsrsnr
ENSCJAP00000008393  .............HYDNIIWALLTLF..TVSTGEGW.PQ..VL.Q................HSVDVTeedrgpsrsnr
ENSCJAP00000051012  .............TFDNFPQALLTVF..QILTGEDW.NA..VM.Y................DGIMAYggpsssgmivc
ENSCJAP00000011705  .............WIETMWDCMEVAG..QAMCL---.--..--.-................-----T...........
ENSCJAP00000024932  .............NFDNILFAILTVF..QCITMEGW.TD..IL.Yntndaag.........NTWNWL...........
ENSCJAP00000051772  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywvndavg.........RDWPWI...........
ENSCJAP00000014021  .............TFDNFPQALLTVF..QILTGEDW.NA..VM.Y................DGIMAYggpsssgmivc
ENSCJAP00000001522  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywvndavg.........RDWPWI...........
ENSCJAP00000026361  .............LRRQYLYSFYFST..LILTTVG-.DT..PP.P................AREEEY...........
ENSCJAP00000023649  .............WSELYSFALFKAM..SHMLCIGY.GR..QA.P................ESMTDI...........
ENSCJAP00000043192  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywvndavg.........RDWPWI...........
ENSCJAP00000009758  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywvndavg.........RDWPWI...........
ENSCJAP00000001424  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywvndavg.........RDWPWI...........
ENSCJAP00000024617  .............NFDNIGYAWIAIF..QVITLEGW.VD..IM.Yyvmdah..........SFYNFI...........
ENSCJAP00000051012  .............NFQTFPQAVLLLFrkRCATGEAW.QE..IM.L................ACLPGKlcdpesdynpg
ENSCJAP00000009776  .............NFDNFPQALISVF..QSFSSEDW.TS..MM.Y................NGIMAYggpaypgvlvc
ENSCJAP00000047289  .............SFDTFSWAFLALF..RLMTQDYW.EN..LY.Q................QTLRAAgktymi.....
ENSCJAP00000049465  .............SFDSFAWAFLALF..RLMTQDCW.ER..LY.Q................QTLRSAgkiymi.....
ENSCJAP00000011864  .............WIETMWDCMEVAG..QAMCL---.--..--.-................-----I...........
ENSCJAP00000014011  .............NFDNVLSAMMALF..TVSTFEGW.PA..LL.Y................KAIDSNgenvgpvynhr
ENSCJAP00000013976  .............NFDNVLSAMMALF..TVSTFEGW.PA..LL.Y................KAIDSNgenvgpvynhr
ENSCJAP00000050238  .............NFDNVLSAMMALF..TVSTFEGW.PA..LL.Y................KAIDSNgenvgpvynhr
ENSCJAP00000014021  .............NFDNVLSAMMALF..TVSTFEGW.PA..LL.Y................KAIDSNgenvgpvynhr
ENSCJAP00000001452  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywmqdamg.........YELPWV...........
ENSCJAP00000051012  .............NFDNVLSAMMALF..TVSTFEGW.PA..LL.Y................KAIDSNgenvgpvynhr
ENSCJAP00000024578  .............PDRKNFDSLLWAI..VT------.--..--.-................------...........
ENSCJAP00000043192  .............DFDNVLAAMMALF..TVSTFEGW.PE..LL.Y................RSIDSHtedkgpiynyr
ENSCJAP00000001539  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywmqdamg.........YELPWV...........
ENSCJAP00000001452  .............DFDNVLAAMMALF..TVSTFEGW.PE..LL.Y................RSIDSHtedkgpiynyr
ENSCJAP00000001544  .............NFDNFAFAMLTVF..QCITMEGW.TD..VL.Ywmqdamg.........YELPWV...........
ENSCJAP00000051432  .............NFDNVLSAMMALF..TVSTFEGW.PA..LL.Y................KAIDSNgenvgpvynhr
ENSCJAP00000011693  .............SFDTFSWAFLSLF..RLMTQDFW.EN..LY.Q................LTLRAAgktymi.....
ENSCJAP00000032944  .............SFDTFSWAFLALF..RLMTQDYW.EN..LY.Q................LTLRAAgktymi.....
ENSCJAP00000032952  .............SFDTFSWAFLALF..RLMTQDYW.EN..LY.Q................LTLRAAgktymi.....
ENSCJAP00000032909  .............SFDTFSWAFLALF..RLMTQDYW.EN..LY.Q................LTLRAAgktymi.....
ENSCJAP00000018413  .............SFDSFAWAFLALF..RLMTQDCW.ER..LY.Q................QTLRSAgkiymi.....
ENSCJAP00000018438  .............SFDSFAWAFLALF..RLMTQDCW.ER..LY.Q................QTLRSAgkiymi.....
ENSCJAP00000018440  .............SFDSFAWAFLALF..RLMTQDCW.ER..LY.Q................QTLRSAgkiymi.....
ENSCJAP00000005090  .............QTISYFESIYLVV..ITASTVGF.GD..VV.P................KTYLGR...........
ENSCJAP00000011860  .............SFDTFSWAFLALF..RLMTQDYW.EN..LY.Q................QTLRAAgktymi.....
ENSCJAP00000051772  .............DFDNVLAAMMALF..TVSTFEGW.PE..LL.Y................RSIDSHtedkgpiynyr
ENSCJAP00000001522  .............DFDNVLAAMMALF..TVSTFEGW.PE..LL.Y................RSIDSHtedkgpiynyr
ENSCJAP00000009758  .............DFDNVLAAMMALF..TVSTFEGW.PE..LL.Y................RSIDSHtedkgpiynyr
ENSCJAP00000011461  .............SFDTFSWAFLSLF..RLMTQDFW.EN..LY.Q................LTLRAAgktymi.....
ENSCJAP00000008352  .............NFRSFFGSLMLLFrlRSATGEAW.QE..IM.L................SCLGEKgcepdttapsg
ENSCJAP00000036134  .............WIETMWDCMEVAG..QAMCL---.--..--.-................-----T...........
ENSCJAP00000011251  .............SFDTFSWAFLSLF..RLMTQDFW.EN..LY.Q................LTLRAAgktymi.....
ENSCJAP00000011518  .............SFDTFSWAFLSLF..RLMTQDFW.EN..LY.Q................LTLRAAgktymi.....
ENSCJAP00000032944  ......rwknvkiNFDNVGAGYLALL..QVATFKGW.MD..IM.Y................AAVDSRkpdeqpkyedn
ENSCJAP00000011705  .............SFDTFSWAFLSLF..RLMTQDFW.EN..LY.Q................LTLRAAgktymi.....
ENSCJAP00000018484  .............SFDSFAWAFLALF..RLMTQDCW.ER..LY.Q................QTLRSAgkiymi.....
ENSCJAP00000018413  .............WIETMWDCMEVSG..QSLCL---.--..--.-................-----L...........
ENSCJAP00000036134  .............SYDTFSWAFLALF..RLMTQDYW.EN..LF.Q................LTLRAAgktymi.....
ENSCJAP00000000428  .............G-NKYLRCYYWAV..RTLITIG-.GL..PE.P................QTLFEI...........
ENSCJAP00000018440  .............WIETMWDCMEVSG..QSLCL---.--..--.-................-----L...........
ENSCJAP00000018484  .............WIETMWDCMEVSG..QSLCL---.--..--.-................-----L...........
ENSCJAP00000018438  .............WIETMWDCMEVSG..QSLCL---.--..--.-................-----L...........
ENSCJAP00000005022  .............TFDTFPQALLTVF..QILTGEDW.NV..VM.Y................DGIMAYggpffpgmlvc
ENSCJAP00000018471  .............NFDNVAMGYLALL..QVATFKGW.MD..IM.Y................AAVDSRevnmqpkwedn
ENSCJAP00000051432  .............NFQTFPQAVLLLFrkRCATGEAW.QE..IM.L................ACLPGKlcdpesdynpg
ENSCJAP00000011510  .............SFDTFSWAFLSLF..RLMTQDFW.EN..LY.Q................LTLRAAgktymi.....
ENSCJAP00000028522  ...hvgnytpcvaNVYNFPSAFLFFI..ETEATIGY.GY..RY.Itd..............KCPEGI...........
ENSCJAP00000005008  .............NFDNVLSAMMALF..TVSTFEGW.PA..LL.Y................KAIDAYaedhgpiynyr
ENSCJAP00000008130  .............HYDNVLWALLTLF..TVSTGEGW.PQ..VL.K................HSVDATfenqgpspgyr
ENSCJAP00000005022  .............NFDNVLSAMMALF..TVSTFEGW.PA..LL.Y................KAIDAYaedhgpiynyr
ENSCJAP00000036148  .............WIETMWDCMEVAG..QAMCL---.--..--.-................-----T...........
ENSCJAP00000009776  .............HFDNFGFSMLTVY..QCITMEGW.TD..VL.Ywvndaig.........NEWPWI...........
ENSCJAP00000018471  .............SFDSFAWAFLSLF..RLMTQDSW.ER..LY.Q................QTLRASgkiymi.....
ENSCJAP00000036144  .............SYDTFSWAFLALF..RLMTQDYW.EN..LF.Q................LTLRAAgktymi.....
ENSCJAP00000018471  .............HMCDFFHSFLIVF..RILCGEWI.EN..MW.Acmevgq..........KSICLV...........
ENSCJAP00000036148  .............SYDTFSWAFLALF..RLMTQDYW.EN..LF.Q................LTLRAAgktymi.....
ENSCJAP00000001539  .............TFDNFPQSLLTVF..QILTGEDW.NS..VM.Y................DGIMAYggpsfpgmlvc
ENSCJAP00000001544  .............TFDNFPQSLLTVF..QILTGEDW.NS..VM.Y................DGIMAYggpsfpgmlvc
ENSCJAP00000015632  .............--LSLLTSFYFCI..VTFSTVGY.GD..VT.P................KIWPSQ...........
ENSCJAP00000045673  .............VTSNFLGAMWLIS..ITFLSIGY.GD..MV.P................HTYCGK...........
ENSCJAP00000017214  .............VTSNFLGAMWLIS..ITFLSIGY.GD..MV.P................HTYCGK...........
ENSCJAP00000030676  .............VTSNFLGAMWLIS..ITFLSIGY.GD..MV.P................NTYCGK...........
ENSCJAP00000048251  .............VTSNFLGAMWLIS..ITFLSIGY.GD..MV.P................HTYCGK...........
ENSCJAP00000019483  .............--LSLLTSFYFCI..VTFSTVGY.GD..VT.P................KIWPSQ...........
ENSCJAP00000017218  .............VTSNFLGAMWLIS..ITFLSIGY.GD..MV.P................HTYCGK...........
ENSCJAP00000031810  .............--WTALESIYFVV..VTLTTVGF.GD..FV.Aggnagin.........YREWYK...........
ENSCJAP00000031809  .............--WTALESIYFVV..VTLTTVGF.GD..FV.Aggnagin.........YREWYK...........
ENSCJAP00000031817  .............--WTALESIYFVV..VTLTTVGF.GD..FV.Aggnagin.........YREWYK...........
ENSCJAP00000018110  .............NFDNFGWSFLAMF..RLMTQDSW.EK..LY.Q................QTLRTTglysvf.....
ENSCJAP00000025797  .............VTINFLGAMWLIS..ITFLSIGY.GD..MV.P................HTYCGK...........
ENSCJAP00000047563  .............VTINFLGAMWLIS..ITFLSIGY.GD..MV.P................HTYCGK...........
ENSCJAP00000025796  .............VTINFLGAMWLIS..ITFLSIGY.GD..MV.P................HTYCGK...........
ENSCJAP00000036144  .............WIETMWDCMEVAG..QAMCL---.--..--.-................-----T...........
ENSCJAP00000001539  .............DFDNVLAAMMALF..TVSTFEGW.PE..LL.Y................R-----...........
ENSCJAP00000015636  .............--LNLFDSLYFCI..VTFSTVGF.GD..VT.P................ETWSSK...........
ENSCJAP00000001544  .............DFDNVLAAMMALF..TVSTFEGW.PE..LL.Y................R-----...........
ENSCJAP00000044387  .............NFETFGSSMLCLF..QVAIFAGW.DG..ML.V................AIFNSKwsdcdpdkinp
ENSCJAP00000051406  .............VTINFLGAMWLIS..ITFLSIGY.GD..MV.P................HTYCGK...........
ENSCJAP00000017751  .............HFQNMQVALYTLF..ICITQDGW.VD..IY.S................DFQTEKreyameiggai
ENSCJAP00000001424  .............DFDNVLAAMMALF..TVSTFEGW.PE..LL.Y................RSIDSHtedkgpiynyr
ENSCJAP00000028312  .............--WSALDAIYFVV..ITLTTIGF.GD..YV.Aggsdie..........YLDFYK...........
ENSCJAP00000039183  .............NFDNVGNAMLALF..EVLSLKGW.VE..VR.Dviihrv..........GPIHGI...........
ENSCJAP00000018110  .............WIENMWECMQEAN..TSLCV---.--..--.-................-----I...........
ENSCJAP00000039178  .............NFDNVGNAMLALF..EVLSLKGW.VE..VR.Dviihrv..........GPIHGI...........
ENSCJAP00000011922  .............NFETFGSSMLCLF..QVAIFAGW.DG..ML.V................AIFNSKwsdcdpdkinp
ENSCJAP00000007663  .............VQWKFAGSFYFAI..TVITTIGY.GH..AA.P................GTDAGK...........
ENSCJAP00000032603  .............VQWKFAGSFYFAI..TVITTIGY.GH..AA.P................GTDAGK...........
ENSCJAP00000009758  .............NFQTFPQAVLLLF..RCATGEAW.QD..IM.L................ACMPGKkcapesepsns
ENSCJAP00000025602  hdappenhticvkYITSFTAAFSFSL..ETQLTIGY.GT..MF.Psg..............DCPSAI...........
ENSCJAP00000048019  .............QALTYWECVYLLM..VTMSTVGY.GD..VY.A................KTTLGR...........
ENSCJAP00000010880  .............N-WDFGSSFFFAG..TVVTTIGY.GN..LA.P................STEAGQ...........
ENSCJAP00000028254  .............--WSALDAIYFVV..ITLTTIGF.GD..YV.Aggsdie..........YLDFYK...........
ENSCJAP00000024637  .............T-GHLSDTLWLIP..ITFLTIGY.GD..VV.P................GTMWGK...........
ENSCJAP00000028292  .............--WSALDAIYFVV..ITLTTIGF.GD..YV.Aggsdie..........YLDFYK...........
ENSCJAP00000021660  .............VGNSYIRCYYFAV..KTLITIG-.GL..PD.P................KTLFEI...........
ENSCJAP00000021649  .............VGNSYIRCYYFAV..KTLITIG-.GL..PD.P................KTLFEI...........
ENSCJAP00000028286  .............--WSALDAIYFVV..ITLTTIGF.GD..YV.Aggsdie..........YLDFYK...........
ENSCJAP00000036223  .............TDWSFLSSLFFCC..TVFSTVGY.GY..IY.P................VTRLGK...........
ENSCJAP00000010869  .............N-WDFGSSFFFAG..TVVTTIGY.GN..LA.P................STEAGQ...........
ENSCJAP00000044387  .............NFDNVGNGFLSLL..QLATFNGW.IT..IM.NsaidsvainmqprfedNIYMYC...........
ENSCJAP00000033717  .............WNWDFTSALFFAS..TVLSTTGY.GH..TV.P................LSDGGK...........
ENSCJAP00000000198  .............EVNSFTAAFLFSI..ETQTTIGY.GF..RC.Vtd..............ECPIAV...........
ENSCJAP00000051538  .............EVNSFTAAFLFSI..ETQTTIGY.GF..RC.Vtd..............ECPIAV...........
ENSCJAP00000011266  .............SFDTFSWAFLSLF..RLMTQDYW.EN..LY.Q................LTLRAAgktymi.....
ENSCJAP00000036144  .............SSHTFGNSIICLF..EITTSAGW.DG..LLnPiln.............S---GPpdcdpslenpg
ENSCJAP00000031810  .............SHWDLGSAFFFAG..TVITTIGY.GN..IA.P................STEGGK...........
ENSCJAP00000031809  .............SHWDLGSAFFFAG..TVITTIGY.GN..IA.P................STEGGK...........
ENSCJAP00000031817  .............SHWDLGSAFFFAG..TVITTIGY.GN..IA.P................STEGGK...........
ENSCJAP00000004803  .........eyrmFFSDLLNSLVTVF..ILFTLDHW.YA..LL.Qdtwk............VPETSR...........
ENSCJAP00000011922  .............NFDNVGNGFLSLL..QLATFNGW.IT..IM.NsaidsvainmqprfedNIYMYC...........
ENSCJAP00000010847  .............GRWEFVGSFFFSV..STITTIGY.GN..LS.P................NTMAAR...........
ENSCJAP00000010844  .............GRWEFVGSFFFSV..STITTIGY.GN..LS.P................NTMAAR...........
ENSCJAP00000034853  ...egrgrtpcvmQVHGFMAAFLFSI..ETQTTIGY.GL..RC.Vte..............ECPVAV...........
ENSCJAP00000004793  .........eyrmFFSDLLNSLVTVF..ILFTLDHW.YA..LL.Qdtwk............VPETSR...........
ENSCJAP00000007663  .............--WSFFHAYYYCF..ITLTTIGF.GD..YV.Alqtkgalq........KKPLYV...........
ENSCJAP00000032603  .............--WSFFHAYYYCF..ITLTTIGF.GD..YV.Alqtkgalq........KKPLYV...........
ENSCJAP00000042788  .............SHWDLGSSFFFAG..TVITTIGF.GN..IS.P................RTEGGK...........
ENSCJAP00000033365  .............SAWDLGSAFFFSG..TIITTIGY.GN..VA.L................RTDAGR...........
ENSCJAP00000004804  .........eyrmFFSDLLNSLVTVF..ILFTLDHW.YA..LL.Qdtwk............VPETSR...........
ENSCJAP00000028286  .............SHWDLGSSFFFAG..TVITTIGF.GN..IS.P................RTEGGK...........
ENSCJAP00000028292  .............SHWDLGSSFFFAG..TVITTIGF.GN..IS.P................RTEGGK...........
ENSCJAP00000025789  .............VTINFLGAMWLIS..ITFLSIGY.GD..MV.P................HTYCGK...........
ENSCJAP00000028254  .............SHWDLGSSFFFAG..TVITTIGF.GN..IS.P................RTEGGK...........
ENSCJAP00000033361  .............SAWDLGSAFFFSG..TIITTIGY.GN..VA.L................RTDAGR...........
ENSCJAP00000016635  ...gdrewipcveNLSGFVSAFLFSI..ETETTIGY.GF..RV.Ite..............KCPEGI...........
ENSCJAP00000044520  ...gdrewipcveNLSGFVSAFLFSI..ETETTIGY.GF..RV.Ite..............KCPEGI...........
ENSCJAP00000004712  ...edpswtpcvtNLNGFVSAFLFSI..ETETTIGY.GY..RV.Itd..............KCPEGI...........
ENSCJAP00000004717  ...edpswtpcvtNLNGFVSAFLFSI..ETETTIGY.GY..RV.Itd..............KCPEGI...........
ENSCJAP00000033717  .............--WNFLESFYFCF..ISLSTIGL.GD..YV.Pgegynqk.........FRELYK...........
ENSCJAP00000028312  .............SHWDLGSSFFFAG..TVITTIGF.GN..IS.P................RTEGGK...........
ENSCJAP00000000665  .............HVASFLAAFLFAL..ETQTSIGY.GV..RS.Vte..............ECPAAV...........
ENSCJAP00000010822  .............--WNYIEGLYYSF..ITISTIGF.GD..FV.Agvnpsan.........YHALYR...........
ENSCJAP00000011922  .............WIETLWDCM----..--------.-Q..VA.G................QSWCIS...........
ENSCJAP00000030680  .............VTSNFLGAMWLIS..ITFLSIGY.GD..MV.P................NTYCGK...........
ENSCJAP00000036134  .............NFETFGNSIICLF..EITTSAGW.DG..LLnPiln.............S---GPpdcdpslenpg
ENSCJAP00000036148  .............NFETFGNSIICLF..EITTSAGW.DG..LLnPiln.............S---GPpdcdpslenpg
ENSCJAP00000041691  .....pditpcvdNVHSFTGAFLFSL..ETQTTIGY.GY..RC.Vte..............ECSAAV...........
ENSCJAP00000043961  .....pditpcvdNVHSFTGAFLFSL..ETQTTIGY.GY..RC.Vte..............ECSAAV...........
ENSCJAP00000050339  .....pditpcvdNVHSFTGAFLFSL..ETQTTIGY.GY..RC.Vte..............ECSAAV...........
ENSCJAP00000032611  .............PRWDFAGAFYFVG..TVVSTIGF.GM..TT.P................ATVGGK...........
ENSCJAP00000036223  .............--LDFENAFYFCF..VTLTTIGF.GD..TV.L................EHPNFF...........
ENSCJAP00000006678  .............IRSAYIAALYFTL..SSLTSVGF.GN..VS.A................NTDAEK...........
ENSCJAP00000002449  .............--WTFFQAYYYCF..ITLTTIGF.GD..YV.Alqkdqalq........TQPQYV...........
ENSCJAP00000028533  ...hvgnytpcvaNVYNFPSAFLFFI..ETEATIGY.GY..RY.Itd..............KCPEGI...........
ENSCJAP00000008130  .............QFDNILFAVLTVF..QCITMEGW.TD..LL.Ynsndasg.........NTWNWL...........
ENSCJAP00000033335  .............WGKQYSYALFKAM..SHMLCIGY.GR..QA.P................VGMSDV...........
ENSCJAP00000044017  .............--QNMQVALYTLF..ICITQDGW.VD..IY.S................DFQTEKreyameiggai
ENSCJAP00000002449  .............-QWRFAGSLYFAI..TVITTIGY.GH..AA.P................STDGGK...........
ENSCJAP00000008352  .............QFDNILFAVLTVF..QCITMEGW.TT..VL.Yntndalg.........ATWNWL...........
ENSCJAP00000010847  .............--WSYMEGFYFSF..ITLSTVGF.GD..YV.Igmnpsqr.........YPLWYK...........
ENSCJAP00000010844  .............--WSYMEGFYFSF..ITLSTVGF.GD..YV.Igmnpsqr.........YPLWYK...........
ENSCJAP00000032608  .............RQWKFAGSFYFAI..TVITTIGY.SH..AA.P................GTDSGK...........
ENSCJAP00000001064  .............PRWDFPGAFYFVG..TVVSTIGF.GM..TT.P................ATVGGK...........
ENSCJAP00000044773  ..gppanhtpcvvQVHTLTGAFLFSL..ESQTTIGY.GF..RY.Ise..............ECPLAI...........
ENSCJAP00000015112  ..episnhtpcimKVDSLTGAFLFSL..ESQTTIGY.GVrsIT.E................ECPHAI...........
ENSCJAP00000042307  ..episnhtpcimKVDSLTGAFLFSL..ESQTTIGY.GVrsIT.E................ECPHAI...........
ENSCJAP00000044603  ..episnhtpcimKVDSLTGAFLFSL..ESQTTIGY.GVrsIT.E................ECPHAI...........
ENSCJAP00000032611  .............--WSYFDSLYFCF..VAFSTIGF.GD..LV.Ssqnaqyk.........SQGLYR...........
ENSCJAP00000024941  .............--WSFLDAFYFCF..ISLSTIGL.GD..YV.Pgeapgqp.........YRALYK...........
ENSCJAP00000039178  .............RFTTFPRAFMSMF..QILTQEGW.VD..VM.D................QTLNAVghmwapvvai.
ENSCJAP00000010822  .............-NWNWPNAMIFAA..TVITTIGY.GN..VA.P................KTPAGR...........
ENSCJAP00000010657  .............NWGNLPVAFFTLF..SLATVDGW.TD..LQ.Kqldnr...........GFALSRa..........
ENSCJAP00000045969  .............NFDSFGWALLALF..RLMTQD-Y.PE..AL.Yhqi.............L---YAsgkvymi....
ENSCJAP00000010880  .............--WSFGEGFYFAF..ITLSTIGF.GD..YV.V................GTDPSKhyisvyr....
ENSCJAP00000047810  .............NWGNLPVAFFTLF..SLATVDGW.TD..LQ.Kqldnr...........GFALSRa..........
ENSCJAP00000032608  .............--WTFFHAYYYCF..ITLTTIGF.SD..FV.Alqsgealq........RKPPYV...........
ENSCJAP00000024941  .............PAWDFASALFFAS..TLVTTVGY.GY..TT.P................LTDAGK...........
ENSCJAP00000016592  ........tpcveNINGLTSAFLFSL..ETQVTIGY.GF..RC.Vte..............QCATAI...........
ENSCJAP00000001064  .............--WDYVDSLYFCF..VIFNTIGF.GD..LV.Ssqhaayr.........NQGLYR...........
ENSCJAP00000039183  .............RFTTFPRAFMSMF..QILTQEGW.VD..VM.D................QTLNAVghmwapvvai.
ENSCJAP00000029287  .............NFDDFAAALVTLW..NLMVVNNW.QV..LL.Dafrrys..........GPWSKI...........
ENSCJAP00000010869  .............--WSFGEGFYFAF..ITLSTIGF.GD..YV.V................GH----...........
ENSCJAP00000003851  .............SNWDLPSALLFTA..SILSTTGY.GH..MA.P................LSAGGR...........
ENSCJAP00000018351  .............NFDNILNSFVTLF..ELTVVNNW.YI..IM.Egvtsq...........TSHWSR...........
ENSCJAP00000011922  .............NFDSFGWALLALF..RLMTQD-Y.PE..AL.Yhqi.............L---YAsgkvymi....
ENSCJAP00000039178  .............GFNEIGTSIFTVY..EAASQEGW.VF..LM.Yraidsfp.........RWRSYF...........
ENSCJAP00000034731  .............NFDNLGQALMSLF..VLASKDGW.VD..IM.Y................DGLDAVgvdqqpimnhn
ENSCJAP00000011191  .............---GFVAAFLFSI..ETETTIGY.GH..RV.Itd..............QCPEGI...........
ENSCJAP00000040639  .............SIHSFSSAFLFSI..EVQVTIGF.GG..RM.Vte..............ECPLAI...........
ENSCJAP00000000427  .............-------------..--------.--..--.-................------...........
ENSCJAP00000039183  .............NFSSAGKAITVLF..RIVTGEDW.NK..IM.Hdcmv............Q----Ppfctpdeftyw
ENSCJAP00000009758  .............-------------..--------.--..--.-................------...........
ENSCJAP00000039178  .............NFSSAGKAITVLF..RIVTGEDW.NK..IM.Hdcmv............Q----Ppfctpdeftyw
ENSCJAP00000043591  .............-------------..--------.--..--.-................------...........
ENSCJAP00000018307  .............NFDNILNSFVTLF..ELTVVNNW.YI..IM.Egvtsq...........TSHWSR...........
ENSCJAP00000003851  .............--SSLLGAIYFCF..SSLSTIGL.GN..LL.P................SHGHGLhpmiyhvrq..
ENSCJAP00000018358  .............NFDNILNSFVTLF..ELTVVNNW.YI..IM.Egvtsq...........TSHWSR...........
ENSCJAP00000016835  .............-------------..--------.--..--.-................------...........
ENSCJAP00000016824  .............-------------..--------.--..--.-................------...........
ENSCJAP00000018307  .............YFSTLENSIVSLF..VLLTTANF.PD..VM.Mpsys............RNPWSCv..........
ENSCJAP00000018358  .............YFSTLENSIVSLF..VLLTTANF.PD..VM.Mpsys............RNPWSCv..........
ENSCJAP00000023858  .............DALTLSSAMWFSW..GVLLNSGI.GE..GA.P................RSFSAR...........
ENSCJAP00000023857  .............DALTLSSAMWFSW..GVLLNSGI.GE..GA.P................RSFSAR...........
ENSCJAP00000011719  .............F-STFQECIFTQF..RIIL----.GD..IN.F................AEIEEAnrvlgpi....
ENSCJAP00000023869  .............DALTLSSAMWFSW..GVLLNSGI.GE..GA.P................RSFSAR...........
ENSCJAP00000011724  .............F-STFQECIFTQF..RIIL----.GD..IN.F................AEIEEAnrvlgpi....
ENSCJAP00000031891  .............NFSTFIKCIFTQF..RIIL----.GD..FD.Y................NAIDKAnrilgpa....
ENSCJAP00000032813  .............-------------..--------.--..--.-................------...........
ENSCJAP00000018176  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000029682  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000029731  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000029720  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000029725  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000016830  .............-------------..--------.--..--.-................------...........
ENSCJAP00000026317  .............-------------..--------.--..--.-................------...........
ENSCJAP00000031883  .............NFSTFIKCIFTQF..RIIL----.GD..FD.Y................NAIDKAnrilgpa....
ENSCJAP00000008550  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000008592  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000019881  .............-------------..--------.--..--.-................------...........
ENSCJAP00000018165  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000008585  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000051777  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000008594  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000043053  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000018166  .............NEFGIFNSLWFSL..GAFMQQG-.CD..IS.P................RSLSGR...........
ENSCJAP00000043051  .............Y-QTFFSSAVTIV..GLLTGIS-.--..--.-................-----Hqeevialdpvl


                                          200            210            220                         
                                            |              |              |                         
d1orqc_               ................VIGIAVMLTG.....ISALTLLIGTVSNMFQ.....K---ilv...................
ENSCJAP00000001034  ................IVGSLCAIAG.....VLTIALPVPVIVSNF-.....----n.....................
ENSCJAP00000006275  ................IVGSLCAIAG.....VLTIALPVPVIVSNF-.....----n.....................
ENSCJAP00000011257  ................IVGSLCAIAG.....VLTIALPVPVIVSNF-.....----n.....................
ENSCJAP00000051240  ................IVGSLCAIAG.....VLTIALPVPVIVSNF-.....----n.....................
ENSCJAP00000040816  ................IVGSLCAIAG.....VLTIALPVPVIVSNF-.....----n.....................
ENSCJAP00000041201  ................IVGGLCCIAG.....VLVIALPIPIIVNNFS.....E---......................
ENSCJAP00000041491  ................LNAAISFLCG.....VIAIALPIHPIINNFV.....----r.....................
ENSCJAP00000000350  ................IVGSLCAIAG.....VLTISLPVPVIVSNF-.....----s.....................
ENSCJAP00000002245  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000006280  ................IVGSLCAIAG.....VLTIALPVPVIVSNF-.....----n.....................
ENSCJAP00000000354  ................IVGSLCAIAG.....VLTISLPVPVIVSNF-.....----s.....................
ENSCJAP00000002246  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000002252  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000043218  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000002244  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000006178  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000006190  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000011362  ................IVAFMCILSG.....ILVLALPIAIINDRF-.....----s.....................
ENSCJAP00000042235  ................IVAFMCILSG.....ILVLALPIAIINDRF-.....----s.....................
ENSCJAP00000006168  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000020121  ................FFAFLCIAFG.....IILNGMPISILYNKF-.....----s.....................
ENSCJAP00000006183  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000013687  ................LIASTCIICG.....ILVVALPITIIFNKFS.....----k.....................
ENSCJAP00000007967  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000013573  ................LVGALCALAG.....VLTIAMPVPVIVNNF-.....----......................
ENSCJAP00000020116  ................FFAFLCIAFG.....IILNGMPISILYNKF-.....----s.....................
ENSCJAP00000028718  ................LTASACILAG.....ILVVVLPITLIFNKFS.....----hfyr..................
ENSCJAP00000000985  ................VVALSSILSG.....ILLMAFPVTSIFHTFS.....R---......................
ENSCJAP00000049469  ................VVALSSILSG.....ILLMAFPVTSIFHTFS.....R---......................
ENSCJAP00000014952  ................LAASGCILGG.....ILVVALPITIIFNKFS.....----hfyr..................
ENSCJAP00000032384  ................LAASGCILGG.....ILVVALPITIIFNKFS.....----hfyr..................
ENSCJAP00000007249  ................MVALSSILSG.....ILIMAFPATSIFHTF-.....----s.....................
ENSCJAP00000027043  ................ILGGVCVVSG.....IVLLALPITFIYHSF-.....----v.....................
ENSCJAP00000050058  ................IFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000037509  ................IFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000014024  ................IFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000037518  ................IFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000037477  ................IFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000037521  ................IFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000018246  ................LLSAGFALLG.....ISFFALPAGILGSGF-.....----a.....................
ENSCJAP00000011046  ................VFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000036726  ................VFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000003807  ................VFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000011055  ................IFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000035788  ................MFSVAMMMVG.....SLLYATIFGNVTTIFQ.....Q---m.....................
ENSCJAP00000035791  ................MFSVAMMMVG.....SLLYATIFGNVTTIFQ.....Q---m.....................
ENSCJAP00000035786  ................MFSVAMMMVG.....SLLYATIFGNVTTIFQ.....Q---m.....................
ENSCJAP00000035785  ................MFSVAMMMVG.....SLLYATIFGNVTTIFQ.....Q---m.....................
ENSCJAP00000005433  ................VLAAGFALLG.....ISFFALPAGILGSGF-.....----a.....................
ENSCJAP00000018820  ................LLAATFTLIG.....VSFFALPAGILGSGF-.....----a.....................
ENSCJAP00000032952  ...........iymyiYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000032909  ...........iymyiYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000005420  ................VLAAGFALLG.....ISFFALPAGILGSGF-.....----a.....................
ENSCJAP00000021515  ................TIASCFSVFA.....ISFFALPAGILGSGF-.....----a.....................
ENSCJAP00000018413  ...........lymyiYFVVFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000036144  ...........lymylYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000018484  ...........lymyiYFVVFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000018438  ...........lymyiYFVVFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000034755  ...........pwmllYFISFLLIVA.....FFVLNMFVGVVVENFH.....K---cr....................
ENSCJAP00000011266  ...........lymylYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000034722  ...........pwmllYFISFLLIVA.....FFVLNMFVGVVVENFH.....K---cr....................
ENSCJAP00000011510  ...........lymylYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000011251  ...........lymylYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000011518  ...........lymylYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000011461  ...........lymylYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000035750  ................MFSVAMMMVG.....CKYFN-----------.....----s.....................
ENSCJAP00000011705  ...........lymylYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000024714  ................----------.....----------------.....----......................
ENSCJAP00000032944  ........gnpsvgifFFVSYIIISF.....LIVVNMYIAIILENF-.....----s.....................
ENSCJAP00000032952  ........gnpsvgifFFVSYIIISF.....LIVVNMYIAIILENF-.....----s.....................
ENSCJAP00000032909  ........gnpsvgifFFVSYIIISF.....LIVVNMYIAIILENF-.....----s.....................
ENSCJAP00000040782  ................----------.....----------------.....----......................
ENSCJAP00000011510  ........gnpsvgifFFVSYIIISF.....LVVVNMYIAVILENF-.....----s.....................
ENSCJAP00000011251  ........gnpsvgifFFVSYIIISF.....LVVVNMYIAVILENF-.....----s.....................
ENSCJAP00000011518  ........gnpsvgifFFVSYIIISF.....LVVVNMYIAVILENF-.....----s.....................
ENSCJAP00000011461  ........gnpsvgifFFVSYIIISF.....LVVVNMYIAVILENF-.....----s.....................
ENSCJAP00000035768  ................MFSVAMMMVG.....YILFIII---------.....----l.....................
ENSCJAP00000038945  ................IFSICTMLIG.....ALMHAVVFGNVTAIIQ.....RM--......................
ENSCJAP00000038937  ................IFSICTMLIG.....ALMHAVVFGNVTAIIQ.....RM--......................
ENSCJAP00000024617  ...........pwmllYFISFLLIVS.....FFVLNMFVGVVVENFH.....K---cr....................
ENSCJAP00000011705  gssvkgdcgnpsvgifFFVSYIIISF.....LVVVNMYIAVILENF-.....----s.....................
ENSCJAP00000035074  ................VFVVVDFLIG.....VLIFATIVGNIGSMIS.....NM--n.....................
ENSCJAP00000035079  ................VFVVVDFLIG.....VLIFATIVGNIGSMIS.....NM--n.....................
ENSCJAP00000008124  ................LIAATFSLIG.....VSFFALPA--------.....----a.....................
ENSCJAP00000011222  ....kgdcgnpsvgifFFVSYIIISF.....LVVVNMYIAVILENF-.....----s.....................
ENSCJAP00000011864  ................YFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000011864  gssvegdcgnpsvgifYFVSYIIISF.....LVVVNMYIAVILENF-.....----s.....................
ENSCJAP00000024578  ................YFILLIIVGS.....FFMINLCLVVIATQFS.....E---......................
ENSCJAP00000018242  ................LLSAGFALLG.....ISFFALPAGILGSGF-.....----a.....................
ENSCJAP00000024617  ................YFVALMTFGN.....YVLFNLLVAILVEGFQ.....----......................
ENSCJAP00000000792  ................IFSICTMLIG.....ALMHAVVFGNVTAIIQ.....RM--......................
ENSCJAP00000008119  ................LIAATFSLIG.....VSFFALP---------.....----a.....................
ENSCJAP00000014021  ................YFVSLIILGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000001539  ..tegetpcgssfavfYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000006710  ................IFSICTMLIG.....ALMHALVFGNVTAIIQ.....RM--......................
ENSCJAP00000048898  ................IFSICTMLIG.....ALMHAVVFGNVTAIIQ.....RM--......................
ENSCJAP00000011266  ....kgdcgnpsvgifFFVSYIIISF.....LVVVNMYIAVILENF-.....----s.....................
ENSCJAP00000001544  ..tegetpcgssfavfYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000018110  ...........slsylYFVVFIIFGS.....FFTLNLFIGVIIDNFN.....QQQK......................
ENSCJAP00000008393  ................YFIVLTLFGN.....YTLLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000018413  .....gdcgspavgilFFTTYIIISF.....LIVVNMYIAIILENF-.....----s.....................
ENSCJAP00000008410  ................YFIVLTLFGN.....YTLLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000018484  .....gdcgspavgilFFTTYIIISF.....LIVVNMYIAIILENF-.....----s.....................
ENSCJAP00000018438  .....gdcgspavgilFFTTYIIISF.....LIVVNMYIAIILENF-.....----s.....................
ENSCJAP00000018440  .....gdcgspavgilFFTTYIIISF.....LIVVNMYIAIILENF-.....----s.....................
ENSCJAP00000014011  ................YFVSLVIFGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000013976  ................YFVSLVIFGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000050238  ................YFVSLVIFGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000013508  ................LFVVIDFLVG.....VLIFATIVGNVGSMIS.....NM--n.....................
ENSCJAP00000050035  ................LFVVIDFLVG.....VLIFATIVGNVGSMIS.....NM--n.....................
ENSCJAP00000013510  ................LFVVIDFLVG.....VLIFATIVGNVGSMIS.....NM--n.....................
ENSCJAP00000013487  ................LFVVIDFLVG.....VLIFATIVGNVGSMIS.....NM--n.....................
ENSCJAP00000008406  ................YFIVLTLFGN.....YTLLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000001452  ..tegetpcgssfavfYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000007056  ................LFVIFDFLIG.....VLIFATIVGNVGSMIS.....NM--n.....................
ENSCJAP00000007061  ................LFVIFDFLIG.....VLIFATIVGNVGSMIS.....NM--n.....................
ENSCJAP00000024932  ................YFIVLTLFGN.....YTLLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000024922  ................YFIVLTLFGN.....YTLLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000005022  ................YFVSLVIFGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000015533  ................WLTMLSMIVG.....ATCYAMFIGHATALIQ.....----sldssr................
ENSCJAP00000015531  ................WLTMLSMIVG.....ATCYAMFIGHATALIQ.....----sldssr................
ENSCJAP00000036148  ...........lymylYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000018471  .....gdcgspavgilFFTTYIIISF.....LIVVNMYIAVILENF-.....----n.....................
ENSCJAP00000036134  ...........lymylYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000051809  ....eeytcgsnfaivYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000018440  ................YFVVFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000051772  ..tegetpcgssfavfYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000001522  ..tegetpcgssfavfYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000043192  ..tegetpcgssfavfYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000002533  ................WITMLSMIVG.....ATCYAMFVGHATALIQ.....----sldssr................
ENSCJAP00000008130  ................YFIVLTLFGN.....YTLLNVFWAIAVDNL-.....----a.....................
ENSCJAP00000014011  ....eeytcgsnfaivYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000001328  ................LFMVFFILGG.....LAMFASYVPEIIEL--.....----i.....................
ENSCJAP00000001906  ................LFMVFFILGG.....LAMFASYVPEIIEL--.....----i.....................
ENSCJAP00000049896  ................LFMVFFILGG.....LAMFASYVPEIIEL--.....----i.....................
ENSCJAP00000042093  ................LFMVFFILGG.....LAMFASYVPEIIEL--.....----i.....................
ENSCJAP00000014021  ....eeytcgsnfaivYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000013976  ....eeytcgsnfaivYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000050238  ....eeytcgsnfaivYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000024617  ..........palspvYFVTFVLVAQ.....FVLVNVVVAVLMKHLE.....E---sn....................
ENSCJAP00000051772  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000001522  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000008352  ................YFIVLTLFGN.....YTLLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000043192  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000001452  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000009758  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000001424  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000001424  ..tegetpcgssfavfYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000009782  ....eeytcgtnfayyYFISFYMLCA.....FLVINLFVAVIMDNF-.....----......................
ENSCJAP00000009782  ...............iYFIILFVCGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000008130  .......ecgnefayfYFVSFIFLCS.....FLMLNLFVAVIMDNF-.....----e.....................
ENSCJAP00000005022  ....eeftcgsnfaiaYFISFFMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000004594  ................IFGSICSLSG.....VLVIALPVPVIVSNFS.....R---......................
ENSCJAP00000036717  ................VFSICVMLIG.....SLMYASIFGNVSAIIQ.....R---......................
ENSCJAP00000001901  ................LFMVFFILGG.....LAMFASYVPEIIEL--.....----i.....................
ENSCJAP00000034755  .............spiYFVSFVLTAQ.....FVLVNVVIAVLMKHLE.....E---sn....................
ENSCJAP00000011864  ................FFVVVIFLGS.....FYLINLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000005008  ....eeftcgsnfaiaYFISFFMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000034722  .............spiYFVSFVLTAQ.....FVLVNVVIAVLMKHLE.....E---sn....................
ENSCJAP00000034731  .............spiYFVSFVLTAQ.....FVLVNVVIAVLMKHLE.....E---sn....................
ENSCJAP00000024932  ...........melsiFYVVYFVVFP.....FFFVNIFVALIIITFQ.....E---......................
ENSCJAP00000024922  ...........melsiFYVVYFVVFP.....FFFVNIFVALIIITFQ.....E---......................
ENSCJAP00000008393  ..qnenercgtdlayvYFVSFIFFCS.....FLMLNLFVAVIMDNF-.....----e.....................
ENSCJAP00000008406  ..qnenercgtdlayvYFVSFIFFCS.....FLMLNLFVAVIMDNF-.....----e.....................
ENSCJAP00000008410  ..qnenercgtdlayvYFVSFIFFCS.....FLMLNLFVAVIMDNF-.....----e.....................
ENSCJAP00000024922  .........gsdfayfYFVSFIFLCS.....FLMLNLFVAVIMDNF-.....----e.....................
ENSCJAP00000018110  .........lpgiatsYFVSYIIISF.....LIVVNMYIAVILENF-.....----n.....................
ENSCJAP00000024932  .........gsdfayfYFVSFIFLCS.....FLMLNLFVAVIMDNF-.....----e.....................
ENSCJAP00000014011  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000009782  ................YFVTLILLGS.....FFILNLVLGVLSGEFT.....KE--r.....................
ENSCJAP00000008352  ...........memsiFYVVYFVVFP.....FFFVNIFVALIIITFQ.....E---......................
ENSCJAP00000011251  ................VFMMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000011518  ................VFMMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000011461  ................VFMMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000009782  ...........vemaiFFIIYIILIA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000032909  ................VFMMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000011510  ................VFMMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000051432  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000011266  ................VFMLVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000024922  ................YFIPLIIIGS.....FFMLNLVLGVLSGEFA.....KE--r.....................
ENSCJAP00000003065  ................ILMIYIIIQY.....FIFLNLLIAVLVDNFQ.....----......................
ENSCJAP00000049104  ................ILMIYIIIQY.....FIFLNLLIAVLVDNFQ.....----......................
ENSCJAP00000032944  ................VFMMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000032952  ................VFMMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000008393  ................YFIPLIIIGS.....FFVLNLVLGVLSGEFA.....KE--r.....................
ENSCJAP00000008406  ................YFIPLIIIGS.....FFVLNLVLGVLSGEFA.....KE--r.....................
ENSCJAP00000008410  ................YFIPLIIIGS.....FFVLNLVLGVLSGEFA.....KE--r.....................
ENSCJAP00000013976  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000050238  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000008406  ...........memsiFYVVYFVVFP.....FFFVNIFVALIIITFQ.....E---......................
ENSCJAP00000008410  ...........memsiFYVVYFVVFP.....FFFVNIFVALIIITFQ.....E---......................
ENSCJAP00000008393  ...........memsiFYVVYFVVFP.....FFFVNIFVALIIITFQ.....E---......................
ENSCJAP00000051012  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000011705  ................VFMMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000024932  ................YFIPLIIIGS.....FFMLNLVLGVLSGEFA.....KE--r.....................
ENSCJAP00000051772  ................YFVTLIIIGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000014021  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000001522  ................YFVTLIIIGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000026361  ................LFMAGDFLLA.....VMGFATIMGSMSS---.....----vi....................
ENSCJAP00000023649  ................WLTMLSMIVG.....ATCYAMFIGHATALIQ.....----sldssr................
ENSCJAP00000043192  ................YFVTLIIIGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000009758  ................YFVTLIIIGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000001424  ................YFVTLIIIGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000024617  ................YFILLIIVGS.....FFMINLCLVVIATQFS.....E---......................
ENSCJAP00000051012  ....eeytcgsnfaivYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000009776  ...............iYFIILFVCGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000047289  ................FFVVVIFLGS.....FYLINLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000049465  ................FFMLVIFLGS.....FYLVNLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000011864  ................VYMMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000014011  ...........veisiFFIIYIIIVA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000013976  ...........veisiFFIIYIIIVA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000050238  ...........veisiFFIIYIIIVA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000014021  ...........veisiFFIIYIIIVA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000001452  ................YFVSLVIFGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000051012  ...........veisiFFIIYIIIVA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000024578  ................----------.....----------------.....----v.....................
ENSCJAP00000043192  ...........veisiFFIIYIIIIA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000001539  ................YFVSLVIFGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000001452  ...........veisiFFIIYIIIIA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000001544  ................YFVSLVIFGS.....FFVLNLVLGVLSGEFS.....KERE......................
ENSCJAP00000051432  ...........veisiFFIIYIIIVA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000011693  ................FFVLVIFLGS.....FYLINLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000032944  ................FFVLVIFVGS.....FYLVNLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000032952  ................FFVLVIFVGS.....FYLVNLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000032909  ................FFVLVIFVGS.....FYLVNLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000018413  ................FFMLVIFLGS.....FYLVNLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000018438  ................FFMLVIFLGS.....FYLVNLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000018440  ................FFMLVIFLGS.....FYLVNLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000005090  ................ICMMIFTLGS.....LILFANFMPEMVELFA.....NKRK......................
ENSCJAP00000011860  ................FFVVVIFLGS.....FYLINLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000051772  ...........veisiFFIIYIIIIA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000001522  ...........veisiFFIIYIIIIA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000009758  ...........veisiFFIIYIIIIA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000011461  ................FFVLVIFLGS.....FYLINLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000008352  ..qnenercgtdlayvYFVSFIFFCS.....FLMLNLFVAVIMDNF-.....----e.....................
ENSCJAP00000036134  ................VFLMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000011251  ................FFVLVIFLGS.....FYLINLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000011518  ................FFVLVIFLGS.....FYLINLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000032944  ...........iymyiYFVIFIIFGS.....FFTLNLFIGVIIDNFN.....Q---qk....................
ENSCJAP00000011705  ................FFVLVIFLGS.....FYLINLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000018484  ................FFMLVIFLGS.....FYLVNLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000018413  ................VFLLVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000036134  ................FFVVIIFLGS.....FYLINLILAVVAMAYA.....E---qn....................
ENSCJAP00000000428  ................VFQLLNFFSG.....VFVFSSLIGQM-----.....----rd....................
ENSCJAP00000018440  ................VFLLVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000018484  ................VFLLVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000018438  ................VFLLVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000005022  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----......................
ENSCJAP00000018471  ...........vymylYFVIFIIFGG.....FFTLNLFVGVIIDNFN.....Q---qk....................
ENSCJAP00000051432  ....eeytcgsnfaivYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000011510  ................FFVLVIFLGS.....FYLINLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000028522  ................ILFLFQSILG.....SIVDAFLIGCMFIKMS.....QPK-kraetlmfsehavismrdgklt
ENSCJAP00000005008  ...........veisvFFIVYIIIIA.....FFMMNIFVGFVIITF-.....----r.....................
ENSCJAP00000008130  ...........memsiFYVVYFVVFP.....FFFVNIFVALIIITFQ.....E---......................
ENSCJAP00000005022  ...........veisvFFIVYIIIIA.....FFMMNIFVGFVIITF-.....----r.....................
ENSCJAP00000036148  ................VFLMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000009776  ................YFVTLILLGS.....FFILNLVLGVLSGEFT.....KE--r.....................
ENSCJAP00000018471  ................FFVLVIFLGS.....FYLVNLILAVVTMAYE.....EQ--n.....................
ENSCJAP00000036144  ................FFVVIIFLGS.....FYLINLILAVVAMAYA.....E---qn....................
ENSCJAP00000018471  ................LFLTVMVLGN.....LVVLNLFIALLLNSF-.....----s.....................
ENSCJAP00000036148  ................FFVVIIFLGS.....FYLINLILAVVAMAYA.....E---qn....................
ENSCJAP00000001539  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000001544  ...............iYFIILFICGN.....YILLNVFLAIAVDNL-.....----a.....................
ENSCJAP00000015632  ................LLVVIMICVA.....LVVLPLQFEELVYLWM.....ERQKsggnysrhraqtekhvvlcvss
ENSCJAP00000045673  ................GVCLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrik
ENSCJAP00000017214  ................GVCLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrik
ENSCJAP00000030676  ................GVCLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrvk
ENSCJAP00000048251  ................GVCLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrik
ENSCJAP00000019483  ................LLVVIMICVA.....LVVLPLQFEELVYLWM.....ERQKsggnysrhraqtekhvvlcvss
ENSCJAP00000017218  ................GVCLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrik
ENSCJAP00000031810  ................PLVWFWILVG.....LAYFAAVLSMIGDWLR.....----vlskktkeevgeikahaaewka
ENSCJAP00000031809  ................PLVWFWILVG.....LAYFAAVLSMIGDWLR.....----vlskktkeevgeikahaaewka
ENSCJAP00000031817  ................PLVWFWILVG.....LAYFAAVLSMIGDWLR.....----vlskktkeevgeikahaaewka
ENSCJAP00000018110  ................FFIVVIFLGS.....FYLINLTLAVVTMAYE.....EQ--n.....................
ENSCJAP00000025797  ................GVCLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrvk
ENSCJAP00000047563  ................GVCLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrvk
ENSCJAP00000025796  ................GVCLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrvk
ENSCJAP00000036144  ................VFLMVMVIGN.....LVVLNLFLALLLSSF-.....----s.....................
ENSCJAP00000001539  ................----------.....----------------.....----sid...................
ENSCJAP00000015636  ................LFVVAMICVA.....LVVLPIQFEQLAYLWM.....ERQKsggnysrhraqtekhvvlcvss
ENSCJAP00000001544  ................----------.....----------------.....----sid...................
ENSCJAP00000044387  gtqvrgdcgnpsvgilYFVSYILISW.....VIIVNMYIVVVMEF--.....----l.....................
ENSCJAP00000051406  ................GVCLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrvk
ENSCJAP00000017751  ................YFTIFITIGA.....FIGINLFIVVVTTNLE.....QM--m.....................
ENSCJAP00000001424  ...........veisiFFIIYIIIIA.....FFMMNIFVGFVIVTFQ.....E---q.....................
ENSCJAP00000028312  ................PVVWFWILVG.....LAYFAAVLSMIGDWLR.....----viskktkeevgefrahaaewta
ENSCJAP00000039183  ................YIHVFVFLGC.....MIGLTLFVGVVIANFN.....----e.....................
ENSCJAP00000018110  ................VFVLITVIGK.....LVVLNLFIALLLNSFS.....----ne....................
ENSCJAP00000039178  ................YIHVFVFLGC.....MIGLTLFVGVVIANFN.....----e.....................
ENSCJAP00000011922  gtqvrgdcgnpsvgilYFVSYILISW.....VIIVNMYIVVVMEF--.....----l.....................
ENSCJAP00000007663  ................AFCMFYAVLG.....IPLTLVMFQSLGERM-.....----ntfvryllkrikkccg......
ENSCJAP00000032603  ................AFCMFYAVLG.....IPLTLVMFQSLGERM-.....----ntfvryllkrikkccg......
ENSCJAP00000009758  ..tegetpcgssfavfYFISFYMLCA.....FLIINLFVAVIMDNF-.....----......................
ENSCJAP00000025602  ................ALLAIQMLLG.....LMLEAFITGAFVAKIA.....R---pknrafsirftdiavvahidgk
ENSCJAP00000048019  ................LFMVFFILGG.....LAMFASYVPEIIELI-.....----gnrkkyggsysavsgrkhivvc
ENSCJAP00000010880  ................VFCVFYALLG.....IPLNVIFLNNLGTGL-.....----rahlatierwedqprrs.....
ENSCJAP00000028254  ................PVVWFWILVG.....LAYFAAVLSMIGDWLR.....----viskktkeevgefrahaaewta
ENSCJAP00000024637  ................IVCLCTGVMG.....VCCTALLVAVVARKLE.....----fnkaekhvhnfmmdiqyakemk
ENSCJAP00000028292  ................PVVWFWILVG.....LAYFAAVLSMIGDWLR.....----viskktkeevgefrahaaewta
ENSCJAP00000021660  ................VFQGLNYFTG.....VFAFSVMIGQM-----.....----r.....................
ENSCJAP00000021649  ................VFQGLNYFTG.....VFAFSVMIGQM-----.....----r.....................
ENSCJAP00000028286  ................PVVWFWILVG.....LAYFAAVLSMIGDWLR.....----viskktkeevgefrahaaewta
ENSCJAP00000036223  ................YLCMLYALFG.....IPLMFLVLT-------.....----dtgdilatils...........
ENSCJAP00000010869  ................VFCVFYALLG.....IPLNVIFLNNLGTGL-.....----rahlatierwedqprr......
ENSCJAP00000044387  ................YFINFIILGV.....FLPLSMLISAIVDNFN.....----k.....................
ENSCJAP00000033717  ................AFCIIYSVIG.....IPFTLLFLTAVVQR--.....----itvhvtrrpvl...........
ENSCJAP00000000198  ................FMVVFQSIVG.....CIIDAFIIGAVMAKM-.....----a.....................
ENSCJAP00000051538  ................FMVVFQSIVG.....CIIDAFIIGAVMAKM-.....----a.....................
ENSCJAP00000011266  ................FFVLVIFLGS.....FYLVNLILAVVAMAYE.....EQ--n.....................
ENSCJAP00000036144  .tsikgdcgnpsigicFFCSYIIISF.....LIVVNMYIAIILENF-.....----n.....................
ENSCJAP00000031810  ................IFCILYAIFG.....IPLFGFLLAGIGDQ--.....----l.....................
ENSCJAP00000031809  ................IFCILYAIFG.....IPLFGFLLAGIGDQ--.....----l.....................
ENSCJAP00000031817  ................IFCILYAIFG.....IPLFGFLLAGIGDQ--.....----l.....................
ENSCJAP00000004803  ................IFSSIYVILWlllgsIIFRNIIVAMMVTNFQ.....----nir...................
ENSCJAP00000011922  ................YFINFIILGV.....FLPLSMLISAIVDNFN.....----k.....................
ENSCJAP00000010847  ................LFCIFFALVG.....IPLNLVVLNRLGHLMQ.....----qg....................
ENSCJAP00000010844  ................LFCIFFALVG.....IPLNLVVLNRLGHLMQ.....----qg....................
ENSCJAP00000034853  ................FMVVAQSIVG.....CIIDSFMIGAIMAKM-.....----a.....................
ENSCJAP00000004793  ................IFSSIYVILWlllgsIIFRNIIVAMMVTNFQ.....----nir...................
ENSCJAP00000007663  ................AFSFMYILVG.....LTVIGAFLNLVVLRF-.....----ltmntederrdaeer.......
ENSCJAP00000032603  ................AFSFMYILVG.....LTVIGAFLNLVVLRF-.....----ltmntederrdaeer.......
ENSCJAP00000042788  ................IFCIIYALLG.....IPLFGFLLAGVGD---.....----ql....................
ENSCJAP00000033365  ................LFCIFYALVG.....IPLFGILLAGVGDR--.....----lgsslrrgigh...........
ENSCJAP00000004804  ................IFSSIYVILWlllgsIIFRNIIVAMMVTNFQ.....----nir...................
ENSCJAP00000028286  ................IFCIIYALLG.....IPLFGFLLAGVGD---.....----ql....................
ENSCJAP00000028292  ................IFCIIYALLG.....IPLFGFLLAGVGD---.....----ql....................
ENSCJAP00000025789  ................G-CLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrvk
ENSCJAP00000028254  ................IFCIIYALLG.....IPLFGFLLAGVGD---.....----ql....................
ENSCJAP00000033361  ................LFCIFYALVG.....IPLFGILLAGVGDR--.....----lgsslrrgigh...........
ENSCJAP00000016635  ................ILLLVQAILG.....SIVNAFMVGCMFVKI-.....----s.....................
ENSCJAP00000044520  ................ILLLVQAILG.....SIVNAFMVGCMFVKI-.....----s.....................
ENSCJAP00000004712  ................ILLLIQSVLG.....SIVNAFMVGCMFVKI-.....----s.....................
ENSCJAP00000004717  ................ILLLIQSVLG.....SIVNAFMVGCMFVKI-.....----s.....................
ENSCJAP00000033717  ................IGITCYLLLG.....LIAMLVVLETFC----.....----elhelkkfrkmfyvkkdkded.
ENSCJAP00000028312  ................IFCIIYALLG.....IPLFGFL---------.....----l.....................
ENSCJAP00000000665  ................AAVVLQCIAG.....CVLDAFVVGAVMAKM-.....----a.....................
ENSCJAP00000010822  ................YFVELWIYLG.....LAWLSLFVNWKVSMFV.....EVH-kaikkrrrrrke..........
ENSCJAP00000011922  ................FYLMVILIGN.....LLVLYLFLAL------.....----v.....................
ENSCJAP00000030680  ................GVCLLTGIMG.....AGCTALVVAVVARKLE.....----ltkaekhvhnfmmdtqltkrvk
ENSCJAP00000036134  .tsikgdcgnpsigicFFCSYIIISF.....LIVVNMYIAIILENF-.....----n.....................
ENSCJAP00000036148  .tsikgdcgnpsigicFFCSYIIISF.....LIVVNMYIAIILENF-.....----n.....................
ENSCJAP00000041691  ................LMVILQSILS.....CIINTFIIGAALA---.....----km....................
ENSCJAP00000043961  ................LMVILQSILS.....CIINTFIIGAALA---.....----km....................
ENSCJAP00000050339  ................LMVILQSILS.....CIINTFIIGAALA---.....----km....................
ENSCJAP00000032611  ................IFLIFYGLIG.....CSSTILFFNLFLERL-.....----itviayimkschqrqlr.....
ENSCJAP00000036223  ................LFFSIYIIVG.....MEIVFIAFKLVQNR--.....----l.....................
ENSCJAP00000006678  ................IFSICTMLIG.....VSQFQ-----------.....----vcprpswiicwyldhfssillm
ENSCJAP00000002449  ................AFSFVYILTG.....LTVIGAFLN-------.....----pm....................
ENSCJAP00000028533  ................ILFLFQSILG.....SIVDAFLIGCMFIKM-.....----s.....................
ENSCJAP00000008130  ................YFIPLIIIGS.....FFMLNLVLGVLSGEFA.....KE--r.....................
ENSCJAP00000033335  ................WLTMLSMIVG.....ATCYAMFIGHATALIQsldssR---rqyqekykqveqymsfhklppd
ENSCJAP00000044017  ................YFTIFITIGA.....FIGINLFIVVVTTNLE.....QM--m.....................
ENSCJAP00000002449  ................VFCMFYALLG.....IPLTLVMFQSLGER--.....----intlvryllh............
ENSCJAP00000008352  ................YFIPLIIIGS.....FFVLNLVLGVLSGEFA.....KE--r.....................
ENSCJAP00000010847  ................NMVSLWILFG.....MAWQALIIKLILSQL-.....----empg..................
ENSCJAP00000010844  ................NMVSLWILFG.....MAWQALIIKLILSQL-.....----empg..................
ENSCJAP00000032608  ................VFCMFSALLG.....IPLTLVTFQSLGE---.....----rlna..................
ENSCJAP00000001064  ................AFLIAYGLFG.....CAGTILFFNLFLER--.....----iisllafimr............
ENSCJAP00000044773  ................VLLIAQLVLT.....TILEIFITGTFLA---.....----kia...................
ENSCJAP00000015112  ................FLLVAQLVIT.....TLIEIFITGTFL----.....----akia..................
ENSCJAP00000042307  ................FLLVAQLVIT.....TLIEIFITGTFL----.....----akia..................
ENSCJAP00000044603  ................FLLVAQLVIT.....TLIEIFITGTFL----.....----akia..................
ENSCJAP00000032611  ................FANFVFILMG.....VCCIYSLFNVISILIK.....----qslnwilrkmdsgccpqcr...
ENSCJAP00000024941  ................VLVTVYLFLG.....LVAMVLVL--------.....----qtf...................
ENSCJAP00000039178  ................YFILYHLFAT.....LILLSLFVAVILDNL-.....----e.....................
ENSCJAP00000010822  ................LFCVFYGLFG.....VPLCLTWISALGKFF-.....----ggrakrlgqf............
ENSCJAP00000010657  ................FTIIFILLAS.....FIFLNMFVGVMIRY--.....----te....................
ENSCJAP00000045969  ................FFVVVSFWFS.....FYMASLFLGILAMA--.....----hee...................
ENSCJAP00000010880  ................SLAAIWILLG.....LAWLALI---------.....----l.....................
ENSCJAP00000047810  ................FTIIFILLAS.....FIFLNMFVGVMIRY--.....----te....................
ENSCJAP00000032608  ................AFSFLYILLG.....LTVIGAFLNLVVLR--.....----f.....................
ENSCJAP00000024941  ................AFSIAFALLG.....VPTTMLLLT-------.....----asaqrls...............
ENSCJAP00000016592  ................FLLI------.....----------------.....----fqsile................
ENSCJAP00000001064  ................LGNFLLILLG.....VCCIYS----------.....----lf....................
ENSCJAP00000039183  ................YFILYHLFAT.....LILLSLFVAVILDNL-.....----e.....................
ENSCJAP00000029287  ................YFVLWWLVSS.....VIWVNLFLALILENF-.....----lhk...................
ENSCJAP00000010869  ................----------.....----------------.....----pl....................
ENSCJAP00000003851  ................AFCVVYAALG.....LPA-------------.....----sllvat................
ENSCJAP00000018351  ................LYFMTFYIVT.....MVVMTIIVAFILEAF-.....----v.....................
ENSCJAP00000011922  ................FFVVVSFWFS.....FYMASLFLGILAMA--.....----hee...................
ENSCJAP00000039178  ................YFITLIFFLA.....WLVKNVFIAVIIETFA.....----ei....................
ENSCJAP00000034731  ...........pwmllYFISFLLIVA.....FFVLNMFVGVVVENFH.....K---cr....................
ENSCJAP00000011191  ................VLLLLQAILG.....SMVNAFMVGCMFVKI-.....----s.....................
ENSCJAP00000040639  ................LILIVQNIVG.....LMINAIMLGCIFM---.....----kt....................
ENSCJAP00000000427  ................----------.....----------------.....----......................
ENSCJAP00000039183  ....atdcgnyagalmYFCSFYVIIA.....YIMLNLLVAIIVENF-.....----s.....................
ENSCJAP00000009758  ................----------.....----------------.....----se....................
ENSCJAP00000039178  ....atdcgnyagalmYFCSFYVIIA.....YIMLNLLVAIIVENF-.....----s.....................
ENSCJAP00000043591  ................----------.....----------------.....----aa....................
ENSCJAP00000018307  ................LYFMTFYIVT.....MVVMTIIVAFILEAF-.....----v.....................
ENSCJAP00000003851  ................LALLDYLLLG.....LLA-------------.....----mllaveafskl...........
ENSCJAP00000018358  ................LYFMTFYIVT.....MVVMTIIVAFILEAF-.....----v.....................
ENSCJAP00000016835  ................----------.....----------------.....----n.....................
ENSCJAP00000016824  ................----------.....----------------.....----n.....................
ENSCJAP00000018307  ................FFIVYLSIEL.....YFIMNLLLAVVFDTF-.....----n.....................
ENSCJAP00000018358  ................FFIVYLSIEL.....YFIMNLLLAVVFDTF-.....----n.....................
ENSCJAP00000023858  ................ILGMVWAGFA.....MIIVASYTANLAAFLV.....----ldrpeeritgindprlrnpsdk
ENSCJAP00000023857  ................ILGMVWAGFA.....MIIVASYTANLAAFLV.....----ldrpeeritgindprlrnpsdk
ENSCJAP00000011719  ................YFTTFVFFMF.....FILLNMFLAIINDTYS.....----e.....................
ENSCJAP00000023869  ................ILGMVWAGFA.....MIIVASYTANLAAFLV.....----ldrpeeritgindprlrnpsdk
ENSCJAP00000011724  ................YFTTFVFFMF.....FILLNMFLAIINDTYS.....----e.....................
ENSCJAP00000031891  ................YFVTYVFFVF.....FVLLNMFLAIINDTYS.....----e.....................
ENSCJAP00000032813  ................----------.....----------------.....----ryvrn.................
ENSCJAP00000018176  ................IVGGVWWFFT.....LIIISSYTANLAAF--.....----l.....................
ENSCJAP00000029682  ................IVGGVWWFFT.....LIIISSYTANLAAF--.....----l.....................
ENSCJAP00000029731  ................IVGGVWWFFT.....LIIISSYTANLAAF--.....----l.....................
ENSCJAP00000029720  ................IVGGVWWFFT.....LIIISSYTANLAAF--.....----l.....................
ENSCJAP00000029725  ................IVGGVWWFFT.....LIIISSYTANLAAF--.....----l.....................
ENSCJAP00000016830  ................----------.....----------------.....----n.....................
ENSCJAP00000026317  ................----------.....----------------.....----dha...................
ENSCJAP00000031883  ................YFVTYVFFVF.....FVLLNMFLAIINDTYS.....----e.....................
ENSCJAP00000008550  ................IVGGVWWFFT.....LIIISSYTANLAAFL-.....----tv....................
ENSCJAP00000008592  ................IVGGVWWFFT.....LIIISSYTANLAAFL-.....----tv....................
ENSCJAP00000019881  ................----------.....----------------.....----......................
ENSCJAP00000018165  ................IVGGVWWFFT.....LIIISSYTANLAAFL-.....----tv....................
ENSCJAP00000008585  ................IVGGVWWFFT.....LIIISSYTANLAAFL-.....----tv....................
ENSCJAP00000051777  ................IVGGVWWFFT.....LIIISSYTANLAAFL-.....----tv....................
ENSCJAP00000008594  ................IVGGVWWFFT.....LIIISSYTANLAAFL-.....----tv....................
ENSCJAP00000043053  ................IVGGVWWFFT.....LIIISSYTANLAAFL-.....----tv....................
ENSCJAP00000018166  ................IVGGVWWFFT.....LIIISSYTANLAAFL-.....----tv....................
ENSCJAP00000043051  .............gtfLILTSVILMV.....LVVINLFVS-------.....----ailmaf................


                                                                             
                                                                             
d1orqc_               .......................................................
ENSCJAP00000001034  .......................................................
ENSCJAP00000006275  .......................................................
ENSCJAP00000011257  .......................................................
ENSCJAP00000051240  .......................................................
ENSCJAP00000040816  .......................................................
ENSCJAP00000041201  .......................................................
ENSCJAP00000041491  .......................................................
ENSCJAP00000000350  .......................................................
ENSCJAP00000002245  .......................................................
ENSCJAP00000006280  .......................................................
ENSCJAP00000000354  .......................................................
ENSCJAP00000002246  .......................................................
ENSCJAP00000002252  .......................................................
ENSCJAP00000043218  .......................................................
ENSCJAP00000002244  .......................................................
ENSCJAP00000006178  .......................................................
ENSCJAP00000006190  .......................................................
ENSCJAP00000011362  .......................................................
ENSCJAP00000042235  .......................................................
ENSCJAP00000006168  .......................................................
ENSCJAP00000020121  .......................................................
ENSCJAP00000006183  .......................................................
ENSCJAP00000013687  .......................................................
ENSCJAP00000007967  .......................................................
ENSCJAP00000013573  .......................................................
ENSCJAP00000020116  .......................................................
ENSCJAP00000028718  .......................................................
ENSCJAP00000000985  .......................................................
ENSCJAP00000049469  .......................................................
ENSCJAP00000014952  .......................................................
ENSCJAP00000032384  .......................................................
ENSCJAP00000007249  .......................................................
ENSCJAP00000027043  .......................................................
ENSCJAP00000050058  .......................................................
ENSCJAP00000037509  .......................................................
ENSCJAP00000014024  .......................................................
ENSCJAP00000037518  .......................................................
ENSCJAP00000037477  .......................................................
ENSCJAP00000037521  .......................................................
ENSCJAP00000018246  .......................................................
ENSCJAP00000011046  .......................................................
ENSCJAP00000036726  .......................................................
ENSCJAP00000003807  .......................................................
ENSCJAP00000011055  .......................................................
ENSCJAP00000035788  .......................................................
ENSCJAP00000035791  .......................................................
ENSCJAP00000035786  .......................................................
ENSCJAP00000035785  .......................................................
ENSCJAP00000005433  .......................................................
ENSCJAP00000018820  .......................................................
ENSCJAP00000032952  .......................................................
ENSCJAP00000032909  .......................................................
ENSCJAP00000005420  .......................................................
ENSCJAP00000021515  .......................................................
ENSCJAP00000018413  .......................................................
ENSCJAP00000036144  .......................................................
ENSCJAP00000018484  .......................................................
ENSCJAP00000018438  .......................................................
ENSCJAP00000034755  .......................................................
ENSCJAP00000011266  .......................................................
ENSCJAP00000034722  .......................................................
ENSCJAP00000011510  .......................................................
ENSCJAP00000011251  .......................................................
ENSCJAP00000011518  .......................................................
ENSCJAP00000011461  .......................................................
ENSCJAP00000035750  .......................................................
ENSCJAP00000011705  .......................................................
ENSCJAP00000024714  .......................................................
ENSCJAP00000032944  .......................................................
ENSCJAP00000032952  .......................................................
ENSCJAP00000032909  .......................................................
ENSCJAP00000040782  .......................................................
ENSCJAP00000011510  .......................................................
ENSCJAP00000011251  .......................................................
ENSCJAP00000011518  .......................................................
ENSCJAP00000011461  .......................................................
ENSCJAP00000035768  .......................................................
ENSCJAP00000038945  .......................................................
ENSCJAP00000038937  .......................................................
ENSCJAP00000024617  .......................................................
ENSCJAP00000011705  .......................................................
ENSCJAP00000035074  .......................................................
ENSCJAP00000035079  .......................................................
ENSCJAP00000008124  .......................................................
ENSCJAP00000011222  .......................................................
ENSCJAP00000011864  .......................................................
ENSCJAP00000011864  .......................................................
ENSCJAP00000024578  .......................................................
ENSCJAP00000018242  .......................................................
ENSCJAP00000024617  .......................................................
ENSCJAP00000000792  .......................................................
ENSCJAP00000008119  .......................................................
ENSCJAP00000014021  .......................................................
ENSCJAP00000001539  .......................................................
ENSCJAP00000006710  .......................................................
ENSCJAP00000048898  .......................................................
ENSCJAP00000011266  .......................................................
ENSCJAP00000001544  .......................................................
ENSCJAP00000018110  .......................................................
ENSCJAP00000008393  .......................................................
ENSCJAP00000018413  .......................................................
ENSCJAP00000008410  .......................................................
ENSCJAP00000018484  .......................................................
ENSCJAP00000018438  .......................................................
ENSCJAP00000018440  .......................................................
ENSCJAP00000014011  .......................................................
ENSCJAP00000013976  .......................................................
ENSCJAP00000050238  .......................................................
ENSCJAP00000013508  .......................................................
ENSCJAP00000050035  .......................................................
ENSCJAP00000013510  .......................................................
ENSCJAP00000013487  .......................................................
ENSCJAP00000008406  .......................................................
ENSCJAP00000001452  .......................................................
ENSCJAP00000007056  .......................................................
ENSCJAP00000007061  .......................................................
ENSCJAP00000024932  .......................................................
ENSCJAP00000024922  .......................................................
ENSCJAP00000005022  .......................................................
ENSCJAP00000015533  .......................................................
ENSCJAP00000015531  .......................................................
ENSCJAP00000036148  .......................................................
ENSCJAP00000018471  .......................................................
ENSCJAP00000036134  .......................................................
ENSCJAP00000051809  .......................................................
ENSCJAP00000018440  .......................................................
ENSCJAP00000051772  .......................................................
ENSCJAP00000001522  .......................................................
ENSCJAP00000043192  .......................................................
ENSCJAP00000002533  .......................................................
ENSCJAP00000008130  .......................................................
ENSCJAP00000014011  .......................................................
ENSCJAP00000001328  .......................................................
ENSCJAP00000001906  .......................................................
ENSCJAP00000049896  .......................................................
ENSCJAP00000042093  .......................................................
ENSCJAP00000014021  .......................................................
ENSCJAP00000013976  .......................................................
ENSCJAP00000050238  .......................................................
ENSCJAP00000024617  .......................................................
ENSCJAP00000051772  .......................................................
ENSCJAP00000001522  .......................................................
ENSCJAP00000008352  .......................................................
ENSCJAP00000043192  .......................................................
ENSCJAP00000001452  .......................................................
ENSCJAP00000009758  .......................................................
ENSCJAP00000001424  .......................................................
ENSCJAP00000001424  .......................................................
ENSCJAP00000009782  .......................................................
ENSCJAP00000009782  .......................................................
ENSCJAP00000008130  .......................................................
ENSCJAP00000005022  .......................................................
ENSCJAP00000004594  .......................................................
ENSCJAP00000036717  .......................................................
ENSCJAP00000001901  .......................................................
ENSCJAP00000034755  .......................................................
ENSCJAP00000011864  .......................................................
ENSCJAP00000005008  .......................................................
ENSCJAP00000034722  .......................................................
ENSCJAP00000034731  .......................................................
ENSCJAP00000024932  .......................................................
ENSCJAP00000024922  .......................................................
ENSCJAP00000008393  .......................................................
ENSCJAP00000008406  .......................................................
ENSCJAP00000008410  .......................................................
ENSCJAP00000024922  .......................................................
ENSCJAP00000018110  .......................................................
ENSCJAP00000024932  .......................................................
ENSCJAP00000014011  .......................................................
ENSCJAP00000009782  .......................................................
ENSCJAP00000008352  .......................................................
ENSCJAP00000011251  .......................................................
ENSCJAP00000011518  .......................................................
ENSCJAP00000011461  .......................................................
ENSCJAP00000009782  .......................................................
ENSCJAP00000032909  .......................................................
ENSCJAP00000011510  .......................................................
ENSCJAP00000051432  .......................................................
ENSCJAP00000011266  .......................................................
ENSCJAP00000024922  .......................................................
ENSCJAP00000003065  .......................................................
ENSCJAP00000049104  .......................................................
ENSCJAP00000032944  .......................................................
ENSCJAP00000032952  .......................................................
ENSCJAP00000008393  .......................................................
ENSCJAP00000008406  .......................................................
ENSCJAP00000008410  .......................................................
ENSCJAP00000013976  .......................................................
ENSCJAP00000050238  .......................................................
ENSCJAP00000008406  .......................................................
ENSCJAP00000008410  .......................................................
ENSCJAP00000008393  .......................................................
ENSCJAP00000051012  .......................................................
ENSCJAP00000011705  .......................................................
ENSCJAP00000024932  .......................................................
ENSCJAP00000051772  .......................................................
ENSCJAP00000014021  .......................................................
ENSCJAP00000001522  .......................................................
ENSCJAP00000026361  .......................................................
ENSCJAP00000023649  .......................................................
ENSCJAP00000043192  .......................................................
ENSCJAP00000009758  .......................................................
ENSCJAP00000001424  .......................................................
ENSCJAP00000024617  .......................................................
ENSCJAP00000051012  .......................................................
ENSCJAP00000009776  .......................................................
ENSCJAP00000047289  .......................................................
ENSCJAP00000049465  .......................................................
ENSCJAP00000011864  .......................................................
ENSCJAP00000014011  .......................................................
ENSCJAP00000013976  .......................................................
ENSCJAP00000050238  .......................................................
ENSCJAP00000014021  .......................................................
ENSCJAP00000001452  .......................................................
ENSCJAP00000051012  .......................................................
ENSCJAP00000024578  .......................................................
ENSCJAP00000043192  .......................................................
ENSCJAP00000001539  .......................................................
ENSCJAP00000001452  .......................................................
ENSCJAP00000001544  .......................................................
ENSCJAP00000051432  .......................................................
ENSCJAP00000011693  .......................................................
ENSCJAP00000032944  .......................................................
ENSCJAP00000032952  .......................................................
ENSCJAP00000032909  .......................................................
ENSCJAP00000018413  .......................................................
ENSCJAP00000018438  .......................................................
ENSCJAP00000018440  .......................................................
ENSCJAP00000005090  .......................................................
ENSCJAP00000011860  .......................................................
ENSCJAP00000051772  .......................................................
ENSCJAP00000001522  .......................................................
ENSCJAP00000009758  .......................................................
ENSCJAP00000011461  .......................................................
ENSCJAP00000008352  .......................................................
ENSCJAP00000036134  .......................................................
ENSCJAP00000011251  .......................................................
ENSCJAP00000011518  .......................................................
ENSCJAP00000032944  .......................................................
ENSCJAP00000011705  .......................................................
ENSCJAP00000018484  .......................................................
ENSCJAP00000018413  .......................................................
ENSCJAP00000036134  .......................................................
ENSCJAP00000000428  .......................................................
ENSCJAP00000018440  .......................................................
ENSCJAP00000018484  .......................................................
ENSCJAP00000018438  .......................................................
ENSCJAP00000005022  .......................................................
ENSCJAP00000018471  .......................................................
ENSCJAP00000051432  .......................................................
ENSCJAP00000011510  .......................................................
ENSCJAP00000028522  lmfrvgnlrnshmv.........................................
ENSCJAP00000005008  .......................................................
ENSCJAP00000008130  .......................................................
ENSCJAP00000005022  .......................................................
ENSCJAP00000036148  .......................................................
ENSCJAP00000009776  .......................................................
ENSCJAP00000018471  .......................................................
ENSCJAP00000036144  .......................................................
ENSCJAP00000018471  .......................................................
ENSCJAP00000036148  .......................................................
ENSCJAP00000001539  .......................................................
ENSCJAP00000001544  .......................................................
ENSCJAP00000015632  lkidllmdflnefyah.......................................
ENSCJAP00000045673  naaanvlretwliykh.......................................
ENSCJAP00000017214  naaanvlretwliykh.......................................
ENSCJAP00000030676  naaanvlretwliyk........................................
ENSCJAP00000048251  naaanvlretwliykh.......................................
ENSCJAP00000019483  lkidllmdflnefyah.......................................
ENSCJAP00000017218  naaanvlretwliykh.......................................
ENSCJAP00000031810  nvtaefretrrrlsveihdk...................................
ENSCJAP00000031809  nvtaefretrrrlsveihdk...................................
ENSCJAP00000031817  nvtaefretrrrlsveihdk...................................
ENSCJAP00000018110  .......................................................
ENSCJAP00000025797  naaanvlretwliykht......................................
ENSCJAP00000047563  naaanvlretwliykht......................................
ENSCJAP00000025796  naaanvlretwliykht......................................
ENSCJAP00000036144  .......................................................
ENSCJAP00000001539  .......................................................
ENSCJAP00000015636  lkidllmdflnefyah.......................................
ENSCJAP00000001544  .......................................................
ENSCJAP00000044387  .......................................................
ENSCJAP00000051406  naaanvlretwlis.........................................
ENSCJAP00000017751  .......................................................
ENSCJAP00000001424  .......................................................
ENSCJAP00000028312  nvtaefketrrrlsveiydk...................................
ENSCJAP00000039183  .......................................................
ENSCJAP00000018110  .......................................................
ENSCJAP00000039178  .......................................................
ENSCJAP00000011922  .......................................................
ENSCJAP00000007663  .......................................................
ENSCJAP00000032603  .......................................................
ENSCJAP00000009758  .......................................................
ENSCJAP00000025602  pnlv...................................................
ENSCJAP00000048019  ghitlesvsnflkdflhk.....................................
ENSCJAP00000010880  .......................................................
ENSCJAP00000028254  nvtaefketrrrlsveiydk...................................
ENSCJAP00000024637  esaarvlqeawrfykhtrrk...................................
ENSCJAP00000028292  nvtaefketrrrlsveiydk...................................
ENSCJAP00000021660  .......................................................
ENSCJAP00000021649  .......................................................
ENSCJAP00000028286  nvtaefketrrrlsveiydk...................................
ENSCJAP00000036223  .......................................................
ENSCJAP00000010869  .......................................................
ENSCJAP00000044387  .......................................................
ENSCJAP00000033717  .......................................................
ENSCJAP00000000198  .......................................................
ENSCJAP00000051538  .......................................................
ENSCJAP00000011266  .......................................................
ENSCJAP00000036144  .......................................................
ENSCJAP00000031810  .......................................................
ENSCJAP00000031809  .......................................................
ENSCJAP00000031817  .......................................................
ENSCJAP00000004803  .......................................................
ENSCJAP00000011922  .......................................................
ENSCJAP00000010847  .......................................................
ENSCJAP00000010844  .......................................................
ENSCJAP00000034853  .......................................................
ENSCJAP00000004793  .......................................................
ENSCJAP00000007663  .......................................................
ENSCJAP00000032603  .......................................................
ENSCJAP00000042788  .......................................................
ENSCJAP00000033365  .......................................................
ENSCJAP00000004804  .......................................................
ENSCJAP00000028286  .......................................................
ENSCJAP00000028292  .......................................................
ENSCJAP00000025789  naaanvlretwliykht......................................
ENSCJAP00000028254  .......................................................
ENSCJAP00000033361  .......................................................
ENSCJAP00000016635  .......................................................
ENSCJAP00000044520  .......................................................
ENSCJAP00000004712  .......................................................
ENSCJAP00000004717  .......................................................
ENSCJAP00000033717  .......................................................
ENSCJAP00000028312  .......................................................
ENSCJAP00000000665  .......................................................
ENSCJAP00000010822  .......................................................
ENSCJAP00000011922  .......................................................
ENSCJAP00000030680  naaanvlretwliyk........................................
ENSCJAP00000036134  .......................................................
ENSCJAP00000036148  .......................................................
ENSCJAP00000041691  .......................................................
ENSCJAP00000043961  .......................................................
ENSCJAP00000050339  .......................................................
ENSCJAP00000032611  .......................................................
ENSCJAP00000036223  .......................................................
ENSCJAP00000006678  talmhalvfgnvtaiiqrmysrwslyhtrtkdlkdfirvhhlpqqlkqrmleyfq
ENSCJAP00000002449  .......................................................
ENSCJAP00000028533  .......................................................
ENSCJAP00000008130  .......................................................
ENSCJAP00000033335  trqrihdyyehryq.........................................
ENSCJAP00000044017  .......................................................
ENSCJAP00000002449  .......................................................
ENSCJAP00000008352  .......................................................
ENSCJAP00000010847  .......................................................
ENSCJAP00000010844  .......................................................
ENSCJAP00000032608  .......................................................
ENSCJAP00000001064  .......................................................
ENSCJAP00000044773  .......................................................
ENSCJAP00000015112  .......................................................
ENSCJAP00000042307  .......................................................
ENSCJAP00000044603  .......................................................
ENSCJAP00000032611  .......................................................
ENSCJAP00000024941  .......................................................
ENSCJAP00000039178  .......................................................
ENSCJAP00000010822  .......................................................
ENSCJAP00000010657  .......................................................
ENSCJAP00000045969  .......................................................
ENSCJAP00000010880  .......................................................
ENSCJAP00000047810  .......................................................
ENSCJAP00000032608  .......................................................
ENSCJAP00000024941  .......................................................
ENSCJAP00000016592  .......................................................
ENSCJAP00000001064  .......................................................
ENSCJAP00000039183  .......................................................
ENSCJAP00000029287  .......................................................
ENSCJAP00000010869  .......................................................
ENSCJAP00000003851  .......................................................
ENSCJAP00000018351  .......................................................
ENSCJAP00000011922  .......................................................
ENSCJAP00000039178  .......................................................
ENSCJAP00000034731  .......................................................
ENSCJAP00000011191  .......................................................
ENSCJAP00000040639  .......................................................
ENSCJAP00000000427  .......................................................
ENSCJAP00000039183  .......................................................
ENSCJAP00000009758  .......................................................
ENSCJAP00000039178  .......................................................
ENSCJAP00000043591  .......................................................
ENSCJAP00000018307  .......................................................
ENSCJAP00000003851  .......................................................
ENSCJAP00000018358  .......................................................
ENSCJAP00000016835  .......................................................
ENSCJAP00000016824  .......................................................
ENSCJAP00000018307  .......................................................
ENSCJAP00000018358  .......................................................
ENSCJAP00000023858  fiyatvkqssvdiyfrrqvelstmyrhmekhnyesaaea................
ENSCJAP00000023857  fiyatvkqssvdiyfrrqvelstmyrhmekhnyesaaea................
ENSCJAP00000011719  .......................................................
ENSCJAP00000023869  fiyatvkqssvdiyfrrqvelstmyrhmekhnyesaaea................
ENSCJAP00000011724  .......................................................
ENSCJAP00000031891  .......................................................
ENSCJAP00000032813  .......................................................
ENSCJAP00000018176  .......................................................
ENSCJAP00000029682  .......................................................
ENSCJAP00000029731  .......................................................
ENSCJAP00000029720  .......................................................
ENSCJAP00000029725  .......................................................
ENSCJAP00000016830  .......................................................
ENSCJAP00000026317  .......................................................
ENSCJAP00000031883  .......................................................
ENSCJAP00000008550  .......................................................
ENSCJAP00000008592  .......................................................
ENSCJAP00000019881  .......................................................
ENSCJAP00000018165  .......................................................
ENSCJAP00000008585  .......................................................
ENSCJAP00000051777  .......................................................
ENSCJAP00000008594  .......................................................
ENSCJAP00000043053  .......................................................
ENSCJAP00000018166  .......................................................
ENSCJAP00000043051  .......................................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0041998 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes