SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Voltage-gated potassium channels alignments in Heterocephalus glaber v1.7-2

These alignments are sequences aligned to the 0037417 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                                                                                                    
                                                                                                    
d1f6ga_               mppmlsgll.....................................................................
HGL_H00000358784    argiaivsvlvilisivifcletlpefrdekdypaspsqdafkapsnstsgapaeassfsdpffvvetlciiwfsfel
HGL_H00000228858    sgparviaivsvmvilisivifcletlpelkdekdfsgtihridnstvvyssniftdpffivetlciiwfsfelvvrf
HGL_H00000358786    ssaarsvavvsvlvvvisitifcletlpefredrelkvgrdpslntnmtalsqtmftdpffvvestcivwftfelvlr
HGL_H00000328511    sspargiaivsvlvilisivifcletlpefrddrdlvmalstgagghggllndtlaprlenlghtifndpffivetvc
HGL_H00000218176    staalvfyyvtgffiavsvianvvetipcrspsrrlsreqscgdrfptaffcmdtacvliftgeyllrlfaapsrcrf
HGL_H00000415257    vilisivsfcletlpifrdenedmhgggvtfhtysnstmgyqqstsftdpffivetlciiwfsfeflvrffacpskag
HGL_H00000295082    scparvvavlsfllilvssvvmcmgtipelqvvdsegnrvehptlenvetacigwftleyllrlfsspnklhfalsfm
HGL_H00000360806    fivlstialslntlpelqsldefgqntdnpqlahveavciawftmeyllrflsspkkwkffkgplnaidllailpyyv
HGL_H00000265969    pyvafaslffilvsittfcletherfnpivnkteienvrngtqvryyreaeteafltyiegvcvvwftfeflmrvvfc
HGL_H00000358802    sraarvvafaslffilvsittfcletheafnidrnvteihrvgnitsvhfrrevetepiltyiegvcvlwftleflvr
HGL_H00000329426    dnpqlahveavciawftmeyllrflsspnkwkffkgplnvidllailpyyvtifltesnksvlqfqnvrrvv......
HGL_H00000371514    akamgvasnlfvlvsvvalalntveemqhqaeqgtggnpqpilehvemlcmsfftlefllrlfstpdlrrfarsalnl
HGL_H00000376966-2  fiafaslffilvsittfcletheafnivknktepvingtsvvlqyeietdpaltyvegvcvvwftfeflvrivfspnk
HGL_H00000303282    rcryvafaslffilisittfclethegfihisnktvtqaspipgappenitnvevetepfltyvegvcvvwftfeflm
HGL_H00000305824    asslsvvlasivamcvhsmselqgedreaddpvlegveiacitwftgelairlvaapcqkkfwknplniidfvsiipf
HGL_H00000297404    lswlnlqlleileyvciswftgefvvrflcvrdrcrflrkvpniidllailpfyitllveslsgsqttqelenvgriv
HGL_H00000221444    lpfndpffvvetlcifwfsfellvrllacpskaiffknvmnlidfvailpyfvalgtelarqrgvgqpamslai....
HGL_H00000287042    pgysvlsrvfsvlsilvvlgsiitmclnslpdfqipdsqgnpgedprfeivehfgiawftlelvarfavapdffqffk
HGL_H00000360626-1  glpgkvfaclsvlfvtvtavnlsvstlpslreeeeqgqcsqmchnvfivesvcvgwfslefllrfiqapskfaflrsp
HGL_H00000307694    pgyslpsklfscvsigvvlasiaamcihslpeyqareaaaavaavgagrnaddarddpvlrrleyfciawfsfevssr
HGL_H00000312129    glpgkvfaclsilfvattavslcvstmpdlraeedkgecsqkcyyifiveticvawfslefclrfvqarnkcrffqgp
HGL_H00000315654    ekcrslfvletvcvawfsfefllrslqaeskcaflrtplniidilailpfyvslllglaarpaggrlleraglv....
HGL_H00000262186    hyspfkavwdwlilllviytavftpysaafllketeegpqapdcgyacqplavvdlivdimfivdilinfrttyvnan
HGL_H00000318212    hyspfkavwdwlilllviytavftpysaafllsdqdesqrgacgytcspltmvdlivdimfvvdivinfrttyvnsnd
HGL_H00000384611    viieaicigwftaecivrfivsknkcefvkrplniidllaitpyyisvlmtvftgensqlqragvt............
HGL_H00000345055    wafvyhafvfllvfgclilsvfstipehtklasscllilefvmivvfglefiiriwsagcccryrgwqgrlrfarkpf
HGL_H00000346601    llvfsclvlsvfstikeyekssegalyileivtivvfgveyfvriwaagcccryrgwrgrlkfarkpfcvidimvlia
HGL_H00000331727    hyspfkavwdwlilllviytaiftpysaafllndreeqkrrecgyscsplnvvdlivdimfiidilinfrttyvnqne
HGL_H00000262916    wafvyhvfifllvfsclvlsvlstiqehqefanecllilefvmivvfgleyiirvwsagcccryrgwqgrfrfarkpf
HGL_H00000373648    llyhalvflivlgclilavlttfkeyetvsgdwlllletfaififgaefalriwaagcccrykgwrgrlkfarkplcm
HGL_H00000346534    hnwfetfiifmillssgalafediyieqrktirtileyadkvftyifilemllkwtaygfvkfftnawcwldflivav
HGL_H00000410257    hswfetfiifmillssgalafediyleerktikvlleyadkmftyvfvlemllkwvaygfkkyftnawcwldflivdv
HGL_H00000271751    fkttwdwiililtfytailvpynvsfktrqnnvawlvvdsivdviflvdivlnfhttfvgpagevisdpklirmnylk
HGL_H00000353206    hnwfetfivfmillssgalafediyieqrktiktmleyadkvftyifilemllkwvaygfqtyftnawcwldflivdv
HGL_H00000352011    hkmfdhvvlviiflncitiamerpkidphsaerifltlsnyiftavflaemtvkvvalgwcfgeqaylrsswnvldgl
HGL_H00000383028    hklfdyvvlafiflncitialerpqieagsterifltvsnyiftaifvgemtlkvvslglyfgeqaylrsswnvldgf
HGL_H00000348945    hkmfdhvvllfiflncitialerpdidpssteraflsvsnyiftaifvaemmvkvvalgllwgdcaylqsswnvldgl
HGL_H00000346534    qafdivimmliclnmvtmmvetdtqskqmenilywinlvfvifftcecvlkmfalrhyyftigwnifdfvvvilsivg
HGL_H00000333496    tstmalvfyyvtgffiavsvianvvetvpcgsspghikelpcgeryavaffcldtacvmiftveyllrlaaapsryrf
HGL_H00000348945    skyfnrgimvailvntlsmgvefheqpdeltnaleisnivftsmfalemllkllacgplgyiqnpynifdgiiviisv
HGL_H00000257981    ratwdgfillatlyvavtvpysvcvstarepsaargppsvcdlavevlfildivlnfrttfvsksgqvvfapksiclh
HGL_H00000364536    hswfesfivlmillssgalafediyiekkktikiileyadkiftyifilemllkwvaygyktyftnawcwldflivdv
HGL_H00000155840    eivlvvffgteyvvrlwsagcrskyvgiwgrlrfarkpisiidlivvvasmvvlcvgskgqvfatsairg........
HGL_H00000283256    qvfdisimiliclnmvtmmvetddqsqemtnilywinlvfivlftgecvlklislryyyftigwnifdfvvvilsivg
HGL_H00000384264    dpsgnayynwlfcitlpvmynwtmiiaracfdelqsdylgywlicdytsdiaylldmfvrtrtgyleqgllvkdkykl
HGL_H00000390600    hswfesfiifmillssgslafedcyldqkptvkalleyadrvftfifvfemllkwvaygfkkyftnawcwldflivni
HGL_H00000328813    stfkagwdwlillatfyvavtvpynvcfigndelsttrsttvsdiaveilfiidiilnfrttyvsksgqvifearsic
HGL_H00000261917    hpysdfrfywdltmlllmvgnliiipvgitffkdenttpwivfnvvsdtfflidlvlnfrtgivvednteiildpqri
HGL_H00000353206    rqvfdisimiliclnmvtmmvetddqskymtlvlsrinlvfivlftgefvlklislryyyftigwnifdfvvvilsiv
HGL_H00000264661    ysipkavwdglillatfyvavtipfnvcflgddapatprhvlisdvavemlfivdiilnfrttyvsqsgqvvsaprsi
HGL_H00000303540    rqvfdisimiliclnmvtmmvetddqsdyvtsvlsrinlvfivlftgecvlklislrhyyftigwnifdfvvvilsiv
HGL_H00000357342    lfywdlimlllmvgnlivlpvgitffkeensppwivfnvlsdtfflldlvlnfrtgivveegaeillaprairtrylr
HGL_H00000364536    qafditimvliclnmvtmmvekegqsdeminvlywinvvfiilftgecvlklislrhyyftvgwnifdfvvvilsivg
HGL_H00000350183    sqvfywivlslvalntacvaivhhnqpqwlthllyyaeflflglfllemslkmygmgprlyfhssfncfdfgvtvgsi
HGL_H00000319591-1  gskelpcgerysvaffcldtacvmiftveyllrlfaapsryrfirsvmsiidvvaimpyyiglvmtnnedvsgafv..
HGL_H00000006839    kqvfditimiliclnmvtmmvetddqsqlkvdilyninmifiiiftgecvlkmfalrqyyftigwnifdfvvvilsiv
HGL_H00000006839    hnwfetfivfmillssgalafediyieqrpvirtileyadkiftyifimemllkwvaygfkvyftnawcwldflivdv
HGL_H00000328478    dpagdwyyrwlfviampvlynwcllvaracfsdlqrgyflvwlvldyfsdliyiadlfirlrtgfleqgllvkdtkkl
HGL_H00000283256    hnwfetfivfmilvssgalafediyieqrktiktmleyadkvftyifilemllkwvaygfqvyftnawcwldflivdv
HGL_H00000277549    aqsfywvvlcvvalntlcvamvhynqpqrlttalyfaefvflglfltemslkmyglgprsyfrssfncfdfgvivgsi
HGL_H00000386761    dpsstlyyrwltvialpvfynwcllvcracfddlqsehltlwltldysadvlygldmlvrartgfleqglmvkdvkrl
HGL_H00000303540    hnwfetfivfmillssgalafediyidqrktiktmleyadkvftyifilemllkwvaygyqtyftnawcwldflivdv
HGL_H00000410257    qafdvtimfliclnmvtmmvetddqspekvnilskinllfvaiftgecivkmtalrhyyftnswnifdfvvvilsivg
HGL_H00000352011    skyfgrgimiailvntlsmgieyheqpspqqlhpsspvaaepagvyghlpanqtlvlqeeelglrnkqafggpfldsq
HGL_H00000288139    pfeymmfvlimlntlclamqhyeqskmfndamdilnmvftgvftvemvlkviafkpkgyfsdawntfdslivigsiid
HGL_H00000355192    skvfywlvilivalntlsiasehhnqplwlthlqdvanrvllalftiemlmkmyglglrqyfmsifnrfdcfvvcsgi
HGL_H00000385724    nvfywlviflvflntltiasehynqphwltevqdtankallalftaemllkmyslglqayfvslfnrfdcfivcggil
HGL_H00000400945    hqvfdvfimslivlnmvcmmvetrdqspdtdsvfehlntvfvtiftveclikvfalrqyyfingwnlfdcvvvvlsii
HGL_H00000355192    atwftnfillfillssaalaaedpiraestrnkileyfdiaftsvftveivlkmttygaflhkgsfcrnyfnildllv
HGL_H00000390600    rqafdvsimvliclnmitmmvetddqskektrvlgkinqffvavftgecvlkmfalrhyyftngwnvfdfivvflsig
HGL_H00000383028    skyfnrgimmailvntvsmgiehheqasvvglqlgssrstgsiqftqirppglpltlwlellpeeltnileicnvvft
HGL_H00000365441    aafeylmsllillntvalamqhyeqtapfnyamdilnmiftglftiemvlkiiafklkhyfadawntfdalivvgsiv
HGL_H00000352011    mlvillncvtlgmfrpcediacdsqrcrilqafddfifaffavemvvkmvalgifgkkcylgdtwnrldffiviagml
HGL_H00000383028    shyldifitfiiclnvvtmslehynqptsletalkycnymfttvfvleavlklvafglrrffkdrwnqldlaivllsv
HGL_H00000309052    slvfetfiflivflniimlmaqtfaevkirgewyfmafdciflsiyiieallkiislglqyfydpwnnldffvvvmav
HGL_H00000277549    sppfeyfimamialntvvlmmkfydapyeyelmlkclnivftsmfsmecvlkiiafgvlnyfrdawnvfdfvtvlgsi
HGL_H00000355192    kpfeiiilltifancvalavylpmpeddnntlnlglekleyfflivfsieaamkiiaygflfhqdaylrsgwnvldfi
HGL_H00000364536    fpnmlimctiltncifmtmssppewtknveytftgiytfeslikilargfcvgeftflrdpwnwldfvvivfayvtef
HGL_H00000277549    mryfetvilvvialssialaaedpvrtdssrnnalkymdyiftgvftfemvikmidlglllhpgayfrdlwnildfiv
HGL_H00000352011    shyldlfitgviglnvvtmamehyqqpqildealkicnyiftvifvlesvfklvafgfrrffqdrwnqldlaivllsi
HGL_H00000346534    pfvdlaiticivlntlfmamehhpmtpqfehvltvgnlvftgiftaemflkliamdpyyyfqegwnifdgfivslslm
HGL_H00000350183    lryfemcillviaassialaaedpvltnsernkvlryfdyvftgvftfemvikmidqglilqdgsyfrdlwnildfvv
HGL_H00000283256    pfvdlaiticivlntlfmamehypmteqfssvlsvgnlvftgiftaemflkiiamdpyyyfqegwnifdgfivslslm
HGL_H00000369268    dpsgdyyywwlntmvfpvmynliiivcracfpdlqhgylvawfvldytsdllylldivmhfhtgfleqgilvvdkgsi
HGL_H00000303540    pfvdlaiticivlntlfmamehypmtehfnnvltvgnlvftgiftaemflkiiamdpyyyfqegwnifdgfivtlslv
HGL_H00000385724    pdgkniakerveylfliiftveaflkviaygllfhpnaylrngwnlldfiivvvglfsaileqatkadganalggkga
HGL_H00000355192    ssyfeylmfalimlnticlgmqhynqseqmnhisdilnvaftiiftlemilklmafkargyfgdpwnvfdflivigsi
HGL_H00000288139    svtfywlvivlvflntltissehynqpgwltqiqdiankvllalftcemlikmyslglqayfvslfnrfdcfvvcggi
HGL_H00000385724    ylmfvlihygqsclfkiamnilnmlftglftvemilkliafkpkgyfsdpwnvfdflivigsiidvilsetnhyfcda
HGL_H00000277549    feymilatiiancivlaleqhlpdgdktpmserlddtepyfigifcfeagikiialgfvfhkgsylrngwnvmdfvvv
HGL_H00000348945    cvqafddfifaffavemvikmvalglfgqkcylgdtwnrldffivmagmmeysldghnvslsairtvrv.........
HGL_H00000288139    veyafliiftvetflkiiayglllhpnayvrngwnlldfvivivglfsvileqltketeggnhssgksggfdvka...
HGL_H00000006839    pfvdlgiticivlntlfmamehypmtehfdnvlsvgnlvftgiftaemvlklialdpyeyfqqgwnifdsiivtlslv
HGL_H00000350183    pfeymilatiiancivlaleqhlpeddktpmsrrlektepyfigifcfeagikivalgfifhkgsylrngwnvmdfiv
HGL_H00000383028    drckilqvfddfififfamemvlkmvalgifgkkcylgdtwnrldffivmagmveysldlqninlsairtv.......
HGL_H00000410257    pfadltitmcivlntlfmalehynmttefeemlqvgnlvftgiftaemtfkiialdpyyyfqqgwnifdsiivilslm
HGL_H00000346534    hslfsmiimctiltncvfmtfsnppewsknveytftgiytfesvvkilargfcidgftflrdpwnwldfsvimmayit
HGL_H00000288139    hhvftnlilvfimlssaalaaedpirshsfrntilgyfdyaftaiftveillkmttfgaflhkgafcrnyfnlldmlv
HGL_H00000353362    lryfemcilmviamssialaaedpvqpnaprnnvlryfdyvftgvftfemvikmidlglvlhqgayfrdlwnildfiv
HGL_H00000306275    gyghaapstdggkvfcmfyallgipltlvmfqslgerintfvryl.................................
HGL_H00000390600    pfaeltitlcivvntvfmamehhgmssafetmlqignivftifftaemvfkiiafdpyyyfqkkwnifdciivtvsll
HGL_H00000303540    lfsmlimctiltncvfmtmsnppdwtknveytftgiytfeslikiiargfcledftflrdpwnwldftvitfayvtef
HGL_H00000364536    pfvdlaiticivlntlfmamehhpmtlefknvlsvgnlvftgifaaemvlkliamdpyeyfqvgwnifdslivtlslv
HGL_H00000365441    hhvftnlilvfiilssvslaaedpirahsfrnhilgyfdyaftsiftveillkmtvfgallhrgsfcrswfnlldllv
HGL_H00000353362    tqafywtvlslvalntlcvaivhynqpdwlsdflyyaefiflglfmsemfikmyglgtrpyfhssfncfdcgviigsi
HGL_H00000283256    tlfnvlimctiltncvfmtmsnppdwtknveytftgiytfeslikilargfcledftflrdpwnwldftvitfayvte
HGL_H00000365441    ywavlllvflntltiasehhgqpvwltqtqecankvllclftaemllklyglgpsvyvasffnrfdcfvvcggilett
HGL_H00000348945    shyldlfitfiiglnvitmsvehynqpksldealkycnyvftvvfvfeaalklvafgfrrffkdrwnqldlaivllsi
HGL_H00000353206    pfvdlaiticivlntlfmamehypmtdqfssvltvgnlvftgiftaemvlkiiamdpyyyfqegwnifdgiivslslm
HGL_H00000410257    lrmlimctiltncvfmaqhdppswtkyveytftaiytfeslvkilargfclhaftflrdpwnwldfsvivmayvseni
HGL_H00000006839    sypamfimitiltncvfmtmsdpppwsknveytftgiytfeslikmlargfcidnftflrdpwnwldfsvilmayvte
HGL_H00000350183    spsfeytimamialntvvlmmkyysapctyelalkylniaftmvfslecvlkviafgflnyfrdtwnifdfitvigsi
HGL_H00000264773    ..............................................................................
HGL_H00000310568    i.............................................................................
HGL_H00000302166    pgtdagkafcmfyavlgipltlvmfqslgermntfvr.........................................
HGL_H00000222249    ..............................................................................
HGL_H00000251102    myilwlffvvlawnwncwlipvrwafpyqtpsnihlwllmdylcdliyllditifqirlqfvrggdiimdkkdmrnny
HGL_H00000365441    kpfdililltifancvalgvyipfpeddsntanhnleqveyvflviftmetvlkivayglvlhpsayirngwnlldfi
HGL_N10019168       tls...........................................................................
HGL_H00000385724    gnadyvftsiftleiilkmtaygaflhkgsfcrnyfnildllvvsvslisfgiqssainvv.................
HGL_H00000251127    vtyldwvmivvticscismmfespfrrvmhaptlqiaeyvfvifmsielnlkimadglfftptavirdfggvmdifiy
HGL_H00000294725    ykndlhraiqrtqs................................................................
HGL_H00000384427    r.............................................................................
HGL_H00000316605    tdrlyllwlllvtiaynwncwliplrvvfpyqtpdnthywlitdiicdiiylcdmlliqprlkfirggeiivdstelk
HGL_H00000400945    iqnllnctdniftsifvlemalkwvafgfrkyftnawcwldfiivvvsvvvsfvdlqkwka.................
HGL_H00000243457    gq............................................................................
HGL_H00000271915    ..............................................................................
HGL_H00000394033    nis...........................................................................
HGL_H00000386251    rg............................................................................
HGL_H00000391498-1  r.............................................................................
HGL_H00000355580    verh..........................................................................
HGL_H00000390600    vhsyplpncffhlyvftviytfealikilargfclnefaylrdpwnwldfsvitlayvgtatelkgfsglrtfrvlra
HGL_H00000341006    hpafhlllasllvtnaitialrtnsfldqkhyelfsvidnivlttlicevllrwlsdfwifwkdgwnilnffivcmlv
HGL_H00000334650    gl............................................................................
HGL_H00000298480    pilwverkltlwviqvivatisfletmlliylsykgniweqifrvsfvlemintlpfiitvfwaplrn..........
HGL_H00000353362    nyfrdawnifdfvtvlgsitdilvtefgnnfinlsf..........................................
HGL_H00000310568    vm............................................................................
HGL_H00000328150    ksq...........................................................................
HGL_H00000400945    pftelaiticiiintiflamehhgmntdfkkmlktgnwvftgifmaemclkiialdpyhyfrhgwnifdsivavvslt
HGL_H00000357067    v.............................................................................
HGL_H00000402797    amr...........................................................................
HGL_H00000306497    ksq...........................................................................
HGL_H00000386796    rvfnaiimvliclqamimmiesddqslqmdlalywinatfvmlytvecilklisfhcyyftivwnildfmvvifsitg
HGL_H00000383330    nv............................................................................
HGL_H00000339960-2  qet...........................................................................
HGL_H00000263372    ygyttpltdagkafsiafallgvpitmllltasaqrlglllthaplswlsf...........................
HGL_H00000345708    ni............................................................................
HGL_H00000341479    a.............................................................................
HGL_H00000355580    rr............................................................................
HGL_H00000240662    ni............................................................................
HGL_H00000391498-2  gygnlapstglgqvfcvfyalvgiplnvvflnhlgtglrthlatlerreeqpqcsqvlglg.................
HGL_H00000352527    ..............................................................................
HGL_H00000376438    gsyvv.........................................................................
HGL_H00000352527    l.............................................................................
HGL_H00000334650    rldi..........................................................................
HGL_H00000316136    sr............................................................................
HGL_H00000402797    rvl...........................................................................
HGL_H00000386796    pftdlfificiilnthilalehypmsedtsyflsigniacigiftaemilkiiamhpyqyfqvgwnifdsiivflglt
HGL_H00000361952    nm............................................................................
HGL_H00000357068    k.............................................................................
HGL_H00000251127    svfhmfilsmvtvdvivaasnyykgenfrrqydefylaevaftvlfdleallkiwclgftgyissslhkfelllvigt
HGL_H00000381911    l.............................................................................
HGL_H00000386796    wfkcfiglvtllstgalafediyidqrktikilleyadmiftyifilemllkwmaygfkayfsnawyrldfmvvivfc
HGL_H00000361952    k.............................................................................
HGL_H00000371180    pwfknlitfliilnaivrmitielldstnnslwplklslevavwfilpvftveillkwvasfslfwknawnvfdftvt
HGL_H00000353206    lgnvsalrtfrvlralktisvipglktivgaliqsvkklsdvmiltvfclsvfaliglqlfmgnlrnkclqwppsnsa
HGL_H00000344820    r.............................................................................
HGL_H00000251287    las...........................................................................
HGL_H00000391498-1  lg............................................................................
HGL_M00000049206    fkttwdwvililtfytaimv..........................................................
HGL_H00000353206    qdmlimctiltncvfmtlsnppdwtknveytftgiytfeslikilargfcledftflrdpwnwldfsviv........
HGL_H00000251127    pwvhsllricaiisvisvcmntpmtfehypplqyvtftldtllmflytaemiakmhirgivkgdssyvkdrwcvfdgf
HGL_H00000294309    hyyfdylgniialgnlvsicvflvqdadvlprnrddfvlgildcifilyyvlelllkvfalgpwgylsypsnvcdgll
HGL_H00000282611    sqairisemvfvaiytsefsmkvyvdpinywkdgynlldvviiiiifipyvlhevkgkhfrylnitdgi.........
HGL_H00000294309    snlcqrtlsftiflilflafietpssltrtadvryrslpweppcglmegvellcllvfvadvsvkgylvgwsqfqrnl
HGL_H00000319591-2  ..............................................................................
HGL_H00000344820    allqatg.......................................................................
HGL_H00000251127    ffkrtiallvlaqsvllsvkwdvedpvtvplatmsvvftfifvlevtmkiiamspagfwqsrrnrydllvtslgvvwv
HGL_H00000400945    krafmfiictvvvnclfmamagvkesnkprtdiaeiadldpnsqiklls.............................
HGL_H00000353362    sppfeytimamialntivlmmkfygasaayenalrvfnivf.....................................
HGL_H00000376350    skafqyfmylvvavngmwilvetfmlkggnffpkhvpwsylvfltiygvelflkvagfgpveylssgwnlfdfsvtvf
HGL_H00000394033    dtainv........................................................................
HGL_H00000237596    flaaceiifcffvlyyaveeileirihklhyfrsfwncldvvivvlsgiaiginiyqtssvegllyfledqntfpnfe
HGL_H00000360601    ldsfmqpfqs....................................................................
HGL_H00000376350    giyvhatlelfalmvvvcelcmklrwlglhtfvrhkrtmvktsvlvvqfveaivvlvrqtshvrvtralrciflvdcr
HGL_R00000005229    a.............................................................................
HGL_N10008871       irlycfynhwtmrvatyificvdlslalfeepalfplpfvatalaevlclaafsarlvhfakvtpqmvfwkdtknici
HGL_H00000360302    vfayig........................................................................
HGL_N10008871       fvwaydviilinaicialdekhpfisyaewlflalyiieillklytyepr............................
HGL_H00000242607    shrfqviiiclvvldallvlaelildlkiikadknkyaaqvfhwms................................
HGL_H00000410146    yei...........................................................................
HGL_H00000373594    nsflvacvilvvilltlellidikllqfssalqfasiihwi.....................................
HGL_H00000282499    eiw...........................................................................
HGL_H00000307342    h.............................................................................
HGL_H00000282611    fkdpleisemvfvaiytsefsmkvyvdpinywkdgynlldvvii..................................
HGL_H00000364536    fnfetfgnsmiclfqittsagwdgllapilnsgppdcdpekehpgssvkgdcgnpsvgify.................
HGL_H00000285900    yei...........................................................................
HGL_H00000325296    ffiigckivfcififyygveei........................................................
HGL_H00000377482    feyigylailmntfpiiiswisllneiyvyeirrasyffltlyil.................................


                                                                                                    
                                                                                                    
d1f6ga_               ..............................................................................
HGL_H00000358784    lvrffacpskatfsrnimnlidivaiipyfitlgtelaerqgngqqamslai..........................
HGL_H00000228858    facpsktdffknimnfidivaiipyfitlgteiaeqegnqkgeqatslai............................
HGL_H00000358786    fmvcpsktdffrnimniidvisiipyfatviteqvqetepsaqqnmslai............................
HGL_H00000328511    ivwfsfefvvrcfacpsqalffknimniidivsilpyfitlgtdlaqqqegsngqqqqamsfai..............
HGL_H00000218176    lrsvmslidvvailpyyiglfvpknddvsgafv.............................................
HGL_H00000415257    fftnimniidivaiipyfitlgtelaekpedaqqgqqamslai...................................
HGL_H00000295082    nivdvlailpfyvsltlthlgarmmeltnvqqav............................................
HGL_H00000360806    tifltesnksvlqfqnvrrvv.........................................................
HGL_H00000265969    pnkvefiknslniidfvailpfylevglsglsskaakdvlgf....................................
HGL_H00000358802    ivccpdtldfvknllniidfvailpfylevglsglsskaardvlgf................................
HGL_H00000329426    ..............................................................................
HGL_H00000371514    vdlvailplylqlllecftsedqghgkgsprghdlgtvgrvgkvgqv...............................
HGL_H00000376966-2  lefiknllniidfvailpfylevglsglsskaakdvlgf.......................................
HGL_H00000303282    ritfcpdkveflksslniidcvailpfylevglsglsskaakdvlgf...............................
HGL_H00000305824    yatlavdtkeeesedienmgkvv.......................................................
HGL_H00000297404    ..............................................................................
HGL_H00000221444    ..............................................................................
HGL_H00000287042    nalnlidlmsivpfyitlvvnlvvestptlanlgrva.........................................
HGL_H00000360626-1  ltlidlvailpyyvtlmvdgaasgrrkpssgnsyldkvglv.....................................
HGL_H00000307694    lllapstrnffchplnlidivsvlpfyltllagialgdrdggsgeelgdlgkvv........................
HGL_H00000312129    lniidilaispyyvslvvseeppedgerpngssylekvglv.....................................
HGL_H00000315654    ..............................................................................
HGL_H00000262186    eevvshpgriavhyfkgwflidmvaaipfdllifgsgseeligl..................................
HGL_H00000318212    evvshprriavhyfkgwflidmvaaipfdllifrtgsdetttligl................................
HGL_H00000384611    ..............................................................................
HGL_H00000345055    cvidtivliasiavvsaktqgnifatsalrs...............................................
HGL_H00000346601    siavlaagsqgnvfatsalrs.........................................................
HGL_H00000331727    evvsdpakiaihyfkgwflidmvaaipfdllifgsgsdetttligl................................
HGL_H00000262916    cvidfivfvasvaviaagtqgnifatsalrs...............................................
HGL_H00000373648    ldifvliasvpvvavgnqgnvlatslrs..................................................
HGL_H00000346534    slvslianalgyselgaiks..........................................................
HGL_H00000410257    slvslvantlgfsemgpiks..........................................................
HGL_H00000271751    twfvidllsclpydvinafenvdevsafmgdpgkidfadqippplegresqgisslfss...................
HGL_H00000353206    slvslvanalgyselgaiks..........................................................
HGL_H00000352011    lvlisvidilvsmvsdsgtkilgm......................................................
HGL_H00000383028    lvfvsiidivvsvasaggakilgv......................................................
HGL_H00000348945    lvlvslvdiivamasaggakilgi......................................................
HGL_H00000346534    mfladiiekyfvsptlf.............................................................
HGL_H00000333496    vrsvmsiidvvailpyyiglvmtdnedvsgafv.............................................
HGL_H00000348945    weivgqadgglsvl................................................................
HGL_H00000257981    yvttwflldviaalpfdllhafkvnvyfgahl..............................................
HGL_H00000364536    svvtlvastlgysdlgpiks..........................................................
HGL_H00000155840    ..............................................................................
HGL_H00000283256    mflaeliekyfvsptlf.............................................................
HGL_H00000384264    iekyksnlqfkldfvsmiptdvlyfklgwdype.............................................
HGL_H00000390600    slisliakilkysdmesika..........................................................
HGL_H00000328813    ihyvttwfiidliaalpfdllyafnvtvvslvhl............................................
HGL_H00000261917    kmkylkswfvvdfissipvdyiflivetridsevyktaralrivrftkilsl..........................
HGL_H00000353206    gmflaeliekyfvsptlf............................................................
HGL_H00000264661    glhylatwffvdliaalpfdllyifnvtvtslvhl...........................................
HGL_H00000303540    gmflaeliekyfvsptlf............................................................
HGL_H00000357342    twflvdfissipvdyiflvveleprldtevyktaralrivrftkilsl..............................
HGL_H00000364536    mflaeliekyfvsptlf.............................................................
HGL_H00000350183    fevvwaifrpgtsfgisv............................................................
HGL_H00000319591-1  ..............................................................................
HGL_H00000006839    glalseliqkyfvsptlf............................................................
HGL_H00000006839    siislvanwlgyselgpiks..........................................................
HGL_H00000328478    rdnyihtlqfkldvasviptdliyfavgihnpe.............................................
HGL_H00000283256    slvsltanalgyselgaiks..........................................................
HGL_H00000277549    fevvwaaikpgtsfgisv............................................................
HGL_H00000386761    wkhytktlqfkldmlslvptdlaylklgmsype.............................................
HGL_H00000303540    slvsltanalgyselgaiks..........................................................
HGL_H00000410257    gnlcsnpllhfknwviflll..........................................................
HGL_H00000352011    pcphfpgilrpeeltnaleisnivftslfalemllkllvygpfgyiknpynifdgvivvisvweivgqqggglsv...
HGL_H00000288139    valseadptesdnvpvptatpgnseesnrisit.............................................
HGL_H00000355192    leillvesgamtplgisv............................................................
HGL_H00000385724    etilvetkimsplgisv.............................................................
HGL_H00000400945    stlvtlvgksktipfpptlf..........................................................
HGL_H00000355192    vavslismglessaisvv............................................................
HGL_H00000390600    ..............................................................................
HGL_H00000383028    smfalemilklaafglfdylrnpynifdsiiviisiweivgqadgglsv.............................
HGL_H00000365441    diavtevnssedssrisi............................................................
HGL_H00000352011    eysldlqnvsfsavrtvrv...........................................................
HGL_H00000383028    mgitleeieinaalpinpti..........................................................
HGL_H00000309052    ldfllmqvnslfsfynhslfrilkvlki..................................................
HGL_H00000277549    tdilvteiannfinlsf.............................................................
HGL_H00000355192    ivflgvftvvleqvniiqsntapmsskgagldvka...........................................
HGL_H00000364536    vdlgnvsalrtfrvlralktisvipglktivgaliqsvkklsdvmiltvfclsvfaliglqlfmgnlrhkcvqlefae
HGL_H00000277549    vsgalvafafsgskgkdintiks.......................................................
HGL_H00000352011    mgitleeievnaslpinpti..........................................................
HGL_H00000346534    elsladveglsv..................................................................
HGL_H00000350183    vvgalvafalatnkgrdiktiks.......................................................
HGL_H00000283256    elglanveglsv..................................................................
HGL_H00000369268    asryvrtwsfvldmasliptdlvylrlgphipm.............................................
HGL_H00000303540    elglanveglsv..................................................................
HGL_H00000385724    gfdvka........................................................................
HGL_H00000355192    idvilseidtflassgglyclgggcgnvdpdesarissa.......................................
HGL_H00000288139    tetilveleimsplgis.............................................................
HGL_H00000385724    wntfdalivvgsivdiaitevnpaehtqcspsmnaeensrisit..................................
HGL_H00000277549    ltgilatagtdfd.................................................................
HGL_H00000348945    ..............................................................................
HGL_H00000288139    ..............................................................................
HGL_H00000006839    elglanvqglsv..................................................................
HGL_H00000350183    vlsgilatagthfnthvd............................................................
HGL_H00000383028    ..............................................................................
HGL_H00000410257    elglsrmgnlsv..................................................................
HGL_H00000346534    efvnlgnvsalrtfrvlralktisvipglktivgaliqsvkklsdvmiltvfclsvfaliglqlfmgnlrnkcvvwpi
HGL_H00000288139    vgvslvsfgiqssaisvv............................................................
HGL_H00000353362    vsgalvafaftgnskgkdintiks......................................................
HGL_H00000306275    ..............................................................................
HGL_H00000390600    elsvvrkgslsv..................................................................
HGL_H00000303540    vdlgnvsalrtfrvlralktisvipglktivgaliqsvkklsdvmiltvfclsvfaliglqlfmgnlrnkciqwpatn
HGL_H00000364536    elflshveglsv..................................................................
HGL_H00000365441    vsvslisfgihssaisvv............................................................
HGL_H00000353362    feviwavikpgtsfgisv............................................................
HGL_H00000283256    fvdlgnvsalrtfrvlralktisvipglktivgaliqsvkklsdvmiltvfclsvfaliglqlfmgnlrnkclqwppd
HGL_H00000365441    lvevgamqplgis.................................................................
HGL_H00000348945    mgialeeiemnaalpinpti..........................................................
HGL_H00000353206    elglanveglsv..................................................................
HGL_H00000410257    klgnlsalrtfrvlralktisvipglktivgaliqsvkkladvmvltvfclsvfaliglqlfmgnlrhkcvrnftaln
HGL_H00000006839    fvdlgnisalrtfrvlralktitvipglktivgaliqsvkklsdvmiltvfclsvfalvglqlfmgnlrqkcirwppp
HGL_H00000350183    teiiltdsklvntsgfnmsflklx......................................................
HGL_H00000264773    ..............................................................................
HGL_H00000310568    ..............................................................................
HGL_H00000302166    ..............................................................................
HGL_H00000222249    ..............................................................................
HGL_H00000251102    lksrrfkmdvvcllpldflylkfgvnpl..................................................
HGL_H00000365441    ivvvglsqpppptglhivlnsilkalvpllhiallvl.........................................
HGL_N10019168       ..............................................................................
HGL_H00000385724    ..............................................................................
HGL_H00000251127    lvsliflcwmpqnvpaesgaqllmv.....................................................
HGL_H00000294725    ..............................................................................
HGL_H00000384427    ..............................................................................
HGL_H00000316605    rhyrnstkfqldmasiipfdvfylflgynpi...............................................
HGL_H00000400945    ..............................................................................
HGL_H00000243457    ..............................................................................
HGL_H00000271915    ..............................................................................
HGL_H00000394033    ..............................................................................
HGL_H00000386251    ..............................................................................
HGL_H00000391498-1  ..............................................................................
HGL_H00000355580    ..............................................................................
HGL_H00000390600    lktvsvipglkvivgalihsvrkltdvtiltvfclsvfalvglqlfkgnlknkcirngttvlqapncssrmyeyatkp
HGL_H00000341006    lgvldvvnvsitycl...............................................................
HGL_H00000334650    ..............................................................................
HGL_H00000298480    ..............................................................................
HGL_H00000353362    ..............................................................................
HGL_H00000310568    ..............................................................................
HGL_H00000328150    ..............................................................................
HGL_H00000400945    eaiaakwvf.....................................................................
HGL_H00000357067    ..............................................................................
HGL_H00000402797    ..............................................................................
HGL_H00000306497    ..............................................................................
HGL_H00000386796    lflpmtvghylvppslvqlillsri.....................................................
HGL_H00000383330    ..............................................................................
HGL_H00000339960-2  ..............................................................................
HGL_H00000263372    ..............................................................................
HGL_H00000345708    ..............................................................................
HGL_H00000341479    ..............................................................................
HGL_H00000355580    ..............................................................................
HGL_H00000240662    ..............................................................................
HGL_H00000391498-2  ..............................................................................
HGL_H00000352527    ..............................................................................
HGL_H00000376438    ..............................................................................
HGL_H00000352527    ..............................................................................
HGL_H00000334650    ..............................................................................
HGL_H00000316136    ..............................................................................
HGL_H00000402797    ..............................................................................
HGL_H00000386796    elflasierlsil.................................................................
HGL_H00000361952    ..............................................................................
HGL_H00000357068    ..............................................................................
HGL_H00000251127    tlhvypdlyhsqftyfqvlrvvrlikispaledfvykifgpgkklgslv.............................
HGL_H00000381911    ..............................................................................
HGL_H00000386796    lsligktqedlkplasi.............................................................
HGL_H00000361952    ..............................................................................
HGL_H00000371180    llpllyeilvlggvtghpvwlellsic...................................................
HGL_H00000353206    fetntttyfngtmdsngtfinitmstfnw.................................................
HGL_H00000344820    ..............................................................................
HGL_H00000251287    ..............................................................................
HGL_H00000391498-1  ..............................................................................
HGL_M00000049206    ..............................................................................
HGL_H00000353206    ..............................................................................
HGL_H00000251127    mvfclwvslvlqvfeiadivdqmspwgml.................................................
HGL_H00000294309    tsillvleistlavygfphprwkpetlgllslwdmtrlvnmlivfrflriipnmkpmamvvstvlglvqnlrafgg..
HGL_H00000282611    ..............................................................................
HGL_H00000294309    wllayltvlvvslvdwtvslsllcqep...................................................
HGL_H00000319591-2  ..............................................................................
HGL_H00000344820    ..............................................................................
HGL_H00000251127    vlhfallnaytymmgacvivfrffsicgkhvtlkml..........................................
HGL_H00000400945    ..............................................................................
HGL_H00000353362    ..............................................................................
HGL_H00000376350    aflgllalalnmepfyfivv..........................................................
HGL_H00000394033    ..............................................................................
HGL_H00000237596    hlaswqiqfnsiaaitvflvw.........................................................
HGL_H00000360601    ..............................................................................
HGL_H00000376350    ycggvrrnlr....................................................................
HGL_R00000005229    ..............................................................................
HGL_N10008871       mvtivvtlidliiygsleavhihsirwtralrpvflinfpesrq..................................
HGL_H00000360302    ..............................................................................
HGL_N10008871       ..............................................................................
HGL_H00000242607    ..............................................................................
HGL_H00000410146    ..............................................................................
HGL_H00000373594    ..............................................................................
HGL_H00000282499    ..............................................................................
HGL_H00000307342    ..............................................................................
HGL_H00000282611    ..............................................................................
HGL_H00000364536    ..............................................................................
HGL_H00000285900    ..............................................................................
HGL_H00000325296    ..............................................................................
HGL_H00000377482    ..............................................................................


                                                                                                    
                                                                                                    
d1f6ga_               ..............................................................................
HGL_H00000358784    ..............................................................................
HGL_H00000228858    ..............................................................................
HGL_H00000358786    ..............................................................................
HGL_H00000328511    ..............................................................................
HGL_H00000218176    ..............................................................................
HGL_H00000415257    ..............................................................................
HGL_H00000295082    ..............................................................................
HGL_H00000360806    ..............................................................................
HGL_H00000265969    ..............................................................................
HGL_H00000358802    ..............................................................................
HGL_H00000329426    ..............................................................................
HGL_H00000371514    ..............................................................................
HGL_H00000376966-2  ..............................................................................
HGL_H00000303282    ..............................................................................
HGL_H00000305824    ..............................................................................
HGL_H00000297404    ..............................................................................
HGL_H00000221444    ..............................................................................
HGL_H00000287042    ..............................................................................
HGL_H00000360626-1  ..............................................................................
HGL_H00000307694    ..............................................................................
HGL_H00000312129    ..............................................................................
HGL_H00000315654    ..............................................................................
HGL_H00000262186    ..............................................................................
HGL_H00000318212    ..............................................................................
HGL_H00000384611    ..............................................................................
HGL_H00000345055    ..............................................................................
HGL_H00000346601    ..............................................................................
HGL_H00000331727    ..............................................................................
HGL_H00000262916    ..............................................................................
HGL_H00000373648    ..............................................................................
HGL_H00000346534    ..............................................................................
HGL_H00000410257    ..............................................................................
HGL_H00000271751    ..............................................................................
HGL_H00000353206    ..............................................................................
HGL_H00000352011    ..............................................................................
HGL_H00000383028    ..............................................................................
HGL_H00000348945    ..............................................................................
HGL_H00000346534    ..............................................................................
HGL_H00000333496    ..............................................................................
HGL_H00000348945    ..............................................................................
HGL_H00000257981    ..............................................................................
HGL_H00000364536    ..............................................................................
HGL_H00000155840    ..............................................................................
HGL_H00000283256    ..............................................................................
HGL_H00000384264    ..............................................................................
HGL_H00000390600    ..............................................................................
HGL_H00000328813    ..............................................................................
HGL_H00000261917    ..............................................................................
HGL_H00000353206    ..............................................................................
HGL_H00000264661    ..............................................................................
HGL_H00000303540    ..............................................................................
HGL_H00000357342    ..............................................................................
HGL_H00000364536    ..............................................................................
HGL_H00000350183    ..............................................................................
HGL_H00000319591-1  ..............................................................................
HGL_H00000006839    ..............................................................................
HGL_H00000006839    ..............................................................................
HGL_H00000328478    ..............................................................................
HGL_H00000283256    ..............................................................................
HGL_H00000277549    ..............................................................................
HGL_H00000386761    ..............................................................................
HGL_H00000303540    ..............................................................................
HGL_H00000410257    ..............................................................................
HGL_H00000352011    ..............................................................................
HGL_H00000288139    ..............................................................................
HGL_H00000355192    ..............................................................................
HGL_H00000385724    ..............................................................................
HGL_H00000400945    ..............................................................................
HGL_H00000355192    ..............................................................................
HGL_H00000390600    ..............................................................................
HGL_H00000383028    ..............................................................................
HGL_H00000365441    ..............................................................................
HGL_H00000352011    ..............................................................................
HGL_H00000383028    ..............................................................................
HGL_H00000309052    ..............................................................................
HGL_H00000277549    ..............................................................................
HGL_H00000355192    ..............................................................................
HGL_H00000364536    netaisaldnfenkedlkkyvyylegskdallcgfstdsgqcpegykcvklgrnpdygytsfdtfswaflalfrlmtq
HGL_H00000277549    ..............................................................................
HGL_H00000352011    ..............................................................................
HGL_H00000346534    ..............................................................................
HGL_H00000350183    ..............................................................................
HGL_H00000283256    ..............................................................................
HGL_H00000369268    ..............................................................................
HGL_H00000303540    ..............................................................................
HGL_H00000385724    ..............................................................................
HGL_H00000355192    ..............................................................................
HGL_H00000288139    ..............................................................................
HGL_H00000385724    ..............................................................................
HGL_H00000277549    ..............................................................................
HGL_H00000348945    ..............................................................................
HGL_H00000288139    ..............................................................................
HGL_H00000006839    ..............................................................................
HGL_H00000350183    ..............................................................................
HGL_H00000383028    ..............................................................................
HGL_H00000410257    ..............................................................................
HGL_H00000346534    nfnesylengtrgfdweeyinnktnfytvsgmlepllcgnssdagqcpegyqcmkagrnpnygytsfdtfswaflalf
HGL_H00000288139    ..............................................................................
HGL_H00000353362    ..............................................................................
HGL_H00000306275    ..............................................................................
HGL_H00000390600    ..............................................................................
HGL_H00000303540    asleehsieknitvdyngtlvnetvyefdwktyiqdsryhyflegfldallcgnssdagqcpegyicvkagrnpnygy
HGL_H00000364536    ..............................................................................
HGL_H00000365441    ..............................................................................
HGL_H00000353362    ..............................................................................
HGL_H00000283256    nssfeinitsffnnsldgngtafnrtvsmfnwddyiedkshfyflegqndallcgnssdagqcpegyicvkagrnpny
HGL_H00000365441    ..............................................................................
HGL_H00000348945    ..............................................................................
HGL_H00000353206    ..............................................................................
HGL_H00000410257    dtngsveaeglvwesldlylndpvnyllkngtsdvllcgnssdagtcpegyrclkagenpdhgytsfdsfawaflalf
HGL_H00000006839    fndtkatwsgndtwygndtwygndtwshmswannytfdwdayindegnyyflegandallcgnssdaghcpegyecmk
HGL_H00000350183    ..............................................................................
HGL_H00000264773    ..............................................................................
HGL_H00000310568    ..............................................................................
HGL_H00000302166    ..............................................................................
HGL_H00000222249    ..............................................................................
HGL_H00000251102    ..............................................................................
HGL_H00000365441    ..............................................................................
HGL_N10019168       ..............................................................................
HGL_H00000385724    ..............................................................................
HGL_H00000251127    ..............................................................................
HGL_H00000294725    ..............................................................................
HGL_H00000384427    ..............................................................................
HGL_H00000316605    ..............................................................................
HGL_H00000400945    ..............................................................................
HGL_H00000243457    ..............................................................................
HGL_H00000271915    ..............................................................................
HGL_H00000394033    ..............................................................................
HGL_H00000386251    ..............................................................................
HGL_H00000391498-1  ..............................................................................
HGL_H00000355580    ..............................................................................
HGL_H00000390600    gtsdpllcgngtgaglcpdgyvclktcdnpdfnytsfdsfawafls................................
HGL_H00000341006    ..............................................................................
HGL_H00000334650    ..............................................................................
HGL_H00000298480    ..............................................................................
HGL_H00000353362    ..............................................................................
HGL_H00000310568    ..............................................................................
HGL_H00000328150    ..............................................................................
HGL_H00000400945    ..............................................................................
HGL_H00000357067    ..............................................................................
HGL_H00000402797    ..............................................................................
HGL_H00000306497    ..............................................................................
HGL_H00000386796    ..............................................................................
HGL_H00000383330    ..............................................................................
HGL_H00000339960-2  ..............................................................................
HGL_H00000263372    ..............................................................................
HGL_H00000345708    ..............................................................................
HGL_H00000341479    ..............................................................................
HGL_H00000355580    ..............................................................................
HGL_H00000240662    ..............................................................................
HGL_H00000391498-2  ..............................................................................
HGL_H00000352527    ..............................................................................
HGL_H00000376438    ..............................................................................
HGL_H00000352527    ..............................................................................
HGL_H00000334650    ..............................................................................
HGL_H00000316136    ..............................................................................
HGL_H00000402797    ..............................................................................
HGL_H00000386796    ..............................................................................
HGL_H00000361952    ..............................................................................
HGL_H00000357068    ..............................................................................
HGL_H00000251127    ..............................................................................
HGL_H00000381911    ..............................................................................
HGL_H00000386796    ..............................................................................
HGL_H00000361952    ..............................................................................
HGL_H00000371180    ..............................................................................
HGL_H00000353206    ..............................................................................
HGL_H00000344820    ..............................................................................
HGL_H00000251287    ..............................................................................
HGL_H00000391498-1  ..............................................................................
HGL_M00000049206    ..............................................................................
HGL_H00000353206    ..............................................................................
HGL_H00000251127    ..............................................................................
HGL_H00000294309    ..............................................................................
HGL_H00000282611    ..............................................................................
HGL_H00000294309    ..............................................................................
HGL_H00000319591-2  ..............................................................................
HGL_H00000344820    ..............................................................................
HGL_H00000251127    ..............................................................................
HGL_H00000400945    ..............................................................................
HGL_H00000353362    ..............................................................................
HGL_H00000376350    ..............................................................................
HGL_H00000394033    ..............................................................................
HGL_H00000237596    ..............................................................................
HGL_H00000360601    ..............................................................................
HGL_H00000376350    ..............................................................................
HGL_R00000005229    ..............................................................................
HGL_N10008871       ..............................................................................
HGL_H00000360302    ..............................................................................
HGL_N10008871       ..............................................................................
HGL_H00000242607    ..............................................................................
HGL_H00000410146    ..............................................................................
HGL_H00000373594    ..............................................................................
HGL_H00000282499    ..............................................................................
HGL_H00000307342    ..............................................................................
HGL_H00000282611    ..............................................................................
HGL_H00000364536    ..............................................................................
HGL_H00000285900    ..............................................................................
HGL_H00000325296    ..............................................................................
HGL_H00000377482    ..............................................................................


                                                              10                                    
                                                               |                                    
d1f6ga_               ................................---------ARLVK................................
HGL_H00000358784    ................................LRVIRLVRVFRIFK................................
HGL_H00000228858    ................................LRVIRLVRVFRIFK................................
HGL_H00000358786    ................................LRIIRLVRVFRIFK................................
HGL_H00000328511    ................................LRIIRLVRVFRIFK................................
HGL_H00000218176    ................................--TLRVFRVFRIFK................................
HGL_H00000415257    ................................LRVIRLVRVFRIFK................................
HGL_H00000295082    ................................-QALRIMRIARIFK................................
HGL_H00000360806    ................................-QIFRIMRILRILK................................
HGL_H00000265969    ................................LRVVRFVRILRIFK................................
HGL_H00000358802    ................................LRVVRFVRILRIFK................................
HGL_H00000329426    ................................-QIFRIMRILRILK................................
HGL_H00000371514    ................................LRIMRLMRIFRILK................................
HGL_H00000376966-2  ................................LRVVRFVRILRIFK................................
HGL_H00000303282    ................................LRVVRFVRILRIFK................................
HGL_H00000305824    ................................-QILRLMRIFRILK................................
HGL_H00000297404    ................................-QVLRLLRALRMLK................................
HGL_H00000221444    ................................LRVIRLVRVFRIFK................................
HGL_H00000287042    ................................-QVLRLMRIFRILK................................
HGL_H00000360626-1  ................................LRVLRALRILYVMR................................
HGL_H00000307694    ................................-QVFRLMRIFRVLK................................
HGL_H00000312129    ................................LRVLRALRILYVMR................................
HGL_H00000315654    ................................LRLLRALRVLYVMR................................
HGL_H00000262186    ................................LKTARLLRLVRVAR................................
HGL_H00000318212    ................................LKTARLLRLVRVAR................................
HGL_H00000384611    ................................LRVLRMMRIFWVIK................................
HGL_H00000345055    ................................LRFLQILRMVRMDR................................
HGL_H00000346601    ................................LRFLQILRMIRMDR................................
HGL_H00000331727    ................................LKTARLLRLVRVAR................................
HGL_H00000262916    ................................MRFLQILRMVRMDR................................
HGL_H00000373648    ................................LRFLQILRMLRMDR................................
HGL_H00000346534    ................................LRTLRALRPLRALS................................
HGL_H00000410257    ................................LRTLRALRPLRALS................................
HGL_H00000271751    ................................LKVVRLLRLGRVAR................................
HGL_H00000353206    ................................LRTLRALRPLRALS................................
HGL_H00000352011    ................................LRVLRLLRTLRPLR................................
HGL_H00000383028    ................................LRVLRLLRTLRPLR................................
HGL_H00000348945    ................................LRVLRLLRTLRPLR................................
HGL_H00000346534    ................................-RVIRLARIGRILR................................
HGL_H00000333496    ................................--TLRVFRVFRIFK................................
HGL_H00000348945    ................................----RTFRLLRVLK................................
HGL_H00000257981    ................................LKTVRLLRLLRLLP................................
HGL_H00000364536    ................................LRTLRALRPLRALS................................
HGL_H00000155840    ................................IRFLQILRMLHVDR................................
HGL_H00000283256    ................................-RVIRLARIGRILR................................
HGL_H00000384264    ................................IRLNRLLRISRMFE................................
HGL_H00000390600    ................................LRTLRALRPLRALS................................
HGL_H00000328813    ................................LKTVRLLRLLRLLQ................................
HGL_H00000261917    ................................LRLLRLSRLIRYIH................................
HGL_H00000353206    ................................-RVIRLARIGRILR................................
HGL_H00000264661    ................................LKTVRLLRLLRLLQ................................
HGL_H00000303540    ................................-RVIRLARIGRILR................................
HGL_H00000357342    ................................LRLLRLSRLIRYIH................................
HGL_H00000364536    ................................-RVIRLARIGRILR................................
HGL_H00000350183    ................................LRALRLLRIFKITK................................
HGL_H00000319591-1  ................................--TLRVFRVFRIFK................................
HGL_H00000006839    ................................-RVIRLARIGRVLR................................
HGL_H00000006839    ................................LRTLRALRPLRALS................................
HGL_H00000328478    ................................VRFNRLLHFARMFE................................
HGL_H00000283256    ................................LRTLRALRPLRALS................................
HGL_H00000277549    ................................LRALRLLRIFKVTK................................
HGL_H00000386761    ................................LRFNRLLKFSRLFE................................
HGL_H00000303540    ................................LRTLRALRPLRALS................................
HGL_H00000410257    ................................--RFRLARIGRILR................................
HGL_H00000352011    ................................---LRTFRLMRVLK................................
HGL_H00000288139    ................................--FFRLFRVMRLVK................................
HGL_H00000355192    ................................LRCIRLLRIFKITK................................
HGL_H00000385724    ................................LRCVRLLRIFKITR................................
HGL_H00000400945    ................................-RIVRLARIGRILR................................
HGL_H00000355192    ................................-KILRVLRVLRPLR................................
HGL_H00000390600    ................................--IIRLARIGRILR................................
HGL_H00000383028    ................................---LRTFRLLRVLK................................
HGL_H00000365441    ................................-TFFRLFRVMRLVK................................
HGL_H00000352011    ................................LRPLRAINRVPSMR................................
HGL_H00000383028    ................................IRIMRVLRIARVLK................................
HGL_H00000309052    ................................---MRALRAIRIVR................................
HGL_H00000277549    ................................LRLFRAARLIKLLR................................
HGL_H00000355192    ................................LRAFRVLRPLRLVS................................
HGL_H00000364536    .....................dywenlyqqtl--------------................................
HGL_H00000277549    ................................---LRVLRVLRPLK................................
HGL_H00000352011    ................................IRIMRVLRIARVLK................................
HGL_H00000346534    ................................LRSFRLLRVFKLAK................................
HGL_H00000350183    ................................---LRVLRVLRPLK................................
HGL_H00000283256    ................................LRSFRLLRVFKLAK................................
HGL_H00000369268    ................................LRLNRFLRVPRLFE................................
HGL_H00000303540    ................................LRSFRLLRVFKLAK................................
HGL_H00000385724    ................................LRAFRVLRPLRLVS................................
HGL_H00000355192    ................................--FFRLFRVMRLIK................................
HGL_H00000288139    ................................--VFRCVRLLRIFK................................
HGL_H00000385724    ................................--FFRLFRVMRLVK................................
HGL_H00000277549    ................................LRTLRAVRVLRPLK................................
HGL_H00000348945    ................................LRPLRAINRVPSMR................................
HGL_H00000288139    ................................LRAFRVLRPLRLVS................................
HGL_H00000006839    ................................LRSFRLLRVFKLAK................................
HGL_H00000350183    ................................LRTLRAVRVLRPLK................................
HGL_H00000383028    ................................-------RVLRPLK................................
HGL_H00000410257    ................................LRSFRLLRVFKLAK................................
HGL_H00000346534    ...............rlmtqdywenlyqltlr--------------................................
HGL_H00000288139    ................................-KILRVLRVLRPLR................................
HGL_H00000353362    ................................---LRVLRVLRPLK................................
HGL_H00000306275    ................................--------LHRAKK................................
HGL_H00000390600    ................................LRTFRLLRVFKLAK................................
HGL_H00000303540    ..tsfdtfswaflslfrlmtqdfwenlyqltl--------------................................
HGL_H00000364536    ................................LRSFRLLRVFKLAK................................
HGL_H00000365441    ................................-KILRVLRVLRPLR................................
HGL_H00000353362    ................................LRALRLLRIFKVTK................................
HGL_H00000283256    gytsfdtfswaflslfrlmtqdfwenlyqltl--------------................................
HGL_H00000365441    ................................--VLRCVRLLRIFK................................
HGL_H00000348945    ................................IRIMRVLRIARVLK................................
HGL_H00000353206    ................................LRSFRLLRVFKLAK................................
HGL_H00000410257    ................rlmtqdcwerlyqqtl--------------................................
HGL_H00000006839    .....agrnpnygytsydtfswaflalfrlmt--------------................................
HGL_H00000350183    ................................--RLILLRQGYTIR................................
HGL_H00000264773    ................................LRLYLIARVMLLHS................................
HGL_H00000310568    ................................------ARVEKVFR................................
HGL_H00000302166    ................................----------YLLK................................
HGL_H00000222249    ................................LRLYLLGRVMLLHS................................
HGL_H00000251102    ................................---LRLPRCLKYMA................................
HGL_H00000365441    ................................--------------................................
HGL_N10019168       ................................--------------................................
HGL_H00000385724    ................................-KILRVLRVLRPLR................................
HGL_H00000251127    ................................---LRCLRPLRIFK................................
HGL_H00000294725    ................................--------------................................
HGL_H00000384427    ................................--------------................................
HGL_H00000316605    ................................---FRTNRILKYTS................................
HGL_H00000400945    ................................LRTLRALRPLRALS................................
HGL_H00000243457    ................................----------RYLA................................
HGL_H00000271915    ................................LRLYLIARVMLLHS................................
HGL_H00000394033    ................................-------------K................................
HGL_H00000386251    ................................---------LAYLR................................
HGL_H00000391498-1  ................................--------------................................
HGL_H00000355580    ................................--------------................................
HGL_H00000390600    ................................-------------Lfrlmtqdswerlyqq.................
HGL_H00000341006    ................................-------RVLRLVH................................
HGL_H00000334650    ................................--------------................................
HGL_H00000298480    ................................LFIPVFLNCWLAKH................................
HGL_H00000353362    ................................LRLFRAARLIKLLR................................
HGL_H00000310568    ................................--------------................................
HGL_H00000328150    ................................----------RYLA................................
HGL_H00000400945    ................................LRSFRVLRVFKLAK................................
HGL_H00000357067    ................................------RETYRYLT................................
HGL_H00000402797    ................................--------------................................
HGL_H00000306497    ................................----------RYMA................................
HGL_H00000386796    ................................---------IHILR................................
HGL_H00000383330    ................................------RETYRYLT................................
HGL_H00000339960-2  ................................---------YRYLS................................
HGL_H00000263372    ................................--------------................................
HGL_H00000345708    ................................------REQGRFLQ................................
HGL_H00000341479    ................................----------RYLS................................
HGL_H00000355580    ................................-------PVLYFHI................................
HGL_H00000240662    ................................------REQGRFLQ................................
HGL_H00000391498-2  ................................--------------................................
HGL_H00000352527    ................................----RAQRLGQFLT................................
HGL_H00000376438    ................................--------------................................
HGL_H00000352527    ................................--------------................................
HGL_H00000334650    ................................--------------................................
HGL_H00000316136    ................................---------FIFFV................................
HGL_H00000402797    ................................--------------................................
HGL_H00000386796    ................................-QIFKLGKYWPTFR................................
HGL_H00000361952    ................................--------------................................
HGL_H00000357068    ................................--------RFLYLK................................
HGL_H00000251127    ................................--------------................................
HGL_H00000381911    ................................-----------YLQ................................
HGL_H00000386796    ................................----KFLRALRVLS................................
HGL_H00000361952    ................................--------------................................
HGL_H00000371180    ................................----SVMRCFRLYA................................
HGL_H00000353206    ................................-------------Kdyigddnhfyvldgqkdpllcgngsdagqcpe
HGL_H00000344820    ................................--------------................................
HGL_H00000251287    ................................--------------................................
HGL_H00000391498-1  ................................--------------................................
HGL_M00000049206    ................................--------------................................
HGL_H00000353206    ................................--------------................................
HGL_H00000251127    ................................-RIPRPLIMIRAFR................................
HGL_H00000294309    ................................--------------................................
HGL_H00000282611    ................................-QSLRILKLITYSQ................................
HGL_H00000294309    ................................---LRMRRLLRPFF................................
HGL_H00000319591-2  ................................--------------................................
HGL_H00000344820    ................................--------------................................
HGL_H00000251127    ................................--------------................................
HGL_H00000400945    ................................---LRTFRVIRALK................................
HGL_H00000353362    ................................--------------................................
HGL_H00000376350    ................................LRPLQLLRLFKLKK................................
HGL_H00000394033    ................................--------------................................
HGL_H00000237596    ................................------IKLFKFIS................................
HGL_H00000360601    ................................--------------................................
HGL_H00000376350    ................................--------------................................
HGL_R00000005229    ................................--------------................................
HGL_N10008871       ................................--------IRRAFR................................
HGL_H00000360302    ................................--------------................................
HGL_N10008871       ................................--------------................................
HGL_H00000242607    ................................--------------................................
HGL_H00000410146    ................................--------------................................
HGL_H00000373594    ................................--------------................................
HGL_H00000282499    ................................--------------................................
HGL_H00000307342    ................................--------------................................
HGL_H00000282611    ................................--------------................................
HGL_H00000364536    ................................--------------................................
HGL_H00000285900    ................................--------------................................
HGL_H00000325296    ................................------------LE................................
HGL_H00000377482    ................................--------------................................


                                                                     20                             
                                                                      |                             
d1f6ga_               ...........................................LLLGRHG...........SA...........LH..
HGL_H00000358784    ...........................................LSRHSKGlqilgqt....LK...........AS..
HGL_H00000228858    ...........................................LSRHSKGlqilgqt....LK...........AS..
HGL_H00000358786    ...........................................LSRHSKGlqilgqt....LK...........AS..
HGL_H00000328511    ...........................................LSRHSKGlqilght....LR...........AS..
HGL_H00000218176    ...........................................FSRHSQG...........LRilgytlk....SC..
HGL_H00000415257    ...........................................LSRHSKGlqilgqt....LK...........AS..
HGL_H00000295082    ...........................................LARHSSGlqtltya....LK...........RS..
HGL_H00000360806    ...........................................LARHSTGlqslgft....LR...........RS..
HGL_H00000265969    ...........................................LTRHFVGlrvlght....LR...........AS..
HGL_H00000358802    ...........................................LTRHFVGlrvlght....LR...........AS..
HGL_H00000329426    ...........................................LARHSTGlqslgft....LR...........RS..
HGL_H00000371514    ...........................................LARHSTGlrafgft....LR...........QC..
HGL_H00000376966-2  ...........................................LTRHFVGlrvlght....LR...........AS..
HGL_H00000303282    ...........................................LTRHFVGlrvlght....LR...........AS..
HGL_H00000305824    ...........................................LARHSVGlrslgat....LR...........HS..
HGL_H00000297404    ...........................................LGRHSTG...........LRslgmtit....QC..
HGL_H00000221444    ...........................................LSRHSKGlqilgqt....LR...........AS..
HGL_H00000287042    ...........................................LARHSTG...........LRslgatlk....YS..
HGL_H00000360626-1  ...........................................LARHSLGlqtlglt....AR...........RC..
HGL_H00000307694    ...........................................LARHSTG...........LRslgatlk....HS..
HGL_H00000312129    ...........................................LARHSLGlqtlglt....VR...........RC..
HGL_H00000315654    ...........................................LARHSLG...........LRslgltvr....RC..
HGL_H00000262186    ...........................................KLDRYSE...........YG...........A-..
HGL_H00000318212    ...........................................KLDRYSE...........YG...........A-..
HGL_H00000384611    ...........................................LARHFIGlqtlglt....LK...........RC..
HGL_H00000345055    ...........................................RGGTWKL...........LGsvvy.......AH..
HGL_H00000346601    ...........................................RGGTWKL...........LGsvvy.......AH..
HGL_H00000331727    ...........................................KLDRYSE...........YG...........A-..
HGL_H00000262916    ...........................................RGGTWKL...........LGsvvy.......AH..
HGL_H00000373648    ...........................................RGGTWKL...........LGsaic.......AH..
HGL_H00000346534    ...........................................RFEGMRV...........VV...........NA..
HGL_H00000410257    ...........................................RFEGMRV...........VV...........NA..
HGL_H00000271751    ...........................................KLDHYIE...........YG...........A-..
HGL_H00000353206    ...........................................RFEGMRV...........VV...........NA..
HGL_H00000352011    ...........................................VISRAQGlklvvet....LM...........SS..
HGL_H00000383028    ...........................................VISRAPGlklvvet....LI...........SS..
HGL_H00000348945    ...........................................VISRAPGlklvvet....LI...........SS..
HGL_H00000346534    ...........................................LIKGAKGirtllfa....LM...........MSlp
HGL_H00000333496    ...........................................FSRHSQG...........LRilgytlk....SC..
HGL_H00000348945    ...........................................LVRFLPA...........LR...........RQlv
HGL_H00000257981    ...........................................RLDRYSQ...........YS...........A-..
HGL_H00000364536    ...........................................RFEGMRV...........VV...........NA..
HGL_H00000155840    ...........................................QGGTWRL...........LG...........SVvf
HGL_H00000283256    ...........................................LIKGAKG...........IRtllfalmmslpAL..
HGL_H00000384264    ...........................................FFQRTET...........RTny.........PN..
HGL_H00000390600    ...........................................RFEGMRV...........VV...........DA..
HGL_H00000328813    ...........................................KLDRYSQ...........HS...........T-..
HGL_H00000261917    ...........................................QWEEIFHmtyd.......LA...........SA..
HGL_H00000353206    ...........................................LIKGAKG...........IRtllfalmmslpAL..
HGL_H00000264661    ...........................................KLEPYSQ...........CS...........A-..
HGL_H00000303540    ...........................................LIKGAKG...........IRtllfalmmslpAL..
HGL_H00000357342    ...........................................QWEEIFHmtyd.......LA...........SA..
HGL_H00000364536    ...........................................LIKGAKG...........IRtllfalmmslpAL..
HGL_H00000350183    ...........................................YWASLRNlvvs.......LM...........SS..
HGL_H00000319591-1  ...........................................FSRHSQG...........LRilgytlk....SC..
HGL_H00000006839    ...........................................LIRGAKG...........IR...........TLlf
HGL_H00000006839    ...........................................RFEGMRV...........VV...........NA..
HGL_H00000328478    ...........................................FFDRTET...........RTsy.........PN..
HGL_H00000283256    ...........................................RFEGMRV...........VV...........NA..
HGL_H00000277549    ...........................................YWNSLRNlvvs.......LL...........NS..
HGL_H00000386761    ...........................................FFDRTET...........RTny.........PN..
HGL_H00000303540    ...........................................RFEGMRV...........VV...........NA..
HGL_H00000410257    ...........................................LIRGAKG...........IR...........TLlf
HGL_H00000352011    ...........................................LVRFLPAlqrqlvv....LM...........KT..
HGL_H00000288139    ...........................................LLSRGEGirtllwtfiksFQ...........AL..
HGL_H00000355192    ...........................................YWTSLSNlvas.......LL...........NS..
HGL_H00000385724    ...........................................YWNSLSN...........LV...........AS..
HGL_H00000400945    ...........................................LVRAARG...........IRtllfalmmslpSL..
HGL_H00000355192    ...........................................AINRAKG...........LK...........HVvq
HGL_H00000390600    ...........................................LIRAAKG...........IR...........TLlf
HGL_H00000383028    ...........................................LVRFMPA...........LR...........RQlv
HGL_H00000365441    ...........................................LLSKGEGirtllwtfiksFQ...........AL..
HGL_H00000352011    ...........................................ILVTLLL...........DT...........LP..
HGL_H00000383028    ...........................................LLKMATG...........MR...........ALld
HGL_H00000309052    ...........................................RLRILTSlkevtgt....LV...........GS..
HGL_H00000277549    ...........................................QGYTIRIllwtfvqs...FK...........AL..
HGL_H00000355192    ...........................................GVPSLQV...........VL...........NS..
HGL_H00000364536    ...........................................------Raagk.......TY...........MI..
HGL_H00000277549    ...........................................TIKRLPK...........LK...........AVfd
HGL_H00000352011    ...........................................LLKMAVG...........MR...........ALld
HGL_H00000346534    ...........................................SWPTLNM...........LI...........KIig
HGL_H00000350183    ...........................................TIKRLPK...........LK...........AVfd
HGL_H00000283256    ...........................................SWPTLNM...........LI...........KIig
HGL_H00000369268    ...........................................AFDRTET...........RTay.........PN..
HGL_H00000303540    ...........................................SWPTLNM...........LI...........KIig
HGL_H00000385724    ...........................................GVPSLQVvlns.......II...........KA..
HGL_H00000355192    ...........................................LLSRAEGvrtllwt....FI...........KS..
HGL_H00000288139    ...........................................VTRHWTSlsnlvas....LL...........NS..
HGL_H00000385724    ...........................................LLSRGEGirtllwtfiksFQ...........AL..
HGL_H00000277549    ...........................................LVSGIPSlqvvlks....IM...........KA..
HGL_H00000348945    ...........................................ILVTLLL...........DT...........LP..
HGL_H00000288139    ...........................................GVPSLQVvlns.......II...........KA..
HGL_H00000006839    ...........................................SWPTLNM...........LI...........KIig
HGL_H00000350183    ...........................................LVSGIPSlqivlks....IM...........KA..
HGL_H00000383028    ...........................................AINRVPS...........MR...........ILvn
HGL_H00000410257    ...........................................SWPTLNT...........LI...........KIig
HGL_H00000346534    ...........................................---AAGK...........TY...........MI..
HGL_H00000288139    ...........................................AINRAKG...........LK...........HVvq
HGL_H00000353362    ...........................................TIKRLPK...........LK...........AVfd
HGL_H00000306275    ...........................................GLGMRRA...........DV...........SM..
HGL_H00000390600    ...........................................SWPTLNT...........LI...........KI..
HGL_H00000303540    ...........................................--RAAGK...........TY...........MI..
HGL_H00000364536    ...........................................SWPTLNM...........LI...........KIig
HGL_H00000365441    ...........................................AINRAKG...........LK...........HVvq
HGL_H00000353362    ...........................................YWASLRNlvvs.......LL...........NS..
HGL_H00000283256    ...........................................--RAAGK...........TY...........MI..
HGL_H00000365441    ...........................................VTRHWASlrn........LVasll.......NS..
HGL_H00000348945    ...........................................LLKMATG...........MR...........ALld
HGL_H00000353206    ...........................................SWRPTLN...........MLikiig......NS..
HGL_H00000410257    ...........................................------Rsagk.......IY...........MI..
HGL_H00000006839    ...........................................-Q-----...........--...........--..
HGL_H00000350183    ...........................................ILLWTFVqs.........FK...........AL..
HGL_H00000264773    ...........................................KLFTDAS...........SR...........SIga
HGL_H00000310568    ...........................................KKQVSQT...........KI...........RV..
HGL_H00000302166    ...........................................RIKKCCG...........MRntev.......SM..
HGL_H00000222249    ...........................................KIFTDAS...........SR...........SIga
HGL_H00000251102    ...........................................FFEFNNR...........LEailsk......AY..
HGL_H00000365441    ...........................................-------...........--...........--..
HGL_N10019168       ...........................................-------...........--...........-N..
HGL_H00000385724    ...........................................AINRAKG...........LK...........HVvq
HGL_H00000251127    ...........................................LVPQMRKvvrel......FS...........GF..
HGL_H00000294725    ...........................................-------...........--...........AM..
HGL_H00000384427    ...........................................-FRHWFVak.........LY...........MN..
HGL_H00000316605    ...........................................FFEFNHH...........LE...........SImd
HGL_H00000400945    ...........................................RFEGMKV...........VV...........NA..
HGL_H00000243457    ...........................................DIFTTCV...........DI...........RW..
HGL_H00000271915    ...........................................KLFTDAS...........SR...........SIga
HGL_H00000394033    ...........................................KWNVSQT...........KI...........RI..
HGL_H00000386251    ...........................................DAWGILI...........DM...........RW..
HGL_H00000391498-1  ...........................................-------...........--...........--..
HGL_H00000355580    ...........................................-------...........--...........RS..
HGL_H00000390600    ...........................................TLRASGK...........MY...........MV..
HGL_H00000341006    ...........................................VCMAVEP...........LA...........RIir
HGL_H00000334650    ...........................................-------...........--...........--..
HGL_H00000298480    ...........................................ALENMIN...........DF...........HRai
HGL_H00000353362    ...........................................QGYTIRIllwtfvqs...FK...........AL..
HGL_H00000310568    ...........................................-------...........--...........-K..
HGL_H00000328150    ...........................................DMFTTCV...........DI...........RW..
HGL_H00000400945    ...........................................SWPTLNT...........LI...........KIig
HGL_H00000357067    ...........................................DLFTTLV...........DL...........QW..
HGL_H00000402797    ...........................................-------...........--...........--..
HGL_H00000306497    ...........................................DIFTTCV...........DT...........RW..
HGL_H00000386796    ...........................................LGKGPKVfhdlmvplmlsLP...........AL..
HGL_H00000383330    ...........................................DIFTTLV...........DL...........KW..
HGL_H00000339960-2  ...........................................DLFTTLV...........DL...........KW..
HGL_H00000263372    ...........................................HWGWDPR...........RA...........AR..
HGL_H00000345708    ...........................................DVFTTLV...........DL...........KW..
HGL_H00000341479    ...........................................DLFTTCV...........DV...........RW..
HGL_H00000355580    ...........................................RWGFSKQ...........VV...........AI..
HGL_H00000240662    ...........................................DIFTTLV...........DL...........KW..
HGL_H00000391498-2  ...........................................-------...........--...........--..
HGL_H00000352527    ...........................................RRGVSLR...........KA...........QI..
HGL_H00000376438    ...........................................DIFTTLV...........DT...........KW..
HGL_H00000352527    ...........................................-------...........--...........--..
HGL_H00000334650    ...........................................-------...........--...........--..
HGL_H00000316136    ...........................................DIWTTVL...........DL...........KW..
HGL_H00000402797    ...........................................-------...........--...........--..
HGL_H00000386796    ...........................................RLILTLG...........--...........NS..
HGL_H00000361952    ...........................................-------...........--...........--..
HGL_H00000357068    ...........................................DLWTTFI...........DM...........QW..
HGL_H00000251127    ...........................................-------...........--...........--..
HGL_H00000381911    ...........................................DLWTTVI...........DM...........QW..
HGL_H00000386796    ...........................................QFERMKVvvra.......LI...........--..
HGL_H00000361952    ...........................................-------...........--...........--..
HGL_H00000371180    ...........................................QFHQVRViilalv.....RT...........FK..
HGL_H00000353206    gyicvkagrnpnygytsfdtfswaflslfrlmtqdywenlyqlTLRAAGK...........TY...........MI..
HGL_H00000344820    ...........................................-------...........--...........-P..
HGL_H00000251287    ...........................................-------...........--...........-A..
HGL_H00000391498-1  ...........................................-------...........--...........--..
HGL_M00000049206    ...........................................-------...........--...........--..
HGL_H00000353206    ...........................................-------...........--...........--..
HGL_H00000251127    ...........................................IYFRFELprt........RItnilkrsge..QI..
HGL_H00000294309    ...........................................-------...........--...........--..
HGL_H00000282611    ...........................................AIRTLITamgqi......VY...........IV..
HGL_H00000294309    ...........................................LLQNSSM...........MK...........KTlk
HGL_H00000319591-2  ...........................................-------...........--...........--..
HGL_H00000344820    ...........................................-------...........--...........--..
HGL_H00000251127    ...........................................--LLTVVvs.........MY...........KS..
HGL_H00000400945    ...........................................AISVVSGlkvivga....LL...........RS..
HGL_H00000353362    ...........................................-------...........--...........--..
HGL_H00000376350    ...........................................RYRNVLD...........TM...........--..
HGL_H00000394033    ...........................................-------...........--...........MK..
HGL_H00000237596    ...........................................FNRTMSQlstt.......MS...........RC..
HGL_H00000360601    ...........................................-------...........--...........--..
HGL_H00000376350    ...........................................------Qi..........FQ...........SL..
HGL_R00000005229    ...........................................-------...........--...........--..
HGL_N10008871       ...........................................SIRNT--...........--...........--..
HGL_H00000360302    ...........................................-------...........--...........--..
HGL_N10008871       ...........................................-------...........--...........--..
HGL_H00000242607    ...........................................-------...........--...........--..
HGL_H00000410146    ...........................................-------...........--...........--..
HGL_H00000373594    ...........................................-------...........--...........--..
HGL_H00000282499    ...........................................-------...........--...........--..
HGL_H00000307342    ...........................................-------...........--...........--..
HGL_H00000282611    ...........................................-------...........--...........--..
HGL_H00000364536    ...........................................-------...........--...........--..
HGL_H00000285900    ...........................................-------...........--...........--..
HGL_H00000325296    ...........................................LHLHRLY...........YF...........TS..
HGL_H00000377482    ...........................................-------...........--...........--..


                                          30        40        50                                    
                                           |         |         |                                    
d1f6ga_               .................WAAAGAATVLLVIVLLAGSYLAVLA.......ERGAP........................
HGL_H00000358784    .................MRELGLLIFFLFIGVILFSSAVYFA.......EADDP........................
HGL_H00000228858    .................MRELGLLIFFLFIGVILFSSAVYFA.......EAEEA........................
HGL_H00000358786    .................MRELGLLIFFLFIGVILFSSAVYFA.......EVDEP........................
HGL_H00000328511    .................MRELGLLIFFLFIGVILFSSAVYFA.......EADEP........................
HGL_H00000218176    .................ASELGFLLFSLTMAIIIFATVMFYA.......EKGTS........................
HGL_H00000415257    .................MRELGLLIFFLFIGVILFSSAVYFA.......EADER........................
HGL_H00000295082    .................FKELGLLLMYLAVGIFVFSALGYTM.......EQSHP........................
HGL_H00000360806    .................YNELGLLILFLAMGIMIFSSLVFFA.......EKDED........................
HGL_H00000265969    .................TNEFLLLIIFLALGVLIFATMIYYA.......ERIGA........................
HGL_H00000358802    .................TNEFLLLIIFLALGVLIFATMIYYA.......ERIGA........................
HGL_H00000329426    .................YNELGLLILFLAMGIMIFSSLVFFA.......EKDED........................
HGL_H00000371514    .................YQQVGCLLLFITMGIFAFSAAVYSV.......EHDVP........................
HGL_H00000376966-2  .................TNEFLLLIIFLALGVLIFATMIYYA.......ERVGA........................
HGL_H00000303282    .................TNEFLLLIIFLALGVLIFATMIYYA.......ERIGA........................
HGL_H00000305824    .................YHEVGLLLLFLSVGISIFSVLIYSV.......EKDDP........................
HGL_H00000297404    .................YEEVGLLLLFLSVGISIFSTVEYFA.......EQSIP........................
HGL_H00000221444    .................MRELGLLIFFLFIGVVLFSSAVYFA.......EVDSV........................
HGL_H00000287042    .................YKEVGLLLLYLSVGISIFSVVAYTI.......EK-EE........................
HGL_H00000360626-1  .................TREFGLLLLFLCVAIALFAPLLYVI.......ENEMA........................
HGL_H00000307694    .................YREVGILLLYLAVGVSVFSGVAYTA.......EE--K........................
HGL_H00000312129    .................TREFGLLLLFLAVAVTLFSPLVYVA.......ENESG........................
HGL_H00000315654    .................AREFGLLLLFLCVAMALFAPLVHLA.......ERELG........................
HGL_H00000262186    .................-AVLFLLMCTFALIAHWLACIWYAI.......GNMEQpdvnarigwlhnlgdqigkpynss
HGL_H00000318212    .................-AVLFLLMCTFALIAHWLACIWYAI.......GNGERpylepkigwldslstqlgkhyngs
HGL_H00000384611    .................YREMVMLLVFICVAMAIFSALSQLL.......EHGLDlets....................
HGL_H00000345055    .................SKELITAWYIGFLVLIFSSFLVYLV.......EK-DA........................
HGL_H00000346601    .................SKELVTAWYIGFLCLILASFLVYLA.......EK-GE........................
HGL_H00000331727    .................-AVLMLLMCIFALIAHWLACIWYAI.......GNVERpyltdkigwldslgqqigkrynds
HGL_H00000262916    .................SKELITAWYIGFLVLIFASFLVYLA.......EK-DA........................
HGL_H00000373648    .................SKELITAWYIGFLTLILSSFLVYLV.......EKDVP........................
HGL_H00000346534    .................LVGAIPSIMNVLLVCLIFWLIFSIM.......GVNLFagkyhfcfnetseirfeiehvnnk
HGL_H00000410257    .................LVGAIPSIMNVLLVCLIFWLIFSIM.......GVNLFagkfgrcinqtegdlplnytivnn
HGL_H00000271751    .................-AVLVLLVCVFGLAAHWMACIWYSI.......GDYEIfdedtktirnnswlyqlamdigtp
HGL_H00000353206    .................LVGAIPSIMNVLLVCLIFWLIFSIM.......GV---........................
HGL_H00000352011    .................LKPIGNIVVICCAFFIIFGIL----.......-----........................
HGL_H00000383028    .................LKPIGNIVLICCAFFIIFGIL----.......-----........................
HGL_H00000348945    .................LRPIGNIVLICCAFFIIFGILG---.......-----........................
HGL_H00000346534    ...............alFNIGLLLFLVMFIFSIFGMSNFAYV.......KHEA-........................
HGL_H00000333496    .................ASELGFLLFSLTMAIIIFATVMFYA.......EKGSS........................
HGL_H00000348945    ....vlmktmdnvatfcMLLMLFIFIFSILGMHLFGCKFSLK.......TDTGD........................
HGL_H00000257981    .................-VVLTLLMAVFALLAHWVACIWFYI.......GQREIesseselpeigwlqelarrletpy
HGL_H00000364536    .................LIGAIPSIMNVLLVCLIFWLIFSIM.......GVN--........................
HGL_H00000155840    ...............ihRQELITTLYIGFLGLIFSSYFVYLA.......EKDAV........................
HGL_H00000283256    .................FNIGLLLFLVMFIYAIFGMSNFAYV.......KREV-........................
HGL_H00000384264    .................IFRISNLVMYIVIIIHWNACVYYSI.......SKTVGfgndtwvypdvndpef........
HGL_H00000390600    .................LVGAIPSIVNVLLVCIIFWLIFSIM.......GVNLFagkfgrcinhtngefdlvnwtvvn
HGL_H00000328813    .................-IVLTLLMSMFALLAHWMACIWYVI.......GKMERednsllkwevgwlhelgkrlespy
HGL_H00000261917    .................VVRIVNLIGMMLLLCHWDGCLQFLV.......PMLQDfpsdcwvslndmvn..........
HGL_H00000353206    .................FNIGLLLFLVMFIYAIFGMSNFAYV.......KKEA-........................
HGL_H00000264661    .................-MVLTLLMSVFVLLAHWMACIWYVI.......GRREM........................
HGL_H00000303540    .................FNIGLLLFLVMFIYAIFGMSNFAYV.......KREV-........................
HGL_H00000357342    .................VVRIFNLIGMMLLLCHWDGCLQFLV.......PMLQD........................
HGL_H00000364536    .................FNIGLLLFLVMFIYAIFGMSNFAYV.......KK---........................
HGL_H00000350183    .................MKSIISLLFLLFLFIVVFALLGMQL.......FGGRFnfndgtpsanfdtfpaaimtvfqi
HGL_H00000319591-1  .................ASELGFLLFSLTMAIIIFATVMFYA.......EKGSS........................
HGL_H00000006839    ........almmslpalFNIGLLLFLVMFIYSIFGMSNFAYV.......KK---........................
HGL_H00000006839    .................LLGAIPSIMNVLLVCLIFWLIFSIM.......GV---........................
HGL_H00000328478    .................IFRISNLVLYILVIIHWNACIYYAI.......SKSIGfgvdtwvypnitdpey........
HGL_H00000283256    .................LLGAIPSIMNVLLVCLIFWLIFSIM.......GV---........................
HGL_H00000277549    .................MKSIISLLFLLFLFIVVFALLGMQL.......FGGQFnfkdetpttnfdtfpaailtvfqi
HGL_H00000386761    .................VFRIGNLVLYILIIIHWNACIYFAI.......SKFIGfgtdswvypniskpey........
HGL_H00000303540    .................LLGAIPSIMNVLLVCLIFWLIFSIM.......GV---........................
HGL_H00000410257    ........almmslpalFNIGLLLFLVMFIYSIFGMANFAYVkw.....EAGID........................
HGL_H00000352011    .................MDNVATFCMLLMLFIFIFSILGMHLfgckfasERDGD........................
HGL_H00000288139    .................PYVALLIAMLFFIYAVIGMQMFGKV.......AMRDN........................
HGL_H00000355192    .................IRSIASLLLLLFLFIVIFALLGMQL.......FGGRY........................
HGL_H00000385724    .................LLNSVRSIASLLLLLFLFIIIFSLL.......GMQLF........................
HGL_H00000400945    .................FNIGLLLFLVMFIYAIFGMNCFSKI.......ERK-G........................
HGL_H00000355192    ............cvfvaIRTIGNIVLVTTLLQFMFACI----.......-----........................
HGL_H00000390600    ........almmslpalFNIGLLLFLVMFIYSIFGMSSFPHV.......-----........................
HGL_H00000383028    ....vlmktmdnvatfcMLLMLFIFIFSILGMHIFGCKFSLR.......TDTGD........................
HGL_H00000365441    .................PYVALLIAMIFFIYAVIGMQMFGKV.......ALQDG........................
HGL_H00000352011    .................MLGNVLLLCFFVFFIFGIVGVQLWA.......G----........................
HGL_H00000383028    ........tvvqalpqvGNLGLLFMLLFFIYAALGV------.......-----........................
HGL_H00000309052    .................LLSIITIFILIFSCLLFFSMILTLF.......RRS-D........................
HGL_H00000277549    .................PYVCLLIAMLFFIYAIIGMQVFGNI.......ALDDD........................
HGL_H00000355192    .................IFKAMLPLFHIALLVLFMVTIYAII.......GLELF........................
HGL_H00000364536    .................FFVVVIFLGSFYLINLILAVVAMAY.......-----........................
HGL_H00000277549    ............cvvnsLKNVLNILIVYMLFMFIFAVIAVQL.......FK---........................
HGL_H00000352011    ............tvmqaLPQVGNLGLLFMLLFFIFAAL----.......-----........................
HGL_H00000346534    ...............nsVGALGNLTLVLAIIVFIFAVVGMQL.......F----........................
HGL_H00000350183    ...cvvtslknvfniliVYKLFMFIFAVIAVQLFKGKFFYCT.......DSSKDtekecignyvdheknkmevkgrew
HGL_H00000283256    ...............nsVGALGNLTLVLAIIVFIFAVVGMQL.......FG---........................
HGL_H00000369268    .................AFRIAKLMLYIFVVIHWNSCLYFAL.......SQYLGfgrdawvypdpaqpgf........
HGL_H00000303540    ...............nsVGALGNLTLVLAIIVFIFAVVGMQL.......FG---........................
HGL_H00000385724    .................MVPLLHIALLVLFVIIIYAII----.......-----........................
HGL_H00000355192    .................FQALPYVALLIVMLFFIYAVIGMQV.......RAAEPrpqeepghtgggtvlrgqwrpgsa
HGL_H00000288139    .................MKSIASLLLLLFLFIIIFSLLGMQL.......FGGKF........................
HGL_H00000385724    .................PYVALLIVMLFFIYAVIGMQVFGKI.......ALNDT........................
HGL_H00000277549    .................MVPLLQIGLLLFFAILMFAII----.......-----........................
HGL_H00000348945    .................MLGNVLLLCFFVFFIFGIVGVQLWA.......-----........................
HGL_H00000288139    .................MVPLLHIALLVLFVIIIYAII----.......-----........................
HGL_H00000006839    ...............nsVGALGNLTLVLAIIVFIFAVVGMQL.......F----........................
HGL_H00000350183    .................MVPLLQIGLLLFFAILMFAII----.......-----........................
HGL_H00000383028    ...........llldtlPMLGNVLLLCFFVFFIFGIIGVQLW.......-----........................
HGL_H00000410257    ...............nsVGALGNLTLVLAIIVFIFAVVGMQL.......FG---........................
HGL_H00000346534    .................FFVLVIFVGSFYLVNLILAV-----.......-----........................
HGL_H00000288139    ............cvfvaIRTIGNIMIVTTLLQFMFACI----.......-----........................
HGL_H00000353362    ............cvvnsLKNVFNILIVYMLFMFIFAVVAVQL.......FKGKFfhctdeskefekdcrgkyllyekn
HGL_H00000306275    .................ANMVLIGFVSCISTLCIGAAAFSYY.......EH---........................
HGL_H00000390600    .................IGNSVGALGNLTIILAIIVFIFALV.......GKQ--........................
HGL_H00000303540    .................FFVLVIFLGSFYLINLILAVVAMAY.......E----........................
HGL_H00000364536    ...............nsMGALGNLTLVLAIIVFIFAVVGMQL.......FG---........................
HGL_H00000365441    ............cvfvaIRTIGNIMIVTTLLQFMFACI----.......-----........................
HGL_H00000353362    .................MKSIISLLFLLFLFIVVFALLGMQL.......FGGQF........................
HGL_H00000283256    .................FFVLVIFLGSFYLINLILAVVAMAY.......E----........................
HGL_H00000365441    .................MKSIASLLLLLFLFIIIFSLLGMQL.......FGGKF........................
HGL_H00000348945    ........tvvqalpqvGNLGLLFMLLFFIYAAL--------.......-----........................
HGL_H00000353206    .................VGALGNLTLVLAIIVFIFAVVGMQL.......FG---........................
HGL_H00000410257    .................FFMLVIFLGSFYLVNLILAVVAMAY.......E----........................
HGL_H00000006839    .................-------------------------.......-----........................
HGL_H00000350183    .................PYVCLLIAMLFFIYAIIGMQVFGNI.......KLDEE........................
HGL_H00000264773    lnkinfntrfvmktlmtICPGTVLLVFSISLWIIAAWTVRAC.......ERYHD........................
HGL_H00000310568    .................ISTILFILAGCVVFVTIPAVIFKYI.......EG---........................
HGL_H00000302166    .................ENMVTVGFFSCMGTLCIGAAAFSQC.......EE---........................
HGL_H00000222249    lnkitfntrfvmktlmtICPGTVLLVFSISSWVIAAWTVRVC.......ERYHD........................
HGL_H00000251102    .................VYRVIRTTAYLLYSLHLNSCLYYWA.......SAFQGigsthwvy................
HGL_H00000365441    .................----------FVIIIYAIIGLELFL.......----Grmhktcyflgsdveveedpspcas
HGL_N10019168       .................SIKLVNLLSIFISTWLTAAGFIHLV.......ENSGD........................
HGL_H00000385724    ............cvfvaIRTIGNIVIVTTLLQFMFACI----.......-----........................
HGL_H00000251127    .................KEIFLVSILLLTLMLVFASFGVQL-.......-----........................
HGL_H00000294725    .................FNQVLILISTLLCLIFTCICGIQHL.......ERIGK........................
HGL_H00000384427    .................THPGRLLLGLTLGLWLTTAWVLSVA.......ERQAV........................
HGL_H00000316605    ..............kvyIYRVIRTTGYLLFILHINACIYYWA.......SNYEGigttkwvy................
HGL_H00000400945    .................LIGAIPAIVNVLLVCLIFWLTFCIL.......GV---........................
HGL_H00000243457    .................RWMLVIFCLAFVLSWLFFGCVFWLI.......ALLHG........................
HGL_H00000271915    lnkitfntrfvmktlmtICPGTVLLVFSISLWIIAAWTVRVC.......ERYHD........................
HGL_H00000394033    .................ISTIIFILFGCVLFVALPAIIFKHI.......EG---........................
HGL_H00000386251    .................RWMMLVFSASFVLHWLVFAVLWYVL.......AEMNG........................
HGL_H00000391498-1  .................---ILPLLLAYVCYLLLGATIFQLL.......EKPAEaesrdqfqmeklrflenytcldrr
HGL_H00000355580    .................AWCFGLLVLGYLLYLVFGAVVFSSV.......ELPYEdllrqelrklkrrfleeheclsep
HGL_H00000390600    .................FFVIVIFLGSFYLVNLILAVVTMAY.......E----........................
HGL_H00000341006    ............vilqaGPGMAQIGVLILFVMLVFALLGVTL.......FGEFV........................
HGL_H00000334650    .................-----CFLGCLVTYALLGAALFSVI.......EGRQVqraednpefqkflselcrilnytt
HGL_H00000298480    ..........lrtqsamFNQVLILFCTLLCLVFTGTCGIQHL.......ERAGE........................
HGL_H00000353362    .................PYVCLLIAMLFFIYAIIGMQVFGNI.......GIDGE........................
HGL_H00000310568    .................WKTVVAIFVVVVVYLVTGGLVFRAL.......EQPFEssqkntialekaeflrdhicvspq
HGL_H00000328150    .................RYMLLIFSLAFLASWLLFGVIFWVI.......AVAHG........................
HGL_H00000400945    ...............hsFGALGNLTVVLAIVLFIFSVVGMQ-.......-----........................
HGL_H00000357067    .................RLSLLFFVLAYALTWLFFGAIWWLI.......AYGRG........................
HGL_H00000402797    .................STTLLALLALVLLYLVSGALVFQAL.......EQPYEkqaqkdlgevrekflrahpcvsqh
HGL_H00000306497    .................RYMLMIFSAAFLISWLFFGLLFWCI.......AFFHG........................
HGL_H00000386796    .................LNISLLIFLVMFIYAIFGMYNFAYV.......KK---........................
HGL_H00000383330    .................RFNLLIFVMVYTVTWLFFGMIWWLI.......AYIRG........................
HGL_H00000339960-2  .................RFNLLVFTMVYTITWLFFGFIWWLI.......AYIRG........................
HGL_H00000263372    .................WHLVALLAVIVTICFLVPAVVFEHL.......EEA--........................
HGL_H00000345708    .................PHTLLIFTMSFLCSWLLFAMIWWLI.......AFAHG........................
HGL_H00000341479    .................RWMCLLFSCSFLASWLLFGLAFWLI.......ASLHG........................
HGL_H00000355580    .................VHAVVLGFVTVSCFFFIPAAVFSVL.......EDD--........................
HGL_H00000240662    .................RHTLVIFTMSFLCSWLLFAIMWWLV.......AFAHG........................
HGL_H00000391498-2  .................----LGLTLGTLAILIIPPVAFSHV.......EG---........................
HGL_H00000352527    .................TCTAIFILWGVLVHLVIPPFVFMVT.......EE---........................
HGL_H00000376438    .................RHMFVIFSLSYILSWLIFGSIFWLI.......AFHHG........................
HGL_H00000352527    .................------LTSAIIFYLAIGAAIFEVL.......EEPHWkeakknyytqklhllqefpclsqe
HGL_H00000334650    .................--PLPVIALVIFAYISCAAAILPCW.......ETE--........................
HGL_H00000316136    .................RYKMTIFISAFLGSWFLFGLLWYVV.......AYIHK........................
HGL_H00000402797    .................SAMLFLPIXGCLLFVLTPTFVFCYM.......ED---........................
HGL_H00000386796    .................LMALKDLILLLFTFVFFSAVFGM--.......-----........................
HGL_H00000361952    .................---VVAGLLVCVATLALGAATFAHF.......EG---........................
HGL_H00000357068    .................RYKLLLFSATFAGTWFLFGVVWYLV.......AVAHG........................
HGL_H00000251127    .................----VFTASLLIVMSAISLQMFCFV.......EEL--........................
HGL_H00000381911    .................RYKLTLFAATFVMTWFLFGVIYYAI.......AFIHG........................
HGL_H00000386796    .................KTTLPTWNVFLVCFMIWLSFSIMGV.......E----........................
HGL_H00000361952    .................-------------------------.......-----........................
HGL_H00000371180    .................SIRFHFMLLLLLFYIFAVAGVYFFK.......DY---........................
HGL_H00000353206    .................FFVLVIFLGSFYLVNLILAVVAMAY.......E----........................
HGL_H00000344820    .................WTRYALLVVAHMLAMGLGAVVLQAL.......EGPPAlqlqaklkaelaafqaefgaclpr
HGL_H00000251287    .................VMRICNLISMMLLLCHWDGCLQFLV.......PMLQD........................
HGL_H00000391498-1  .................------LTLGTLAILIIPPVAFSHV.......EG---........................
HGL_M00000049206    .................-------------------------.......-----........................
HGL_H00000353206    .................-------------------------.......-----........................
HGL_H00000251127    .................WSVSIFLIFFLLLYGILGVQMFG--.......-----........................
HGL_H00000294309    .................-------------------------.......-----........................
HGL_H00000282611    .................ASVLILFFILLYIFAILGFYLFGVL.......ER--G........................
HGL_H00000294309    ........cirsslpdmASVGLLLAIHLCLFTTFGMLLFTVG.......EKDME........................
HGL_H00000319591-2  .................-------------------------.......-----........................
HGL_H00000344820    .................-----LGLLVAGIFVLLPALVLWGL.......QGD--........................
HGL_H00000251127    .................FFIIVGMFLLLLCYAFAGVVLFGTV.......KYGENinrhanfssagkaitvlfrivtge
HGL_H00000400945    .................VKKLVDVMVLTLFCLCIFALVG---.......-----........................
HGL_H00000353362    .................---TSLFSLECVLKVMAFGILNYFR.......DA---........................
HGL_H00000376350    .................-FELLPRMASLGLTLLIFYYSFAIV.......GMEFFcgllypnccntstvadayrwlnht
HGL_H00000394033    .................WKTVSTIFLVVVLYLIIGATVFKAL.......EQPQEisqrttiviqkqtfisqhscvnst
HGL_H00000237596    .................AKDLFGFALMFFIIFLAYAQLAYLV.......FGTQV........................
HGL_H00000360601    .................-----TLWLLVGLSVHVVAVMLYLL.......DRFSPfgrfkvnseee.............
HGL_H00000376350    .................PPFMDILLLLLFFMIIFAILGFYLF.......SPNPS........................
HGL_R00000005229    .................--RFLLLAALILLYLLGGAAVFSAL.......ELAHErqakqrweerlanfsrshnlsree
HGL_N10008871       .................LPDILYVFLLFLFSVLMFSLMALKL.......FGDRGlktadgapyftnileiafelyvlv
HGL_H00000360302    .................-------VSVVLFLVSRFSPYEWHL.......EDNNE........................
HGL_N10008871       .................-------------------------.......-AYLG........................
HGL_H00000242607    .................-----LAILAFFMMEIFFKIFVFRL.......EFF--........................
HGL_H00000410146    .................-WMCIVFAYIGVSVVLFLVSRFSPY.......EWHTE........................
HGL_H00000373594    .................SLVILSVF-----------------.......-----........................
HGL_H00000282499    .................--MCIVFAYIGVSVVLFLVSRFSPY.......EWHTE........................
HGL_H00000307342    .................-------------------------.......-----........................
HGL_H00000282611    .................-------I-----------------.......-----........................
HGL_H00000364536    .................-------------------------.......-----........................
HGL_H00000285900    .................-WMCIVFAYIGVSVVLFLVSRFSPY.......EWHSE........................
HGL_H00000325296    .................IWNIVDLVVILLSIVAVGFHIFRTL.......EVN--........................
HGL_H00000377482    .................-----------------E-------.......-----........................


                                                                                                    
                                                                                                    
d1f6ga_               ...............................................................G..............
HGL_H00000358784    ...............................................................S..............
HGL_H00000228858    ...............................................................E..............
HGL_H00000358786    ...............................................................E..............
HGL_H00000328511    ...............................................................T..............
HGL_H00000218176    ...............................................................K..............
HGL_H00000415257    ...............................................................E..............
HGL_H00000295082    ...............................................................E..............
HGL_H00000360806    ...............................................................D..............
HGL_H00000265969    ...............................................................Qpndpsaseh.....
HGL_H00000358802    ...............................................................Rpsdprgndh.....
HGL_H00000329426    ...............................................................A..............
HGL_H00000371514    ...............................................................G..............
HGL_H00000376966-2  ...............................................................Qpndpsaseh.....
HGL_H00000303282    ...............................................................Dpddilgsnh.....
HGL_H00000305824    ...............................................................G..............
HGL_H00000297404    ...............................................................D..............
HGL_H00000221444    ...............................................................E..............
HGL_H00000287042    ...............................................................N..............
HGL_H00000360626-1  ...............................................................Ds.............
HGL_H00000307694    ...............................................................N..............
HGL_H00000312129    ...............................................................Rv.............
HGL_H00000315654    ...............................................................Ar.............
HGL_H00000262186    ...........................................................glggP..............
HGL_H00000318212    ..........................................................dpasgP..............
HGL_H00000384611    ...............................................................N..............
HGL_H00000345055    ...............................................................N..............
HGL_H00000346601    ...............................................................N..............
HGL_H00000331727    ..........................................................dsssgP..............
HGL_H00000262916    ...............................................................N..............
HGL_H00000373648    ...............................................................Evdaqgeemk.....
HGL_H00000346534    .........teceklmegnnteirwknvkinfdnvgagylallqvatfkgwmdimyaavdsrkP..............
HGL_H00000410257    ........ksecesfnmtgelywtkvkvnfdnvgagylallqvatfkgwmdimyaavdsrgyeE..............
HGL_H00000271751    .................................................yqfngsgsgkweggP..............
HGL_H00000353206    ...............................................................-..............
HGL_H00000352011    ...............................................................-..............
HGL_H00000383028    ...............................................................-..............
HGL_H00000348945    ...............................................................-..............
HGL_H00000346534    ...............................................................Giddm..........
HGL_H00000333496    ...............................................................A..............
HGL_H00000348945    ...............................................................T..............
HGL_H00000257981    ............................ylvsrspaegnssgqsdncsssgeanktglellggP..............
HGL_H00000364536    ...............................................................-..............
HGL_H00000155840    ...............................................................Nesgl..........
HGL_H00000283256    ...............................................................Giddm..........
HGL_H00000384264    ...............................................................G..............
HGL_H00000390600    .............................................nmtecenqnytgsffwvnV..............
HGL_H00000328813    .......................................................ygnstlggP..............
HGL_H00000261917    ...............................................................N..............
HGL_H00000353206    ...............................................................Giddm..........
HGL_H00000264661    ...............................................................Eandpllwdiagp..
HGL_H00000303540    ...............................................................Giddm..........
HGL_H00000357342    ...............................................................Fppdcwvymnrmvnh
HGL_H00000364536    ...............................................................-..............
HGL_H00000350183    ..............................................ltgedwnevmyngirsqG..............
HGL_H00000319591-1  ...............................................................A..............
HGL_H00000006839    ...............................................................-..............
HGL_H00000006839    ...............................................................-..............
HGL_H00000328478    ...............................................................G..............
HGL_H00000283256    ...............................................................-..............
HGL_H00000277549    ..............................................ltgedwnavmyhgiesqG..............
HGL_H00000386761    ...............................................................G..............
HGL_H00000303540    ...............................................................-..............
HGL_H00000410257    ...............................................................Dm.............
HGL_H00000352011    ...............................................................T..............
HGL_H00000288139    ...............................................................Nqinrn.........
HGL_H00000355192    ...............................................................Dfedtevrr......
HGL_H00000385724    ...............................................................Ggkfnfdemqtrr..
HGL_H00000400945    ...............................................................Giddi..........
HGL_H00000355192    ...............................................................-..............
HGL_H00000390600    ...............................................................Keeagiddm......
HGL_H00000383028    ...............................................................T..............
HGL_H00000365441    ...............................................................Tqinrn.........
HGL_H00000352011    ...............................................................-..............
HGL_H00000383028    ...............................................................-..............
HGL_H00000309052    ...............................................................P..............
HGL_H00000277549    ...............................................................Tsinrh.........
HGL_H00000355192    ...............................................................-..............
HGL_H00000364536    ...............................................................-..............
HGL_H00000277549    ...............................................................-..............
HGL_H00000352011    ...............................................................-..............
HGL_H00000346534    ...............................................................-..............
HGL_H00000350183    .................krhefhydniiwalltlftvstgegwpqvlqhsvdvteedrgpsrsN..............
HGL_H00000283256    ...............................................................-..............
HGL_H00000369268    ...............................................................E..............
HGL_H00000303540    ...............................................................-..............
HGL_H00000385724    ...............................................................-..............
HGL_H00000355192    aralchlqmfgkiamvdgtqinrnnnfqtfpqavlllfrqcatgeawqeillacsygklcdpeS..............
HGL_H00000288139    ...............................................................Nfdetqtkr......
HGL_H00000385724    ...............................................................Teinrn.........
HGL_H00000277549    ...............................................................-..............
HGL_H00000348945    ...............................................................-..............
HGL_H00000288139    ...............................................................-..............
HGL_H00000006839    ...............................................................-..............
HGL_H00000350183    ...............................................................-..............
HGL_H00000383028    ...............................................................-..............
HGL_H00000410257    ...............................................................-..............
HGL_H00000346534    ...............................................................-..............
HGL_H00000288139    ...............................................................-..............
HGL_H00000353362    .................................................evkardrewkkyefH..............
HGL_H00000306275    ...............................................................-..............
HGL_H00000390600    ...............................................................-..............
HGL_H00000303540    ...............................................................-..............
HGL_H00000364536    ...............................................................-..............
HGL_H00000365441    ...............................................................-..............
HGL_H00000353362    ...............................................................Nfdegtpp.......
HGL_H00000283256    ...............................................................-..............
HGL_H00000365441    ...............................................................Nfdqthtkr......
HGL_H00000348945    ...............................................................-..............
HGL_H00000353206    ...............................................................-..............
HGL_H00000410257    ...............................................................-..............
HGL_H00000006839    ...............................................................-..............
HGL_H00000350183    ...............................................................Shinrh.........
HGL_H00000264773    ...............................................................Qq.............
HGL_H00000310568    ...............................................................-..............
HGL_H00000302166    ...............................................................-..............
HGL_H00000222249    ...............................................................Kq.............
HGL_H00000251102    ...............................................................D..............
HGL_H00000365441    ...........................................sgsgractlnqtecrgrwpgP..............
HGL_N10019168       ...............................................................Pwenfqn........
HGL_H00000385724    ...............................................................-..............
HGL_H00000251127    ...............................................................-..............
HGL_H00000294725    ...............................................................K..............
HGL_H00000384427    ...............................................................N..............
HGL_H00000316605    ...............................................................N..............
HGL_H00000400945    ...............................................................-..............
HGL_H00000243457    ...............................................................Dldaskeskacv...
HGL_H00000271915    ...............................................................Qq.............
HGL_H00000394033    ...............................................................-..............
HGL_H00000386251    ...............................................................Dleldhdappenhti
HGL_H00000391498-1  .......................................alerfvqvileawvkgvnpkgnstN..............
HGL_H00000355580    .......................................qleqflgrvleasnygvsvlsnasG..............
HGL_H00000390600    ...............................................................-..............
HGL_H00000341006    ...............................................................P..............
HGL_H00000334650    .........................................tedeklevlkllqkvkpewwpqT..............
HGL_H00000298480    ...............................................................N..............
HGL_H00000353362    ...............................................................Dedsdedefqiteh.
HGL_H00000310568    ......................................eletliqhaldadnagvspignssnS..............
HGL_H00000328150    ...............................................................Dlepaegrgrtpcv.
HGL_H00000400945    ...............................................................-..............
HGL_H00000357067    ...............................................................Dlehledtawtpcv.
HGL_H00000402797    ....................................elglfikevadalgggadpetnstsisN..............
HGL_H00000306497    ...............................................................Dleasavvaaaggpt
HGL_H00000386796    ...............................................................-..............
HGL_H00000383330    ...............................................................Dmdhiedsswtpcv.
HGL_H00000339960-2  ...............................................................Dldhvgdhewipcv.
HGL_H00000263372    ...............................................................-..............
HGL_H00000345708    ...............................................................Dlapgegttvpcv..
HGL_H00000341479    ...............................................................Dlaappppapcf...
HGL_H00000355580    ...............................................................-..............
HGL_H00000240662    ...............................................................Diyaymeksgleksa
HGL_H00000391498-2  ...............................................................-..............
HGL_H00000352527    ...............................................................-..............
HGL_H00000376438    ...............................................................Dllndpditpcv...
HGL_H00000352527    ........................................gldkilqvvsdaagqgvaitgnqT..............
HGL_H00000334650    ...............................................................-..............
HGL_H00000316136    ...............................................................Dlpefhppdnhtpcv
HGL_H00000402797    ...............................................................-..............
HGL_H00000386796    ...............................................................-..............
HGL_H00000361952    ...............................................................-..............
HGL_H00000357068    ...............................................................Dllelgppanhtpcv
HGL_H00000251127    ...............................................................-..............
HGL_H00000381911    ...............................................................Dlepsetisnhtpci
HGL_H00000386796    ...............................................................-..............
HGL_H00000361952    ...............................................................-..............
HGL_H00000371180    ...............................................................-..............
HGL_H00000353206    ...............................................................-..............
HGL_H00000344820    ......................................galeellatalraqghgvsglgnssE..............
HGL_H00000251287    ...............................................................Fpsncwvsinnmvnh
HGL_H00000391498-1  ...............................................................-..............
HGL_M00000049206    ...............................................................-..............
HGL_H00000353206    ...............................................................-..............
HGL_H00000251127    ...............................................................-..............
HGL_H00000294309    ...............................................................-..............
HGL_H00000282611    ...............................................................D..............
HGL_H00000294309    ...............................................................Pnrerl.........
HGL_H00000319591-2  ...............................................................-..............
HGL_H00000344820    ...............................................................-..............
HGL_H00000251127    .......................................dwnkimhdcmvqppfctpdeftywA..............
HGL_H00000400945    ...............................................................-..............
HGL_H00000353362    ...............................................................-..............
HGL_H00000376350    ......................vgdktvveegyyylnnfdnilnsfvtlfeltvvnnwyiimeG..............
HGL_H00000394033    ......................................eldeliqqivaainagiiplgntsnQ..............
HGL_H00000237596    ...............................................................D..............
HGL_H00000360601    ...............................................................E..............
HGL_H00000376350    ...............................................................D..............
HGL_R00000005229    .............................................lrgflrhyeeatragirmDnv............
HGL_N10008871       .....................................................ttannpdimmP..............
HGL_H00000360302    ...............................................................Eprdpqsppdp....
HGL_N10008871       ...............................................................R..............
HGL_H00000242607    ...............................................................-..............
HGL_H00000410146    ...............................................................Efedgretqsses..
HGL_H00000373594    ...............................................................-..............
HGL_H00000282499    ...............................................................Epedgkegpsdqp..
HGL_H00000307342    ...............................................................-..............
HGL_H00000282611    ...............................................................-..............
HGL_H00000364536    ...............................................................-..............
HGL_H00000285900    ...............................................................Efeegrdqtttdq..
HGL_H00000325296    ...............................................................-..............
HGL_H00000377482    ...............................................................-..............


                                      60        70              80                         90       
                                       |         |               |                          |       
d1f6ga_               ..............AQLITYPAALWWSVETAT.....TV.GYGD..LYP...............VTLWGRCVAVVVMV
HGL_H00000358784    ..............SGFSSIPDAFWWAVVTMT.....TV.GYGD..MHP...............VTIGGKIVGSLCAI
HGL_H00000228858    ..............SHFSSIPDAFWWAVVSMT.....TV.GYGD..MYP...............VTIGGKIVGSLCAI
HGL_H00000358786    ..............SHFSSIPDGFWWAVVTMT.....TV.GYGD..MCP...............TTPGGKIVGTLCAI
HGL_H00000328511    ..............THFQSIPDAFWWAVVTMT.....TV.GYGD..MKP...............ITVGGKIVGSLCAI
HGL_H00000218176    ..............TNFTSIPAAFWYTIVTMT.....TL.GYGD..MVP...............STIAGKIFGSICSL
HGL_H00000415257    ..............SQFPSIPDAFWWAVVSMT.....TV.GYGD..MVP...............TTIGGKIVGSLCAI
HGL_H00000295082    ..............TLFKSIPQSFWWAIITMT.....TV.GYGD..IYP...............KTTLGKLNAAISFL
HGL_H00000360806    ..............TKFKSIPASFWWATITMT.....TV.GYGD..IYP...............KTLLGKIVGGLCCI
HGL_H00000265969    ..............THFKNIPIGFWWAVVTMT.....TL.GYGD..MYP...............QTWSGMLVGALCAL
HGL_H00000358802    ..............TDFKNIPIGFWWAVVTMT.....TL.GYGD..MYP...............KTWSGMLVGALCAL
HGL_H00000329426    ..............TKFTSIPASFWWATITMT.....TV.GYGD..IYP...............KTLLGKIVGGLCCI
HGL_H00000371514    ..............TNFTSILQAWWWAAVSIS.....TV.GYGD..MYP...............ETHLGRLFAFLCIA
HGL_H00000376966-2  ..............TQFKNIPIGFWWAVVTMT.....TL.GYGD..MYP...............QTWSGMLVGALCAL
HGL_H00000303282    ..............TYFKNIPIGFWWAVVTMT.....TL.GYGD..MYP...............KTWSGMLVGALCAL
HGL_H00000305824    ..............SSLTSIPICWWWATISMT.....TV.GFGD..TYP...............VTLAGKLIASTCIL
HGL_H00000297404    ..............TTFTSVPCAWWWATTSMT.....TV.GYGD..IRP...............DTTTGKIVAFMCIL
HGL_H00000221444    ..............SHFTSIPESFWWAVVTMT.....TV.GYGD..MAP...............VTVGGKIVGSLCAI
HGL_H00000287042    ..............EGLATIPACWWWATVSMT.....TV.GYGD..VVP...............GTTAGKLTASACIL
HGL_H00000360626-1  ..............PEFTSIPACYWWAVITMT.....TV.GYGD..MVP...............RSTPGQVVALSSIL
HGL_H00000307694    ..............VGFNTIPACWWWGTVSMT.....TV.GYGD..VVP...............ETVAGKLAASGCIL
HGL_H00000312129    ..............LEFTSIPASYWWAIISMT.....TV.GYGD..MVP...............RSVPGQMVALSSIL
HGL_H00000315654    ..............RDFSSVPASYWWAVISMT.....TV.GYGD..MVP...............RSLPGQVVALSSIL
HGL_H00000262186    ..............SIKDKYVTALYFTFSSLT.....SV.GFGN..VSP...............NTNSEKIFSICVML
HGL_H00000318212    ..............SVQDKYVTALYFTFSSLT.....SV.GFGN..VSP...............NTNSEKVFSICVML
HGL_H00000384611    ..............KDFASIPAACWWVIISMT.....TV.GYGD..MYP...............ITVPGRILGGVCVV
HGL_H00000345055    ..............KEFSTYADALWWGTITLT.....TI.GYGD..KTP...............LTWLGRLLSAGFAL
HGL_H00000346601    ..............DHFDTYADALWWGLITLT.....TI.GYGD..KYP...............QTWNGRLLAATFTL
HGL_H00000331727    ..............SIKDKYVTALYFTFSSLT.....SV.GFGN..VSP...............NTNSEKIFSICVML
HGL_H00000262916    ..............SEFSSYADSLWWGTITLT.....TI.GYGD..KTP...............HTWLGRVLAAGFAL
HGL_H00000373648    ..............EEFETYADALWWGLITLA.....TI.GYGD..KTP...............KTWEGRLIAATFSL
HGL_H00000346534    ..............DEQPKYEDNIYMY-----.....--.----..---...............-----IYFVIFIIF
HGL_H00000410257    ..............------------------.....--.----..---...............--------------
HGL_H00000271751    ..............SKNSVYISSLYFTMTSLT.....SV.GFGN..IAP...............STDIEKIFAVAIMM
HGL_H00000353206    ..............----NLFAGKFYHCVNMT.....T-.----..---...............--------------
HGL_H00000352011    ..............------------------.....--.----..---...............--------------
HGL_H00000383028    ..............------------------.....--.----..---...............--------------
HGL_H00000348945    ..............------------------.....--.----..---...............--------------
HGL_H00000346534    ..............FNFETFGNSMI-------.....--.----..---...............--------------
HGL_H00000333496    ..............SKFTSIPAAFWYTIVTMT.....TL.G---..---...............--------------
HGL_H00000348945    ..............IPDRKNFDSLLWAIVTV-.....--.----..---...............--------------
HGL_H00000257981    ..............SLRSAYITSLYFALSSLT.....SV.GFGN..VSA...............NTDTEKIFSICTML
HGL_H00000364536    ..............------------------.....--.----..---...............--------------
HGL_H00000155840    ..............VEFGSYADALWWGVVTVT.....TI.GYGD..KVP...............QTWVGKTIASCFSV
HGL_H00000283256    ..............FNFETFGNSMICLFQ---.....--.----..---...............--------------
HGL_H00000384264    ..............RLARKYVYSLYWSTLTLT.....TI.G-ET..PPP...............VLDSEYIFVVIDFL
HGL_H00000390600    ..............------------------.....--.----..---...............--------------
HGL_H00000328813    ..............SIRSAYIAALYFTLSSLT.....SV.GFGN..VSA...............NTDAEKIFSICTML
HGL_H00000261917    ..............SWGKQYSYALFKAMSHML.....CI.GYGK..QAP...............VGMSDVWLTMLSMI
HGL_H00000353206    ..............FNFETFGNSMICLFQITT.....--.----..---...............--------------
HGL_H00000264661    ..............SRRSAYIAALYFTLSSLT.....SV.GFGN..VCA...............NTDAEKVFSVCTML
HGL_H00000303540    ..............FNFETFGNSMICLFQI--.....--.----..---...............--------------
HGL_H00000357342    ..............SWGRQYSHALFKAMSHML.....CI.GYGQ..QAP...............VGMPDVWLTMLSMI
HGL_H00000364536    ..............------------------.....--.----..---...............--------------
HGL_H00000350183    ..............GVSSGMWSAIYFIVLTL-.....--.----..---...............--------------
HGL_H00000319591-1  ..............SKFTSIPASFWYTIVTMT.....TL.G---..---...............--------------
HGL_H00000006839    ..............------------------.....--.----..---...............--------------
HGL_H00000006839    ..............---NLFAGKFYHCINTTT.....--.----..---...............--------------
HGL_H00000328478    ..............YLAREYIYCLYWSTLTLT.....TI.G-ET..PPP...............VKDEEFLFVIFDFL
HGL_H00000283256    ..............---NLFAGKFYHCI----.....--.----..---...............--------------
HGL_H00000277549    ..............GVSKGMFSSFYFIVLTL-.....--.----..---...............--------------
HGL_H00000386761    ..............RLSRKYIYSLYWSTLTLT.....TI.G-ET..PPP...............VKDEEYLFVVIDFL
HGL_H00000303540    ..............---NLFAGKFYHCVNTTT.....--.----..---...............--------------
HGL_H00000410257    ..............FNFQTFANSMLCLFQITT.....SA.G---..---...............--------------
HGL_H00000352011    ..............LPDRKNFDSLLWAIVTV-.....--.----..---...............--------------
HGL_H00000288139    ..............NNFQTFPQAVL-------.....--.----..---...............--------------
HGL_H00000355192    ..............SNFDNFPQALISVFQVLTgedwtSV.MYNG..IMAygg............PTYPGVLVCIYFII
HGL_H00000385724    ..............STFDNFPQSLLTVF----.....--.----..---...............--------------
HGL_H00000400945    ..............FNFDTFTGSMLCLFQITT.....SA.G---..---...............--------------
HGL_H00000355192    ..............------------------.....--.----..---...............--------------
HGL_H00000390600    ..............FNFKTFANSMLCLFQITT.....SA.GWD-..---...............--------------
HGL_H00000383028    ..............VPDRKNFDSLLWAIVTV-.....--.----..---...............--------------
HGL_H00000365441    ..............NNFQTFPQAVL-------.....--.----..---...............--------------
HGL_H00000352011    ..............------------------.....--.----..---...............--------------
HGL_H00000383028    ..............------------------.....--.----..---...............--------------
HGL_H00000309052    ..............WRFENFFTTMF-------.....--.----..---...............--------------
HGL_H00000277549    ..............NNFRTFLQAL--------.....--.----..---...............--------------
HGL_H00000355192    ..............------------------.....--.----..---...............--------------
HGL_H00000364536    ..............------------------.....--.----..---...............--------------
HGL_H00000277549    ..............------------------.....--.----..---...............--------------
HGL_H00000352011    ..............------------------.....--.----..---...............--------------
HGL_H00000346534    ..............------------------.....--.----..---...............--------------
HGL_H00000350183    ..............RMEMSIFYVVYFVV----.....--.----..---...............--------------
HGL_H00000283256    ..............------------------.....--.----..---...............--------------
HGL_H00000369268    ..............RLRRQYLYSFYFSTLILT.....TV.G--Dt.PLP...............AREEEYLFMVGNFL
HGL_H00000303540    ..............---KSYKD----------.....--.----..---...............--------------
HGL_H00000385724    ..............------------------.....--.----..---...............--------------
HGL_H00000355192    ..............------------------.....--.---D..YVPgeeytcg........TSFAYYYFISFYML
HGL_H00000288139    ..............STFDNFPQALLTVF----.....--.----..---...............--------------
HGL_H00000385724    ..............NNFQTFPQAVLL------.....--.----..---...............--------------
HGL_H00000277549    ..............------------------.....--.----..---...............--------------
HGL_H00000348945    ..............------------------.....--.----..---...............--------------
HGL_H00000288139    ..............------------------.....--.----..---...............--------------
HGL_H00000006839    ..............------------------.....--.----..---...............--------------
HGL_H00000350183    ..............------------------.....--.----..---...............--------------
HGL_H00000383028    ..............------------------.....--.----..---...............--------------
HGL_H00000410257    ..............------------------.....--.----..---...............--------------
HGL_H00000346534    ..............------------------.....--.----..---...............--------------
HGL_H00000288139    ..............------------------.....--.----..---...............--------------
HGL_H00000353362    ..............------YDNVLWALLTLF.....TV.STGE..GWPqvlkhsvdatfenqgPSPGYRME------
HGL_H00000306275    ..............---WTFFQAYYYCFITLT.....TI.GFGD..YVAlqkdqalq.......TQPQYVAFSFVYIL
HGL_H00000390600    ..............------------------.....--.----..---...............--------------
HGL_H00000303540    ..............------------------.....--.----..---...............--------------
HGL_H00000364536    ..............------------------.....--.----..---...............--------------
HGL_H00000365441    ..............------------------.....--.----..---...............--------------
HGL_H00000353362    ..............TNFDTFPAA---------.....--.----..---...............--------------
HGL_H00000283256    ..............------------------.....--.----..---...............--------------
HGL_H00000365441    ..............STFDTFPQALLTV-----.....--.----..---...............--------------
HGL_H00000348945    ..............------------------.....--.----..---...............--------------
HGL_H00000353206    ..............------------------.....--.----..---...............--------------
HGL_H00000410257    ..............------------------.....--.----..---...............--------------
HGL_H00000006839    ..............------------------.....--.----..---...............--------------
HGL_H00000350183    ..............NNFRSFFGSL--------.....--.----..---...............--------------
HGL_H00000264773    ..............DVTSNFLGAMWLISITFL.....SI.GYGD..MVP...............NTYCGKGVCLLTGI
HGL_H00000310568    ..............---WTALESIYFVVVTLT.....TV.GFGD..FVAggnagin........YREWYKPLVWFWIL
HGL_H00000302166    ..............---WSFFHAYYYCFITLT.....TI.GFGD..YVAlqskgalq.......RKPFYVAFSFMYIL
HGL_H00000222249    ..............EVTSNFLGAMWLISITFL.....SI.GYGD..MVP...............HTYCGKGVCLLTGI
HGL_H00000251102    ..............GVGNSYIRCYYWAVKTLI.....TI.G-GL..PDP...............QTLFEIVFQLLNYF
HGL_H00000365441    ..............NGGITNFDNFFFAMLT--.....--.----..---...............--------------
HGL_N10019168       ..............NQALTYWECVYLLMVTMS.....TV.GYGD..VYA...............KTTLGRLFMVFFIL
HGL_H00000385724    ..............------------------.....--.----..---...............--------------
HGL_H00000251127    ..............------------------.....--.----..---...............--------------
HGL_H00000294725    ..............---LNLFDSLYFCIVTFS.....TV.GFGD..VTP...............ETWSSKLFVVAMIC
HGL_H00000384427    ..............AT-GHLSDTLWLIPITFL.....TI.GYGD..VVP...............GTVWGKIVCLCTGV
HGL_H00000316605    ..............GEGNKYLRCYYWAVRSLI.....TI.G-GL..PEP...............QTLFEIVFQLLNFF
HGL_H00000400945    ..............------------------.....--.----..---...............--------------
HGL_H00000243457    ..............SEVNSFTAAFLFSIETQT.....TI.GYGFrcVTD...............ECPIAVFMVVFQSI
HGL_H00000271915    ..............DVTSNFLGAMWLISITFL.....SI.GYGD..MVP...............HTYCGKGVCLLTGI
HGL_H00000394033    ..............---WSALDAIYFVVITLT.....TI.GFGD..YVAggsdie.........YLDFYKPVVWFWIL
HGL_H00000386251    ............cvKYITSFTAAFSFSLETQL.....TI.GYGT..MFPsg.............DCPSAIALLAIQML
HGL_H00000391498-1  ..............PSNWDFSSSFFFAGTVIT.....TI.GYGN..LAP...............STGLGQVFCVFYAL
HGL_H00000355580    ..............NWNWDFTSALFFASTVLS.....TT.GYGH..TVP...............LSDGGKAFCIIYSV
HGL_H00000390600    ..............------------------.....--.----..---...............--------------
HGL_H00000341006    ..............IHFGNLGVALYTLFVCLT.....QD.GWVD..IYSdfrikerdyal....EIGGAIYFAVFIII
HGL_H00000334650    ..............AEDWNFLGALFFCCTVLS.....TV.GYGH..MFP...............VTRLGRYLCMLYAL
HGL_H00000298480    ..............---LDLLTSFYFCIVTFS.....TV.GYGD..VTP...............KIWPSQLLVVIMIC
HGL_H00000353362    ..............NNFRTFFQAL--------.....--.----..---...............--------------
HGL_H00000310568    ..............SSHWDLGSAFFFAGTVIT.....TI.GYGN..IAP...............STEGGKIFCILYAI
HGL_H00000328150    ..............MQVHGFMAAFLFSIETQT.....TI.GYGLrcVTE...............ECPVAVFMVVAQSI
HGL_H00000400945    ..............------------------.....--.----..---...............--------------
HGL_H00000357067    ..............NNLNGFVAAFLFSIETET.....TI.GYGHrvITD...............QCPEGIVLLLLQAI
HGL_H00000402797    ..............HSAWNLGSAFFFSGTIIT.....TI.GYGN..AAL...............RTDAGRLFCIFYAL
HGL_H00000306497    gnvgatpaapkpciMHVNGFLGAFLFSVETQT.....TI.GYGFrcVTE...............ECPLAVIAVVVQSI
HGL_H00000386796    ..............------------------.....--.----..---...............--------------
HGL_H00000383330    ..............TNLNGFVSAFLFSIETET.....TI.GYGYrvITD...............KCPEGIILLLIQSV
HGL_H00000339960-2  ..............ENLSGFVSAFLFSIETET.....TI.GYGFrvITE...............KCPEGIVLLLVQAI
HGL_H00000263372    ..............---WSFLDAFYFCFISLS.....TI.GLGD..YVPgeapgqp........HRALYKVLVTVYLF
HGL_H00000345708    ..............TSIHSFSSAFLFSIEVQV.....TI.GFGGrmVTE...............ECPLAILILIVQNI
HGL_H00000341479    ..............SHVASFLAAFLFALETQT.....SI.GYGVrsVTE...............ECPAAVAAVVLQCI
HGL_H00000355580    ..............---WNFLESFYFCFISLS.....TI.GLGD..YVPgegynqk........FRELYKIGITCYLL
HGL_H00000240662    .......lestvcvTNVRSFTSAFLFSIEVQV.....TI.GFGGrmMTE...............ECPLAITVLILQNI
HGL_H00000391498-2  ..............---WSLSEGFYFAFITLS.....TI.GFGD..YVVgtdpskh........YIPVYRSLAGLWIL
HGL_H00000352527    ..............---WNYIEGLYYSFITIS.....TI.GFGD..FVAgvnpsan........YHALYRYFVELWIY
HGL_H00000376438    ..............DNVHSFTAAFLFSLETQT.....TI.GYGYrcVTE...............ECSMAVLMVILQSI
HGL_H00000352527    ..............FNNWNWPNAMIFAATVIT.....TI.GYGN..VAP...............KTPAGRLFCVFYGL
HGL_H00000334650    ..............---MNFEEAFYFCFVTLT.....TI.GFGD..IKL...............NHPHFFLFFSIYII
HGL_H00000316136    ..............ENINGMTSAFLFSLETQV.....TI.GYGFrcVTE...............QCATAIFLLVFQSI
HGL_H00000402797    ..............---WSKLEAIYFVIVTLT.....TV.GFGD..YVAgadpkq.........ESPAYQPLVWFWIL
HGL_H00000386796    ..............------------------.....--.----..---...............--------------
HGL_H00000361952    ..............---WTFFHAYYYCFITLT.....TI.GFGD..FVAlqsdealq.......RKPPYVAFSFLYIL
HGL_H00000357068    ..............VQVHTLTGAFLFSLESQT.....TI.GYGFryISE...............ECPLAIVLLIAQLV
HGL_H00000251127    ..............DRFTTFPRAF--------.....--.----..---...............--------------
HGL_H00000381911    ..............MKVDSLTGAFLFSLESQT.....TI.GYGVrsITE...............ECPHAIFLLVAQLV
HGL_H00000386796    ..............------------------.....--.----..---...............--------------
HGL_H00000361952    ..............---WKFAGSFYFAITVIT.....TI.GYGH..AAP...............GTDSGRVFCMFYAL
HGL_H00000371180    ..............------------------.....--.----..---...............--------------
HGL_H00000353206    ..............------------------.....--.----..---...............--------------
HGL_H00000344820    ..............ASNWDLPSALLFTVSILT.....TA.GYGH..MAP...............LSQGGKAFCVVYAA
HGL_H00000251287    ..............SWSELYSFALFKAMSHML.....CI.GYGK..QAP...............ESMTDIWLTMLSMI
HGL_H00000391498-1  ..............---WSLSEGFYFAFITLS.....TI.GFGD..YVVgtdpskh........YIPVYRSLAGLWIL
HGL_M00000049206    ..............------------------.....--.----..---...............--------------
HGL_H00000353206    ..............------------------.....--.----..---...............--------------
HGL_H00000251127    ..............------------------.....--.----..---...............--------------
HGL_H00000294309    ..............------------------.....--.----..---...............------ILVVVYYV
HGL_H00000282611    ..............MNNWGSLDTIFFTLFSLA.....TVeGWTD..MQTqlekh..........NFIVSRAFTIIFIL
HGL_H00000294309    ..............AYFRSLPEALTSLLVLLT.....TA.NNPDv.MIP...............AYSKNRAYAIFFIV
HGL_H00000319591-2  ..............------------------.....--.-YGD..MVP...............KTIAGKIFGSICSL
HGL_H00000344820    ..............---CSLLEAIYFCFNSLS.....TI.GLGD..LLPgsgrslhpv......IYQLGQVALLGYLL
HGL_H00000251127    ..............TDCGNYAGAL--------.....--.----..---...............-----MYFCSFYVI
HGL_H00000400945    ..............------------------.....--.----..---...............--------------
HGL_H00000353362    ..............---WNIFD----------.....--.----..---...............--------------
HGL_H00000376350    ..............------------------.....--.----..---...............--------------
HGL_H00000394033    ..............ISHWDLGSSFFFAGTVIT.....TI.G---..---...............--------------
HGL_H00000237596    ..............------------------.....--.----..---...............--------------
HGL_H00000360601    ..............EDALTLSSAMWFSWGVLL.....NS.GIGE..GAP...............RSFSARILGMVWAG
HGL_H00000376350    ..............PYFSTLENSIVSLFVLLT.....TA.NFPDv.MMPsys............RNPWSCVFFIVYLS
HGL_R00000005229    ..............RPRWDFTGAFYFVGTVVS.....TI.----..---...............--------------
HGL_N10008871       ..............AYNVSWWYSLYFIT----.....--.----..---...............--------------
HGL_H00000360302    ..............PNEFGIFNSLWFSLGAFM.....QQ.G-CD..ISP...............RSLSGRIVGGVWWF
HGL_N10008871       ..............KQFWNWFD----------.....--.----..---...............--------------
HGL_H00000242607    ..............------------------.....--.----..---...............--------------
HGL_H00000410146    ..............TNEFGIFNSLWFSLGAFM.....QQ.G-CD..ISP...............RSLSGRIVGGVWWF
HGL_H00000373594    ..............------------------.....--.----..---...............--------------
HGL_H00000282499    ..............PNEFGIFNSLWFSLGAFM.....QQ.G-CD..ISP...............RSLSGRIVGGVWWF
HGL_H00000307342    ..............----------------ML.....CI.GYGA..QAP...............VSMSDLWITMLSMI
HGL_H00000282611    ..............------------------.....--.----..---...............--------------
HGL_H00000364536    ..............------------------.....--.----..---...............-------FVSYIII
HGL_H00000285900    ..............SNEFGIFNSLWFSLGAFM.....QQ.G-CD..ISP...............RSLSGRIVGGVWWF
HGL_H00000325296    ..............------------------.....--.----..---...............--------------
HGL_H00000377482    ..............------------------.....--.----..---...............--------------


                      100       110                                        120          130         
                        |         |                                          |            |         
d1f6ga_               AGITSFGLVTAALATWFV.................................GREQER...RGHFVRHSEKAAEEAY..
HGL_H00000358784    AGVLTIALPVPVIVSNF-.................................------...----------------..
HGL_H00000228858    AGVLTIALPVPVIVSNF-.................................------...----------------..
HGL_H00000358786    AGVLTIALPVPVIVSNF-.................................------...----------------..
HGL_H00000328511    AGVLTIALPVPVIVSNF-.................................------...----------------..
HGL_H00000218176    SGVLVIALPVPVIVSNFS.................................------...----------------..
HGL_H00000415257    AGVLTIALPVPVIVSNF-.................................------...----------------..
HGL_H00000295082    CGVIAIALPIHPIINNFV.................................------...----------------..
HGL_H00000360806    AGVLVIALPIPIIVNNFS.................................------...----------------..
HGL_H00000265969    AGVLTIAMPVPVIVNNF-.................................------...----------------..
HGL_H00000358802    AGVLTIAMPVPVIVNNF-.................................------...----------------..
HGL_H00000329426    AGVLVIALPIPIIVNNFS.................................------...----------------..
HGL_H00000371514    FGIILNGMPISILYNKFS.................................------...----------------..
HGL_H00000376966-2  AGVLTIAMPVPVIVNNF-.................................------...----------------..
HGL_H00000303282    AGVLTIAMPVPVIVNNF-.................................------...----------------..
HGL_H00000305824    CGILVVALPITIIFNKFS.................................------...----------------..
HGL_H00000297404    SGILVLALPIAIINDRF-.................................------...----------------..
HGL_H00000221444    AGVLTISLPVPVIVSNF-.................................------...----------------..
HGL_H00000287042    AGILVVVLPITLIFNKFS.................................HFYR--...----------------..
HGL_H00000360626-1  SGILLMAFPVTSIFHTFS.................................------...----------------..
HGL_H00000307694    GGILVVALPITIIFNKFS.................................------...----------------..
HGL_H00000312129    SGILIMAFPATSIFHTF-.................................------...----------------..
HGL_H00000315654    SGILLMAFPVTSIFHTFS.................................------...----------------..
HGL_H00000262186    IGSLMYASIFGNVSAIIQ.................................------...----------------..
HGL_H00000318212    IGSLMYASIFGNVSAIIQ.................................------...----------------..
HGL_H00000384611    SGIVLLALPITFIYHSF-.................................------...----------------..
HGL_H00000345055    LGISFFALPAGILGSGF-.................................------...----------------..
HGL_H00000346601    IGVSFFALPAGILGSGF-.................................------...----------------..
HGL_H00000331727    IGSLMYASIFGNVSAIIQ.................................------...----------------..
HGL_H00000262916    LGISFFALPAGILGSGF-.................................------...----------------..
HGL_H00000373648    IGVSFFALPAGILGSGL-.................................------...----------------..
HGL_H00000346534    GSFFTLNLFIGVIID---.................................------...----------------..
HGL_H00000410257    ------------------.................................------...----------------..
HGL_H00000271751    IGSLLYATIFGNVTTIFQ.................................Q-----...----------------..
HGL_H00000353206    ------------------.................................------...----------------..
HGL_H00000352011    ------------------.................................------...----------------..
HGL_H00000383028    ------------------.................................------...----------------..
HGL_H00000348945    ------------------.................................------...----------------..
HGL_H00000346534    ------------------.................................------...----------------..
HGL_H00000333496    ------------------.................................------...----------------..
HGL_H00000348945    ------------------.................................------...----------------..
HGL_H00000257981    IGALMHAVVFGNVTAIIQ.................................RM----...----------------..
HGL_H00000364536    ------------------.................................------...----------------..
HGL_H00000155840    FAISFFALPAGILGSGF-.................................------...----------------..
HGL_H00000283256    ------------------.................................------...----------------..
HGL_H00000384264    IGVLIFATIVGNIGSMIS.................................NM----...----------------..
HGL_H00000390600    ------------------.................................------...----------------..
HGL_H00000328813    IGALMHALVFGNVTAIIQ.................................RM----...----------------..
HGL_H00000261917    VGATCYAMFIGHATALIQ.................................S-----...----------------..
HGL_H00000353206    ------------------.................................------...----------------..
HGL_H00000264661    VGALMHAVVFGNVTAVIQ.................................------...----------------..
HGL_H00000303540    ------------------.................................------...----------------..
HGL_H00000357342    VGATCYAMFIGHATALIQ.................................S-----...----------------..
HGL_H00000364536    ------------------.................................------...----------------..
HGL_H00000350183    ------------------.................................------...----------------..
HGL_H00000319591-1  ------------------.................................------...----------------..
HGL_H00000006839    ------------------.................................------...----------------..
HGL_H00000006839    ------------------.................................------...----------------..
HGL_H00000328478    IGVLIFATIVGNVGSMIS.................................NM----...----------------..
HGL_H00000283256    ------------------.................................------...----------------..
HGL_H00000277549    ------------------.................................------...----------------..
HGL_H00000386761    VGILIFATIVGNVGSMIS.................................NM----...----------------..
HGL_H00000303540    ------------------.................................------...----------------..
HGL_H00000410257    ------------------.................................------...----------------..
HGL_H00000352011    ------------------.................................------...----------------..
HGL_H00000288139    ------------------.................................------...----------------..
HGL_H00000355192    LFVCGNYILLNVFL----.................................------...----------------..
HGL_H00000385724    ------------------.................................------...----------------..
HGL_H00000400945    ------------------.................................------...----------------..
HGL_H00000355192    ------------------.................................------...----------------..
HGL_H00000390600    ------------------.................................------...----------------..
HGL_H00000383028    ------------------.................................------...----------------..
HGL_H00000365441    ------------------.................................------...----------------..
HGL_H00000352011    ------------------.................................------...----------------..
HGL_H00000383028    ------------------.................................------...----------------..
HGL_H00000309052    ------------------.................................------...----------------..
HGL_H00000277549    ------------------.................................------...----------------..
HGL_H00000355192    ------------------.................................------...----------------..
HGL_H00000364536    ------------------.................................------...----------------..
HGL_H00000277549    ------------------.................................------...----------------..
HGL_H00000352011    ------------------.................................------...----------------..
HGL_H00000346534    ------------------.................................------...----------------..
HGL_H00000350183    ------------------.................................------...----------------..
HGL_H00000283256    ------------------.................................------...----------------..
HGL_H00000369268    LAVMGFATIMGSMSSV--.................................------...----------------..
HGL_H00000303540    ------------------.................................------...----------------..
HGL_H00000385724    ------------------.................................------...----------------..
HGL_H00000355192    CAFLIINLFVAVIMDN--.................................------...----------------..
HGL_H00000288139    ------------------.................................------...----------------..
HGL_H00000385724    ------------------.................................------...----------------..
HGL_H00000277549    ------------------.................................------...----------------..
HGL_H00000348945    ------------------.................................------...----------------..
HGL_H00000288139    ------------------.................................------...----------------..
HGL_H00000006839    ------------------.................................------...----------------..
HGL_H00000350183    ------------------.................................------...----------------..
HGL_H00000383028    ------------------.................................------...----------------..
HGL_H00000410257    ------------------.................................------...----------------..
HGL_H00000346534    ------------------.................................------...----------------..
HGL_H00000288139    ------------------.................................------...----------------..
HGL_H00000353362    ------------------.................................------...----------------..
HGL_H00000306275    TGLTVIGAFLNLVVLRF-.................................------...----------------..
HGL_H00000390600    ------------------.................................------...----------------..
HGL_H00000303540    ------------------.................................------...----------------..
HGL_H00000364536    ------------------.................................------...----------------..
HGL_H00000365441    ------------------.................................------...----------------..
HGL_H00000353362    ------------------.................................------...----------------..
HGL_H00000283256    ------------------.................................------...----------------..
HGL_H00000365441    ------------------.................................------...----------------..
HGL_H00000348945    ------------------.................................------...----------------..
HGL_H00000353206    ------------------.................................------...----------------..
HGL_H00000410257    ------------------.................................------...----------------..
HGL_H00000006839    ------------------.................................------...----------------..
HGL_H00000350183    ------------------.................................------...----------------..
HGL_H00000264773    MGAGCTALVVAVVARKLE.................................LTKAEK...HVHNFMMDTQLTKRVK..
HGL_H00000310568    VGLAYFAAVLSMIGDWLR.................................VLSRKT...KEEVGEIKAHAAEWKA..
HGL_H00000302166    VGLTVIGAFLNLVVLR--.................................------...----------------..
HGL_H00000222249    MGAGCTALVVAVVARKLE.................................LTKAEK...HVHNFMMDTQLTKRVK..
HGL_H00000251102    TGVFAFSVMIGQM-----.................................------...----------------..
HGL_H00000365441    ------------------.................................------...----------------..
HGL_N10019168       GGLAMFASYVPEIIELIG.................................NRKKYGg..SYSAVSGRKHIVVCGHit
HGL_H00000385724    ------------------.................................------...----------------..
HGL_H00000251127    ------------------.................................------...----------------..
HGL_H00000294725    VALVVLPIQFEQLAYLWM.................................ERQKSGgnySRHRAQTEKHVVLCVS..
HGL_H00000384427    MGVCCTALLVAVVARKLE.................................FNKAEK...HVHNFMMDIHYTKEMK..
HGL_H00000316605    SGVFVFSSLIGQI-----.................................------...----------------..
HGL_H00000400945    ------------------.................................------...----------------..
HGL_H00000243457    VGCIIDAFIIGAVMAKM-.................................------...----------------..
HGL_H00000271915    MGAGCTALVVAVVARKLE.................................LTKAEK...HVHNFMMDTQLT----..
HGL_H00000394033    VGLAYFAAVLSMIGDWLR.................................VISKKT...KEEVGEFRAHAAEWTA..
HGL_H00000386251    LGLMLEAFITGAFVAKIA.................................RPKNRA...FSIRFTDLAVVAHIDG..
HGL_H00000391498-1  VGIPLNVVFLNHLGTGLR.................................THLATL...ERR-------------..
HGL_H00000355580    IGIPFTLLFLTAVVQRIT.................................VHVTR-...----------------..
HGL_H00000390600    ------------------.................................------...----------------..
HGL_H00000341006    GGIIGMNLLVTVVIRNL-.................................------...----------------..
HGL_H00000334650    FGIPLMFLVLTDIGDILA.................................SVLSKS...----------------..
HGL_H00000298480    VALVVLPLQVG-------.................................------...----------------..
HGL_H00000353362    ------------------.................................------...----------------..
HGL_H00000310568    FGIPLFGFLLAGIGD---.................................------...----------------..
HGL_H00000328150    VGCIIDSFMIGAIMAKM-.................................------...----------------..
HGL_H00000400945    ------------------.................................------...----------------..
HGL_H00000357067    LGSMVNAFMVGCMFVKI-.................................------...----------------..
HGL_H00000402797    VGIPLFGILLAGVGDRLG.................................SSLRR-...----------------..
HGL_H00000306497    VGCVIDSFMIGTIMAKM-.................................------...----------------..
HGL_H00000386796    ------------------.................................------...----------------..
HGL_H00000383330    LGSIVNAFMVGCMFVKI-.................................------...----------------..
HGL_H00000339960-2  LGSIVNAFMVGCMFVKI-.................................------...----------------..
HGL_H00000263372    LGLVAMVLV---------.................................------...----------------..
HGL_H00000345708    VGLMINAIMLGCIFM---.................................------...----------------..
HGL_H00000341479    AGCVLDAFVVGAVMAKM-.................................------...----------------..
HGL_H00000355580    LGLIAMLVVLETFCELHE.................................LKKFRK...MFYVKKDKD-------..
HGL_H00000240662    VGLIINAVMLGCIFM---.................................------...----------------..
HGL_H00000391498-2  LGLAWLE-----------.................................------...----------------..
HGL_H00000352527    LGLAWLSLFVNWKVSMFV.................................EVHKAI...KKRRRRRK--------..
HGL_H00000376438    LSCIINTFIIGAALAK--.................................------...----------------..
HGL_H00000352527    FGAPLCLTWISALGKFFG.................................------...----------------..
HGL_H00000334650    IGMEIVCIAFKLMQNRI-.................................------...----------------..
HGL_H00000316136    LGVVINSFMCGAILAKI-.................................------...----------------..
HGL_H00000402797    LGLAYFASVLTTIGNWLR.................................AVSRRT...RA--------------..
HGL_H00000386796    ------------------.................................------...----------------..
HGL_H00000361952    LGLSVIGGFLNLVVLRF-.................................------...----------------..
HGL_H00000357068    LTTILEIFITGTFLAKI-.................................------...----------------..
HGL_H00000251127    ------------------.................................------...----------------..
HGL_H00000381911    ITTLIEIFITGTFLAKI-.................................------...----------------..
HGL_H00000386796    ------------------.................................------...----------------..
HGL_H00000361952    LGIPLTLVTFQSLG----.................................------...----------------..
HGL_H00000371180    ------------------.................................------...----------------..
HGL_H00000353206    ------------------.................................------...----------------..
HGL_H00000344820    LGLPASLALVAALRHCLL.................................PVFNRL...GT--------------..
HGL_H00000251287    VGATCYAMFIGHATALIQ.................................SLDSSR...RQYQEKYKQVEQYMSF..
HGL_H00000391498-1  LGLAWLELLL--------.................................------...----------------..
HGL_M00000049206    --------------P---.................................------...----------------..
HGL_H00000353206    M-----------------.................................------...----------------..
HGL_H00000251127    ------------------.................................------...----------------..
HGL_H00000294309    FAIV--------------.................................------...----------------..
HGL_H00000282611    LASFIFL-----------.................................------...----------------..
HGL_H00000294309    FTMIGSLFLMNLLTAII-.................................------...----------------..
HGL_H00000319591-2  SGVLVIALPVPVIVSNFS.................................RIYHQN...QRADKRRA--------..
HGL_H00000344820    LGLLAMLLAVETFTE---.................................------...----------------..
HGL_H00000251127    IAYIMLNLLVAIIVENF-.................................------...----------------..
HGL_H00000400945    ------------------.................................------...----------------..
HGL_H00000353362    ------------------.................................------...----------------..
HGL_H00000376350    ------------------.................................------...----------------..
HGL_H00000394033    ------------------.................................------...----------------..
HGL_H00000237596    ------------------.................................------...----------------..
HGL_H00000360601    FAMIIVASYTANLAAFLVldrpeeritgindprlrnpsdkfiyatvkqssvDIYFRR...QVELSTMYRHME----..
HGL_H00000376350    IELYFI------------.................................------...----------------..
HGL_R00000005229    ------------------.................................------...----------------..
HGL_N10008871       ------------------.................................------...----------------..
HGL_H00000360302    FTLIIISSYTANLAAF--.................................------...----------------..
HGL_N10008871       ------------------.................................------...----------------..
HGL_H00000242607    ------------------.................................------...----------------..
HGL_H00000410146    FTLIIISSYTANLAAFLT.................................------...----------------..
HGL_H00000373594    ------------------.................................------...----------------..
HGL_H00000282499    FTLIIISSYTANLAAFLT.................................------...----------------..
HGL_H00000307342    VGATCYAMFVGHATALIQ.................................SL----...----------------..
HGL_H00000282611    ------------------.................................------...----------------..
HGL_H00000364536    SFLVVVNM----------.................................------...----------------..
HGL_H00000285900    FTLIIISSYTANLAAFLT.................................------...----------------..
HGL_H00000325296    ------------------.................................------...----------------..
HGL_H00000377482    ------------------.................................------...----------------..


                       140       150       160                                                      
                         |         |         |                                                      
d1f6ga_               .TRTTRALHERFDRLERMLDDN--rr....................................................
HGL_H00000358784    .-----------------------n.....................................................
HGL_H00000228858    .-----------------------n.....................................................
HGL_H00000358786    .-----------------------n.....................................................
HGL_H00000328511    .-----------------------n.....................................................
HGL_H00000218176    .-----------------------r.....................................................
HGL_H00000415257    .-----------------------n.....................................................
HGL_H00000295082    .-----------------------r.....................................................
HGL_H00000360806    .-----------------------e.....................................................
HGL_H00000265969    .-----------------------......................................................
HGL_H00000358802    .-----------------------......................................................
HGL_H00000329426    .-----------------------e.....................................................
HGL_H00000371514    .-----------------------......................................................
HGL_H00000376966-2  .-----------------------......................................................
HGL_H00000303282    .-----------------------......................................................
HGL_H00000305824    .-----------------------k.....................................................
HGL_H00000297404    .-----------------------s.....................................................
HGL_H00000221444    .-----------------------s.....................................................
HGL_H00000287042    .-----------------------......................................................
HGL_H00000360626-1  .-----------------------r.....................................................
HGL_H00000307694    .-----------------------......................................................
HGL_H00000312129    .-----------------------s.....................................................
HGL_H00000315654    .-----------------------r.....................................................
HGL_H00000262186    .-----------------------r.....................................................
HGL_H00000318212    .-----------------------r.....................................................
HGL_H00000384611    .-----------------------v.....................................................
HGL_H00000345055    .-----------------------a.....................................................
HGL_H00000346601    .-----------------------a.....................................................
HGL_H00000331727    .-----------------------r.....................................................
HGL_H00000262916    .-----------------------a.....................................................
HGL_H00000373648    .-----------------------a.....................................................
HGL_H00000346534    .-----------------------nfnqqk................................................
HGL_H00000410257    .-----------------------qpqweynlymyiyfvvfiifgsfftlnlfigviidnfnqqk.............
HGL_H00000271751    .-----------------------m.....................................................
HGL_H00000353206    .-----------------------gnkfevsdvnnlsdcqalgkqarwknvkvnfdnvgagylallqvatfkgwmdim
HGL_H00000352011    .-----------------------gvqlfkgkffvcqgedtrnitnksdcaeasyrwvrhkynfdnlgqalmslfvla
HGL_H00000383028    .-----------------------gvqlfkgkfyhclgvdtrnitnrsdcvaanyrwvhhkynfdnlgqalmslfvla
HGL_H00000348945    .-----------------------vqlfkgkfyfcegtdtrnistkaecraahyrwvrrkynfdnlgqalmslfvlss
HGL_H00000346534    .-----------------------clfqittsagwdglllpilnrppdcsldkehpgsgfkgdcgnpsvgifffvsyi
HGL_H00000333496    .-----------------------......................................................
HGL_H00000348945    .-----------------------fqiltqedwnvvlyngmastsswaalyfvalmtfgnyvlfnllvailvegfq..
HGL_H00000257981    .-----------------------......................................................
HGL_H00000364536    .-----------------------lfagkfyecvnttdglrfldsqvhnrsecfalmnvtsdvrwknlkvnfdnvglg
HGL_H00000155840    .-----------------------a.....................................................
HGL_H00000283256    .-----------------------ittsagwdgllapilnsgppdcdpekdhpgssvkgdcgnpsvgifffvsyiiis
HGL_H00000384264    .-----------------------n.....................................................
HGL_H00000390600    .-----------------------kvnfdnvmmgylallqvatfkgwmdimyaavdsrevnsqpkwednvymylyfvi
HGL_H00000328813    .-----------------------......................................................
HGL_H00000261917    .-----------------------ldssr.................................................
HGL_H00000353206    .-----------------------sagwdgllapilnsappdcdpdtihpgssvkgdcgnpsvgifffvsyiiisflv
HGL_H00000264661    .-----------------------r.....................................................
HGL_H00000303540    .-----------------------ttsagwdgllapilnsgppdcdpnkvnpgssvkgdcgnpsvgifffvsyiiisf
HGL_H00000357342    .-----------------------ldssr.................................................
HGL_H00000364536    .-----------------------eagiddmfnfetfgnsmiclfqittsagwdgllapilnsgppdcdpekehpgss
HGL_H00000350183    .-----------------------fgnytllnvflaiavdnla...................................
HGL_H00000319591-1  .-----------------------......................................................
HGL_H00000006839    .-----------------------esgiddmfnfetfgnsiiclfeittsagwdgllnpilnsgppdcdptlenpgth
HGL_H00000006839    .-----------------------serfdisevnnkseceslmhtgqvrwlnvkvnydnvglgylsllqvatfkgwmd
HGL_H00000328478    .-----------------------n.....................................................
HGL_H00000283256    .-----------------------nyttgemfdvsvvnnyseckaliesnqtarwknvkvnfdnvglgylsllqvatf
HGL_H00000277549    .-----------------------fgnytllnvflaiavdnla...................................
HGL_H00000386761    .-----------------------n.....................................................
HGL_H00000303540    .-----------------------gdtfeisevnnhsdclkliernetarwknvkvnfdnvgfgylsllqvatfkgwm
HGL_H00000410257    .-----------------------wdgllspilntgppycdpnlpnsngsrgncgspavgilffttyiiisflivvnm
HGL_H00000352011    .-----------------------fqiltqedwnkvlyngmastsswaalyfialmtfgnyvlfnllvailvegfq..
HGL_H00000288139    .-----------------------llfrcatgeawqeimlaclpgklcdpesdynpgeeytcgssfaivyfisfymlc
HGL_H00000355192    .-----------------------aiavdnla..............................................
HGL_H00000385724    .-----------------------qiltgedwnsvmydgimayggpsfpgmlvciyfiilficgnyillnvflaiavd
HGL_H00000400945    .-----------------------wdallnpmlgpnspdkpylhgvaiayfvsyiiisflivvnmyiavilenfn...
HGL_H00000355192    .-----------------------gvqlfkgkffscndlskmteeeckgsfyvykdgdptqielhprqwihndfhfdn
HGL_H00000390600    .-----------------------gllspilntgppfcngtrgdcgspavgilffttyiiisflivvnmyiavilenf
HGL_H00000383028    .-----------------------fqasgssvsiltqedwnvvlyngmastspwaslyfvalmtfgnyvlfnllvail
HGL_H00000365441    .-----------------------llfrcatgeawqeimlaslpgnrcdpesdfapgeeftcgsnfaivyfisffmlc
HGL_H00000352011    .-----------------------llrnrcflpenfslplsvdlepyyqtenedespficsqprengmrscrsvptlr
HGL_H00000383028    .-----------------------elfgklacneenpceglsrhatfenfgmafltlfqvstgdnwngimkdtlrdct
HGL_H00000309052    .-----------------------tlftvltlddwsliymdsraqgawyiipilmiyifiqniiflnlltavlvdnfq
HGL_H00000277549    .-----------------------mllfrsatgeawheimlsclsnracdpnanasecgsdfayfyfvsfiflcsflm
HGL_H00000355192    .-----------------------kgkmhktcyftgtdimatvenekpspcarsgsgrpctingsecrggwpgpnhgi
HGL_H00000364536    .-----------------------eeqn..................................................
HGL_H00000277549    .-----------------------gkffyctdeskelerdcrgqyldyekeeveaqprqwkkydfhydnvlwalltlf
HGL_H00000352011    .-----------------------gvelfgdlecdethpceglgrhatfrnfgmafltlfrvstgdnwngimkdtlrd
HGL_H00000346534    .-----------------------gksykecvckinqncelprwhmhdffhsflivfrvlcgewietmwdcmevagqa
HGL_H00000350183    .-----------------------fpfffvnifvaliiitfqe...................................
HGL_H00000283256    .-----------------------ksykecvckisndcelprwhmhdffhsflivfrvlcgewietmwdcmevagqtm
HGL_H00000369268    .-----------------------i.....................................................
HGL_H00000303540    .-----------------------cvckiasdcklprwhmhdffhsflivfrvlcgewietmwdcmevagqamcltvf
HGL_H00000385724    .-----------------------glelfmgkmhktcynqegiadvpaeedpspcalesghgrqcqngtvckpgwdgp
HGL_H00000355192    .-----------------------f.....................................................
HGL_H00000288139    .-----------------------qiltgedwnavmydgimayggpsssgmivciyfiilficgnyillnvflaiavd
HGL_H00000385724    .-----------------------lfrcatgeawqdimlacmpgkkcapesepsnstegetpcgssfavfyfisfyml
HGL_H00000277549    .-----------------------glefymgkfhkacfpnstdadpvgdfpcgkdaparlcegdtecreywpgpnfgi
HGL_H00000348945    .-----------------------gllrnrcfldsafvrnnnltflrpyyqpeegeenpficssrrdngmqkcships
HGL_H00000288139    .-----------------------glelfigkmhktcffadsdivaeedpapcafsgngrqctangtecrsgwvgpng
HGL_H00000006839    .-----------------------gksykecvckiasdcslprwhmhdffhsfliifrilcgewietmwdcmevagqp
HGL_H00000350183    .-----------------------glefysgklhracfmnnsgilegfdpphpcgvqgcpagyeckdwigpndgitqf
HGL_H00000383028    .-----------------------agllrnrcfleenftiqgdmalppyyqpeeddeipficslsgdngimgcheipp
HGL_H00000410257    .-----------------------knyselrhrisdsgllprwhmmdffhafliifrilcgewietmwdcmevsgqsl
HGL_H00000346534    .-----------------------vamayeeqn.............................................
HGL_H00000288139    .-----------------------gvqlfkgkfyrctdeaksnpeecrglfilykdgdvdspvvreriwqnsdfnfdn
HGL_H00000353362    .-----------------------msifyvvyfvvfpfffvnifvaliiitfqe........................
HGL_H00000306275    .-----------------------m.....................................................
HGL_H00000390600    .-----------------------llgeayftqqakltlpgdreprwhmmdffhsfliifrilcgewienmwacmevs
HGL_H00000303540    .-----------------------eqn...................................................
HGL_H00000364536    .-----------------------ksykecvckinedctlprwhmndffhsflivfrvlcgewietmwdcmevagqam
HGL_H00000365441    .-----------------------gvqlfkgkfygctdeakqtpkeckgsfliypdgdvsrplvqerlwvnndfnfdn
HGL_H00000353362    .-----------------------imtvfqiltgedwnevmydgiksqggvqggmvfsiyfivltl............
HGL_H00000283256    .-----------------------eqn...................................................
HGL_H00000365441    .-----------------------fqiltgedwnvvmydgimayggpffpgmlvciyfiilficgnyillnvflaiav
HGL_H00000348945    .-----------------------gvelfgrlaqsllapcqllsqpgpvgpgcfrvstgdnwngimkdtlrecaredk
HGL_H00000353206    .-----------------------ksykecvckinedctlprwhmhdffhsflivfrvlcgewietmwdcmevagqam
HGL_H00000410257    .-----------------------eqn...................................................
HGL_H00000006839    .-----------------------dywenlfqltlraagktymiffvviiflgsfylinlilavvamayaeqn.....
HGL_H00000350183    .-----------------------mllfrsatgeawqeimlsclgekgcepdttapsgqnenercgtdlayvyfvsfi
HGL_H00000264773    .NAAANVLRETWLIY---------k.....................................................
HGL_H00000310568    .NVTAEFRETRRRLSVEIHD----k.....................................................
HGL_H00000302166    .-----------------------f.....................................................
HGL_H00000222249    .NAAANVLRETWLIYK--------ht....................................................
HGL_H00000251102    .-----------------------r.....................................................
HGL_H00000365441    .-----------------------vfqcitmegwtdvlywmqdamgyelpwvyfvslvifgsffvlnlvlgvlsgefs
HGL_N10019168       lE----------------------svsnflkdflhk..........................................
HGL_H00000385724    .-----------------------gvqlfkgklytcsdsskqteaeckgnyitykdgevdqpiiqprswenskfdfdn
HGL_H00000251127    .-----------------------fagklakcndpniirredcngifrinvsvsknlnlklrpgekkpgfwvprvwan
HGL_H00000294725    .SLKIDLLMDFLNEFY--------ah....................................................
HGL_H00000384427    .ESAARLLQEAWMYYKHTR-----rk....................................................
HGL_H00000316605    .-----------------------rd....................................................
HGL_H00000400945    .-----------------------nffsgkfgnvndnkilrddkctnenytwnppnvnfdhvgmaylallqvatykgw
HGL_H00000243457    .-----------------------a.....................................................
HGL_H00000271915    .-----------------------krm...................................................
HGL_H00000394033    .NVTAEFKETRRRLSVEIYD----k.....................................................
HGL_H00000386251    .-----------------------kpn...................................................
HGL_H00000391498-1  .-----------------------eeq...................................................
HGL_H00000355580    .-----------------------rpvl..................................................
HGL_H00000390600    .-----------------------eqn...................................................
HGL_H00000341006    .-----------------------eqi...................................................
HGL_H00000334650    .-----------------------ynglrtvpffhcspfkwcs...................................
HGL_H00000298480    .-----------------------......................................................
HGL_H00000353362    .-----------------------mllfrsatgeawhnimlsclsgkpcdknsgiltadcgnefayfyfvsfiflcsf
HGL_H00000310568    .-----------------------ql....................................................
HGL_H00000328150    .-----------------------a.....................................................
HGL_H00000400945    .-----------------------lfgykfcstrnspscnsssdscqrrwhmgdfyhsflvvfrilcgewienmwecm
HGL_H00000357067    .-----------------------s.....................................................
HGL_H00000402797    .-----------------------gigh..................................................
HGL_H00000306497    .-----------------------a.....................................................
HGL_H00000386796    .-----------------------eagindvsnfetfgssmiclfqvtifagwdgmlnaifnskwsdcdpdkinpgtq
HGL_H00000383330    .-----------------------s.....................................................
HGL_H00000339960-2  .-----------------------s.....................................................
HGL_H00000263372    .-----------------------l.....................................................
HGL_H00000345708    .-----------------------kt....................................................
HGL_H00000341479    .-----------------------a.....................................................
HGL_H00000355580    .-----------------------ed....................................................
HGL_H00000240662    .-----------------------kt....................................................
HGL_H00000391498-2  .-----------------------lll...................................................
HGL_H00000352527    .-----------------------e.....................................................
HGL_H00000376438    .-----------------------m.....................................................
HGL_H00000352527    .-----------------------graqr.................................................
HGL_H00000334650    .-----------------------i.....................................................
HGL_H00000316136    .-----------------------s.....................................................
HGL_H00000402797    .-----------------------emggl.................................................
HGL_H00000386796    .-----------------------klfgqsykdcvcridkdchlprwhmhdffhsyllvfrilcgewietlwdcmevg
HGL_H00000361952    .-----------------------l.....................................................
HGL_H00000357068    .-----------------------a.....................................................
HGL_H00000251127    .-----------------------msmfqiltqegwvdvmdqtlnavghmwapvvaiyfilyhlfatlillslfvavi
HGL_H00000381911    .-----------------------a.....................................................
HGL_H00000386796    .-----------------------lfagkfyacldqpngerfsvsevwnitqcerlmyneslswknakmnfdnvgngf
HGL_H00000361952    .-----------------------e.....................................................
HGL_H00000371180    .-----------------------trstrqdlvykeaflglpyslitvfilftmdhwnallrdiwkvpevssvissty
HGL_H00000353206    .-----------------------eqn...................................................
HGL_H00000344820    .-----------------------wvanr.................................................
HGL_H00000251287    .HKLPADFRQKIHDYYEHR-----yq....................................................
HGL_H00000391498-1  .-----------------------s.....................................................
HGL_M00000049206    .-----------------------ynvsfktkqnniawlvldsvvdviflvdivlnfhttfvgpggevisdpklirmn
HGL_H00000353206    .-----------------------ayvtefvslgnvsalrtfrvlralktisvipgkkklvyv...............
HGL_H00000251127    .-----------------------tftyhcvvndtkpgnvtwnslaipdthcspeleegyqcpagfkcmdledlglsr
HGL_H00000294309    .-----------------------gislfrgtivapfgnsslapangsascgsfeqleywannfddfaaalvtlwnvm
HGL_H00000282611    .-----------------------svfvgvii..............................................
HGL_H00000294309    .-----------------------ynqfr.................................................
HGL_H00000319591-2  .-----------------------qkka..................................................
HGL_H00000344820    .-----------------------l.....................................................
HGL_H00000251127    .-----------------------s.....................................................
HGL_H00000400945    .-----------------------qqlfq.................................................
HGL_H00000353362    .-----------------------fvtvlgsitdilvtefgn....................................
HGL_H00000376350    .-----------------------vtsqtshwsrlyfmtfyivtmvvmtiivafileafv..................
HGL_H00000394033    .-----------------------......................................................
HGL_H00000237596    .-----------------------dfstfqeciftqfriilgdvnfaeieeanrvlgplyfttfvffmffillnmfla
HGL_H00000360601    .-----------------------khnyesaaeai...........................................
HGL_H00000376350    .-----------------------mnlllavvfdtfn.........................................
HGL_R00000005229    .-----------------------......................................................
HGL_N10008871       .-----------------------yiiintyifmsvflavvynnyrk...............................
HGL_H00000360302    .-----------------------l.....................................................
HGL_N10008871       .-----------------------vliiiaalvatmanaaiqsggfalvthqaaklyfilf.................
HGL_H00000242607    .-----------------------hhkfeildtvvvvvsfvldivllfkehefealgllillrlwrvariin......
HGL_H00000410146    .-----------------------v.....................................................
HGL_H00000373594    .-----------------------fsetvlrivvlgiwdyienkievfdgaviilslapmvastvangprspwdaisl
HGL_H00000282499    .-----------------------v.....................................................
HGL_H00000307342    .-----------------------dssr..................................................
HGL_H00000282611    .-----------------------iifipyvlhevkgkhfrylnitdgiqslrilklitysqair.............
HGL_H00000364536    .-----------------------yiavilenfs............................................
HGL_H00000285900    .-----------------------v.....................................................
HGL_H00000325296    .-----------------------rligklleqpntyadfeflafwqtrynntnavnlffawikifkyisfnktmtql
HGL_H00000377482    .-----------------------avlklaamqkeyfsyawnlfelaitfigildvilfetgfiahnfilteimenip


                                                                                                    
                                                                                                    
d1f6ga_               ..............................................................................
HGL_H00000358784    ..............................................................................
HGL_H00000228858    ..............................................................................
HGL_H00000358786    ..............................................................................
HGL_H00000328511    ..............................................................................
HGL_H00000218176    ..............................................................................
HGL_H00000415257    ..............................................................................
HGL_H00000295082    ..............................................................................
HGL_H00000360806    ..............................................................................
HGL_H00000265969    ..............................................................................
HGL_H00000358802    ..............................................................................
HGL_H00000329426    ..............................................................................
HGL_H00000371514    ..............................................................................
HGL_H00000376966-2  ..............................................................................
HGL_H00000303282    ..............................................................................
HGL_H00000305824    ..............................................................................
HGL_H00000297404    ..............................................................................
HGL_H00000221444    ..............................................................................
HGL_H00000287042    ..............................................................................
HGL_H00000360626-1  ..............................................................................
HGL_H00000307694    ..............................................................................
HGL_H00000312129    ..............................................................................
HGL_H00000315654    ..............................................................................
HGL_H00000262186    ..............................................................................
HGL_H00000318212    ..............................................................................
HGL_H00000384611    ..............................................................................
HGL_H00000345055    ..............................................................................
HGL_H00000346601    ..............................................................................
HGL_H00000331727    ..............................................................................
HGL_H00000262916    ..............................................................................
HGL_H00000373648    ..............................................................................
HGL_H00000346534    ..............................................................................
HGL_H00000410257    ..............................................................................
HGL_H00000271751    ..............................................................................
HGL_H00000353206    yaavdsrdvklqpmyeenlymylyfvifiifgsfftlnlfigviidnfnqqk..........................
HGL_H00000352011    skdgwvdimydgldavgvdqqpimnhnpwmllyfisfllivaffvlnmfvgvvvenfhkcr.................
HGL_H00000383028    skdgwvnimyngldavavdqqpvtnhnpwmllyfisfllivsffvlnmfvgvvvenfhkcr.................
HGL_H00000348945    kdgwvnimydgldavgidqqpvqnhnpwmllyfisfllivsffvlnmfvgvvvenfhkcr..................
HGL_H00000346534    iisflivvnmyiaiilenfs..........................................................
HGL_H00000333496    ..............................................................................
HGL_H00000348945    ..............................................................................
HGL_H00000257981    ..............................................................................
HGL_H00000364536    ylsllqvatfkgwmdimyaavdsvnedqqpryeynlymyiyfvifiifgsfftlnlfigviidnfnqqk.........
HGL_H00000155840    ..............................................................................
HGL_H00000283256    flvvvnmyiavilenfs.............................................................
HGL_H00000384264    ..............................................................................
HGL_H00000390600    fiifggfftlnlfvgviidnfnqqk.....................................................
HGL_H00000328813    ..............................................................................
HGL_H00000261917    ..............................................................................
HGL_H00000353206    vvnmyiavilenfs................................................................
HGL_H00000264661    ..............................................................................
HGL_H00000303540    lvvvnmyiavilenfs..............................................................
HGL_H00000357342    ..............................................................................
HGL_H00000364536    vkgdcgnpsvgifyfvsyiiisflvvvnmyiavilenfs.......................................
HGL_H00000350183    ..............................................................................
HGL_H00000319591-1  ..............................................................................
HGL_H00000006839    ikgncgnpsigicffcsyiiisflivvnmyiaiilenfn.......................................
HGL_H00000006839    imyaavdsreqadqpqyevnlymylyfvifiifgsfftlnlfigviidnfnqqk........................
HGL_H00000328478    ..............................................................................
HGL_H00000283256    kgwmdimyaavdsrnvelqpkyednlymylyfvifiifgsfftlnlfigviidnfnqqk...................
HGL_H00000277549    ..............................................................................
HGL_H00000386761    ..............................................................................
HGL_H00000303540    dimyaavdsrnvelqpkyeeslymylyfvifiifgsfftlnlfigviidnfnqqk.......................
HGL_H00000410257    yiaiilenfs....................................................................
HGL_H00000352011    ..............................................................................
HGL_H00000288139    afliinlfvavimdnf..............................................................
HGL_H00000355192    ..............................................................................
HGL_H00000385724    nla...........................................................................
HGL_H00000400945    ..............................................................................
HGL_H00000355192    vlsammslftvstfegwpqllykaidanaedvgpiynnrvemaiffiiyiiliaffmmnifvgfvivtfqeq......
HGL_H00000390600    n.............................................................................
HGL_H00000383028    vegfq.........................................................................
HGL_H00000365441    afliinlfvavimdnf..............................................................
HGL_H00000352011    gegsggppcgldyeaynsssnttcvnwnqyytncsagehnpfkgainfdnigyawiaifqvitlegwvdimyfvmdah
HGL_H00000383028    hdersclsslqfvsplyfvsfvltaqfvlinvvvavlmkh......................................
HGL_H00000309052    ..............................................................................
HGL_H00000277549    lnlfvavimdnfe.................................................................
HGL_H00000355192    thfdnfgfsmltvyqcitmegwtdvlywvndaignewpwiyfvtlillgsffilnlvlgvlsgeftker.........
HGL_H00000364536    ..............................................................................
HGL_H00000277549    tvstgegwpmvlkhsvdatyeeqgpspgfrmelsifyvvyfvvfpfffvnifvaliiitfqe................
HGL_H00000352011    cdqestcyntvispiyfvsfvltaqfvlvnvviavlmkhleesn..................................
HGL_H00000346534    mclivfmmvmvignlvvlnlflalllssfs................................................
HGL_H00000350183    ..............................................................................
HGL_H00000283256    cltvfmmvmvignlvvlnlflalllssfs.................................................
HGL_H00000369268    ..............................................................................
HGL_H00000303540    mmvmvignlvvlnlflalllssfs......................................................
HGL_H00000385724    khgitnfdnfafamltvfqcitmegwtdvlywmqdamgyelpwvyfvslvifgsffvlnlvlgvlsgefskere....
HGL_H00000355192    ..............................................................................
HGL_H00000288139    nla...........................................................................
HGL_H00000385724    cafliinlfvavimdnf.............................................................
HGL_H00000277549    tnfdnilfailtvfqcitmegwtdilyntndaagntwnwlyfipliiigsffmlnlvlgvlsgefaker.........
HGL_H00000348945    rrelrvqctlgweaygqppaeaagagrngcinwnqyynvcrsgdsnphngaisfdnigyawiaifqvitlegwvdimy
HGL_H00000288139    gitnfdnfafamltvfqcitmegwtdvlywvndaigwewpwvyfvsliilgsffvlnlvlgvlsgefskere......
HGL_H00000006839    mcltvflmvmvignlvvlnlflalllssfs................................................
HGL_H00000350183    dnilfavltvfqcitmegwttvlyntndalgatwnwlyfipliiigsffvlnlvlgvlsgefaker............
HGL_H00000383028    lkeqgrecclskddvydfgagrqdlnasglcvnwnryynvcrtgsanphkgainfdnigyawivifqvitlegwveim
HGL_H00000410257    cllvfllvmvignlvvlnlflalllssfs.................................................
HGL_H00000346534    ..............................................................................
HGL_H00000288139    vlsammalftvstfegwpallykaidsngenvgpvynyrveisiffiiyiiivaffmmnifvgfvivtfqeq......
HGL_H00000353362    ..............................................................................
HGL_H00000306275    ..............................................................................
HGL_H00000390600    ekpiclilfltvmvlgnlvvlnlfialllnsfs.............................................
HGL_H00000303540    ..............................................................................
HGL_H00000364536    clivymmvmvignlvvlnlflalllssfs.................................................
HGL_H00000365441    vlsammalftvstfegwpallykaidahaedegpiynyhveisvffivyiiiiaffmmnifvgfviitfr........
HGL_H00000353362    ..............................................................................
HGL_H00000283256    ..............................................................................
HGL_H00000365441    dnl...........................................................................
HGL_H00000348945    hclsylpalspiyfvtfvlvaqfvlvnvvvavlmkhleesn.....................................
HGL_H00000353206    clivfmlvmvignlvvlnlflalllssfs.................................................
HGL_H00000410257    ..............................................................................
HGL_H00000006839    ..............................................................................
HGL_H00000350183    ffcsflmlnlfvavimdnfe..........................................................
HGL_H00000264773    ..............................................................................
HGL_H00000310568    ..............................................................................
HGL_H00000302166    ..............................................................................
HGL_H00000222249    ..............................................................................
HGL_H00000251102    ..............................................................................
HGL_H00000365441    kere..........................................................................
HGL_N10019168       ..............................................................................
HGL_H00000385724    vlaammalftvstfegwpellyrsidshtedkgpiynyrveisiffiiyiiiiaffmmnifvgfvivtfqeq......
HGL_H00000251127    prnfnfdnvgnamlalfevlslkgwvevrdviihrvgpihgiyihvfvflgcmigltlfvgvvianfne.........
HGL_H00000294725    ..............................................................................
HGL_H00000384427    ..............................................................................
HGL_H00000316605    ..............................................................................
HGL_H00000400945    mdimya........................................................................
HGL_H00000243457    ..............................................................................
HGL_H00000271915    ..............................................................................
HGL_H00000394033    ..............................................................................
HGL_H00000386251    ..............................................................................
HGL_H00000391498-1  ..............................................................................
HGL_H00000355580    ..............................................................................
HGL_H00000390600    ..............................................................................
HGL_H00000341006    ..............................................................................
HGL_H00000334650    ..............................................................................
HGL_H00000298480    ..............................................................................
HGL_H00000353362    lmlnlfvagimdnfe...............................................................
HGL_H00000310568    ..............................................................................
HGL_H00000328150    ..............................................................................
HGL_H00000400945    revniplcvivfvlimvigklvvlnlfialllnsfsne........................................
HGL_H00000357067    ..............................................................................
HGL_H00000402797    ..............................................................................
HGL_H00000306497    ..............................................................................
HGL_H00000386796    vrgdcgnpsvgifyfvsyifiiwliivnmyivmvke..........................................
HGL_H00000383330    ..............................................................................
HGL_H00000339960-2  ..............................................................................
HGL_H00000263372    ..............................................................................
HGL_H00000345708    ..............................................................................
HGL_H00000341479    ..............................................................................
HGL_H00000355580    ..............................................................................
HGL_H00000240662    ..............................................................................
HGL_H00000391498-2  ..............................................................................
HGL_H00000352527    ..............................................................................
HGL_H00000376438    ..............................................................................
HGL_H00000352527    ..............................................................................
HGL_H00000334650    ..............................................................................
HGL_H00000316136    ..............................................................................
HGL_H00000402797    ..............................................................................
HGL_H00000386796    gqsscicfymmvilignllilylflgcvssfls.............................................
HGL_H00000361952    ..............................................................................
HGL_H00000357068    ..............................................................................
HGL_H00000251127    ldnle.........................................................................
HGL_H00000381911    ..............................................................................
HGL_H00000386796    lsllqv........................................................................
HGL_H00000361952    ..............................................................................
HGL_H00000371180    iilwvllgsiilrnviistmannfrd....................................................
HGL_H00000353206    ..............................................................................
HGL_H00000344820    ..............................................................................
HGL_H00000251287    ..............................................................................
HGL_H00000391498-1  ..............................................................................
HGL_M00000049206    ylktwfvidllsclpydiinafenv.....................................................
HGL_H00000353206    ..............................................................................
HGL_H00000251127    qelgysgfneigtsiftvyeassqegwvflmyraidsfpcwrsyfyfitlifflawlvknvfiaviietfaei.....
HGL_H00000294309    vvnnwqvildayeryvgpwskiyfvlwwlvssviwvnlflalllenflhr............................
HGL_H00000282611    ..............................................................................
HGL_H00000294309    ..............................................................................
HGL_H00000319591-2  ..............................................................................
HGL_H00000344820    ..............................................................................
HGL_H00000251127    ..............................................................................
HGL_H00000400945    ..............................................................................
HGL_H00000353362    ..............................................................................
HGL_H00000376350    ..............................................................................
HGL_H00000394033    ..............................................................................
HGL_H00000237596    iindtyse......................................................................
HGL_H00000360601    ..............................................................................
HGL_H00000376350    ..............................................................................
HGL_R00000005229    ..............................................................................
HGL_N10008871       ..............................................................................
HGL_H00000360302    ..............................................................................
HGL_N10008871       ..............................................................................
HGL_H00000242607    ..............................................................................
HGL_H00000410146    ..............................................................................
HGL_H00000373594    iimlriwrvkrvi.................................................................
HGL_H00000282499    ..............................................................................
HGL_H00000307342    ..............................................................................
HGL_H00000282611    ..............................................................................
HGL_H00000364536    ..............................................................................
HGL_H00000285900    ..............................................................................
HGL_H00000325296    sstlaccakdilgfaimffivffayaqlgyllfgmqiilgdfgynainnancilgpvyfvtyvffiffillnmfpaii
HGL_H00000377482    llriarvlkli...................................................................


                                                              
                                                              
d1f6ga_               ........................................
HGL_H00000358784    ........................................
HGL_H00000228858    ........................................
HGL_H00000358786    ........................................
HGL_H00000328511    ........................................
HGL_H00000218176    ........................................
HGL_H00000415257    ........................................
HGL_H00000295082    ........................................
HGL_H00000360806    ........................................
HGL_H00000265969    ........................................
HGL_H00000358802    ........................................
HGL_H00000329426    ........................................
HGL_H00000371514    ........................................
HGL_H00000376966-2  ........................................
HGL_H00000303282    ........................................
HGL_H00000305824    ........................................
HGL_H00000297404    ........................................
HGL_H00000221444    ........................................
HGL_H00000287042    ........................................
HGL_H00000360626-1  ........................................
HGL_H00000307694    ........................................
HGL_H00000312129    ........................................
HGL_H00000315654    ........................................
HGL_H00000262186    ........................................
HGL_H00000318212    ........................................
HGL_H00000384611    ........................................
HGL_H00000345055    ........................................
HGL_H00000346601    ........................................
HGL_H00000331727    ........................................
HGL_H00000262916    ........................................
HGL_H00000373648    ........................................
HGL_H00000346534    ........................................
HGL_H00000410257    ........................................
HGL_H00000271751    ........................................
HGL_H00000353206    ........................................
HGL_H00000352011    ........................................
HGL_H00000383028    ........................................
HGL_H00000348945    ........................................
HGL_H00000346534    ........................................
HGL_H00000333496    ........................................
HGL_H00000348945    ........................................
HGL_H00000257981    ........................................
HGL_H00000364536    ........................................
HGL_H00000155840    ........................................
HGL_H00000283256    ........................................
HGL_H00000384264    ........................................
HGL_H00000390600    ........................................
HGL_H00000328813    ........................................
HGL_H00000261917    ........................................
HGL_H00000353206    ........................................
HGL_H00000264661    ........................................
HGL_H00000303540    ........................................
HGL_H00000357342    ........................................
HGL_H00000364536    ........................................
HGL_H00000350183    ........................................
HGL_H00000319591-1  ........................................
HGL_H00000006839    ........................................
HGL_H00000006839    ........................................
HGL_H00000328478    ........................................
HGL_H00000283256    ........................................
HGL_H00000277549    ........................................
HGL_H00000386761    ........................................
HGL_H00000303540    ........................................
HGL_H00000410257    ........................................
HGL_H00000352011    ........................................
HGL_H00000288139    ........................................
HGL_H00000355192    ........................................
HGL_H00000385724    ........................................
HGL_H00000400945    ........................................
HGL_H00000355192    ........................................
HGL_H00000390600    ........................................
HGL_H00000383028    ........................................
HGL_H00000365441    ........................................
HGL_H00000352011    sfynfiyfilliivgsffminlclvviatqfse.......
HGL_H00000383028    ........................................
HGL_H00000309052    ........................................
HGL_H00000277549    ........................................
HGL_H00000355192    ........................................
HGL_H00000364536    ........................................
HGL_H00000277549    ........................................
HGL_H00000352011    ........................................
HGL_H00000346534    ........................................
HGL_H00000350183    ........................................
HGL_H00000283256    ........................................
HGL_H00000369268    ........................................
HGL_H00000303540    ........................................
HGL_H00000385724    ........................................
HGL_H00000355192    ........................................
HGL_H00000288139    ........................................
HGL_H00000385724    ........................................
HGL_H00000277549    ........................................
HGL_H00000348945    yvmdahsfynfiyfilliivgsffminlclvviatqfse.
HGL_H00000288139    ........................................
HGL_H00000006839    ........................................
HGL_H00000350183    ........................................
HGL_H00000383028    yyvmdahsfynfiyfilliivgsffminlclvviatqfse
HGL_H00000410257    ........................................
HGL_H00000346534    ........................................
HGL_H00000288139    ........................................
HGL_H00000353362    ........................................
HGL_H00000306275    ........................................
HGL_H00000390600    ........................................
HGL_H00000303540    ........................................
HGL_H00000364536    ........................................
HGL_H00000365441    ........................................
HGL_H00000353362    ........................................
HGL_H00000283256    ........................................
HGL_H00000365441    ........................................
HGL_H00000348945    ........................................
HGL_H00000353206    ........................................
HGL_H00000410257    ........................................
HGL_H00000006839    ........................................
HGL_H00000350183    ........................................
HGL_H00000264773    ........................................
HGL_H00000310568    ........................................
HGL_H00000302166    ........................................
HGL_H00000222249    ........................................
HGL_H00000251102    ........................................
HGL_H00000365441    ........................................
HGL_N10019168       ........................................
HGL_H00000385724    ........................................
HGL_H00000251127    ........................................
HGL_H00000294725    ........................................
HGL_H00000384427    ........................................
HGL_H00000316605    ........................................
HGL_H00000400945    ........................................
HGL_H00000243457    ........................................
HGL_H00000271915    ........................................
HGL_H00000394033    ........................................
HGL_H00000386251    ........................................
HGL_H00000391498-1  ........................................
HGL_H00000355580    ........................................
HGL_H00000390600    ........................................
HGL_H00000341006    ........................................
HGL_H00000334650    ........................................
HGL_H00000298480    ........................................
HGL_H00000353362    ........................................
HGL_H00000310568    ........................................
HGL_H00000328150    ........................................
HGL_H00000400945    ........................................
HGL_H00000357067    ........................................
HGL_H00000402797    ........................................
HGL_H00000306497    ........................................
HGL_H00000386796    ........................................
HGL_H00000383330    ........................................
HGL_H00000339960-2  ........................................
HGL_H00000263372    ........................................
HGL_H00000345708    ........................................
HGL_H00000341479    ........................................
HGL_H00000355580    ........................................
HGL_H00000240662    ........................................
HGL_H00000391498-2  ........................................
HGL_H00000352527    ........................................
HGL_H00000376438    ........................................
HGL_H00000352527    ........................................
HGL_H00000334650    ........................................
HGL_H00000316136    ........................................
HGL_H00000402797    ........................................
HGL_H00000386796    ........................................
HGL_H00000361952    ........................................
HGL_H00000357068    ........................................
HGL_H00000251127    ........................................
HGL_H00000381911    ........................................
HGL_H00000386796    ........................................
HGL_H00000361952    ........................................
HGL_H00000371180    ........................................
HGL_H00000353206    ........................................
HGL_H00000344820    ........................................
HGL_H00000251287    ........................................
HGL_H00000391498-1  ........................................
HGL_M00000049206    ........................................
HGL_H00000353206    ........................................
HGL_H00000251127    ........................................
HGL_H00000294309    ........................................
HGL_H00000282611    ........................................
HGL_H00000294309    ........................................
HGL_H00000319591-2  ........................................
HGL_H00000344820    ........................................
HGL_H00000251127    ........................................
HGL_H00000400945    ........................................
HGL_H00000353362    ........................................
HGL_H00000376350    ........................................
HGL_H00000394033    ........................................
HGL_H00000237596    ........................................
HGL_H00000360601    ........................................
HGL_H00000376350    ........................................
HGL_R00000005229    ........................................
HGL_N10008871       ........................................
HGL_H00000360302    ........................................
HGL_N10008871       ........................................
HGL_H00000242607    ........................................
HGL_H00000410146    ........................................
HGL_H00000373594    ........................................
HGL_H00000282499    ........................................
HGL_H00000307342    ........................................
HGL_H00000282611    ........................................
HGL_H00000364536    ........................................
HGL_H00000285900    ........................................
HGL_H00000325296    ndtyse..................................
HGL_H00000377482    ........................................


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0037417 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Anopheles gambiae 55 (pseudogenes) - African malaria mosquito
NoYes   Canis familiaris 58 (pseudogenes) - Dog
NoYes   Danio rerio 58 (pseudogenes) - Zebrafish
NoYes   Gallus gallus 58 (pseudogene) - Chicken
NoYes   Homo sapiens 58 (pseudogenes) - Human
NoYes   Mus musculus 56 (pseudogenes) - House mouse
NoYes   Pan troglodytes 58 (pseudogenes) - Chimpanzee
NoYes   Homo sapiens 76_38 - Human
NoYes   Pan troglodytes 76_2.1.4 - Chimpanzee
NoYes   Gorilla gorilla 76_3.1 - Western gorilla
NoYes   Pongo abelii 76_2 - Sumatran orangutan
NoYes   Tarsius syrichta 76_1
NoYes   Nomascus leucogenys 76_1.0 - Northern white-cheeked gibbon
NoYes   Papio anubis 76 - Olive baboon
NoYes   Macaca mulatta 76_1 - Rhesus monkey
NoYes   Callithrix jacchus 76_3.2.1 - White-tufted-ear marmoset
NoYes   Otolemur garnettii 76_3 - Small-eared galago
NoYes   Microcebus murinus 76_1 - Gray mouse lemur
NoYes   Physcomitrella patens subsp. patens 22
NoYes   Rattus norvegicus 76_5.0 - Norway rat
NoYes   Mus musculus 76_38 - House mouse
NoYes   Dipodomys ordii 76_1 - Ord's kangaroo rat
NoYes   Ictidomys tridecemlineatus 76_2 - Thirteen-lined ground squirrel
NoYes   Heterocephalus glaber v1.7-2 - Naked mole-rat
NoYes   Cavia porcellus 76_3 - Domestic guinea pig
NoYes   Oryctolagus cuniculus 76_2 - Rabbit
NoYes   Ochotona princeps 76 - American pika
NoYes   Tupaia belangeri 76 - Northern tree shrew
NoYes   Sus scrofa 76_10.2 - Pig
NoYes   Bos taurus 76_3.1 - Cattle
NoYes   Ovis aries 76_3.1 - Sheep
NoYes   Vicugna pacos 76_1 - Alpaca
NoYes   Tursiops truncatus 76_1 - Bottlenose dolphin
NoYes   Mustela putorius furo 76_1.0 - Domestic ferret
NoYes   Ailuropoda melanoleuca 76_1 - Giant panda
NoYes   Canis familiaris 76_3.1 - Dog
NoYes   Felis catus 76_6.2 - Domestic cat
NoYes   Equus caballus 76_2 - Horse
NoYes   Myotis lucifugus 76_2.0 - Little brown bat
NoYes   Pteropus vampyrus 76_1 - Large flying fox
NoYes   Sorex araneus 76_1 - European shrew
NoYes   Erinaceus europaeus 76 - Western European hedgehog
NoYes   Procavia capensis 76_1 - Cape rock hyrax
NoYes   Loxodonta africana 76_3 - African savanna elephant
NoYes   Echinops telfairi 76 - Small Madagascar hedgehog
NoYes   Dasypus novemcinctus 76_2 - Nine-banded armadillo
NoYes   Choloepus hoffmanni 76_1 - Hoffmann's two-fingered sloth
NoYes   Macropus eugenii 76_1.0 - Tammar wallaby
NoYes   Sarcophilus harrisii 76_7.0 - Tasmanian devil
NoYes   Monodelphis domestica 76_5 - Gray short-tailed opossum
NoYes   Ornithorhynchus anatinus 76_5 - Platypus
NoYes   Saccoglossus kowalevskii v3.0
NoYes   Petromyzon marinus 76_7.0 - Sea lamprey
NoYes   Meleagris gallopavo 76_2 - Turkey
NoYes   Gallus gallus 76_4 - Chicken
NoYes   Anas platyrhynchos 76_1.0 - Mallard
NoYes   Taeniopygia guttata 76_3.2.4 - Zebra finch
NoYes   Ficedula albicollis 76_1.0 - Collared flycatcher
NoYes   Pelodiscus sinensis 76_1.0 - Chinese soft-shelled turtle
NoYes   Anolis carolinensis 76_2.0 - Green anole
NoYes   Xenopus laevis - African clawed frog
NoYes   Xenopus tropicalis 76_4.2 - Tropical clawed frog
NoYes   Latimeria chalumnae 76_1 - Coelacanth
NoYes   Lepisosteus oculatus 76 - Spotted gar
NoYes   Gadus morhua 76_1 - Atlantic cod
NoYes   Tetraodon nigroviridis 76_8 - Spotted green pufferfish
NoYes   Takifugu rubripes 76_4 - Torafugu
NoYes   Gasterosteus aculeatus 76_1 - Three-spined stickleback
NoYes   Oryzias latipes 76_1 - Japanese medaka
NoYes   Xiphophorus maculatus 76_4.4.2 - Southern platyfish
NoYes   Poecilia formosa 76 - Amazon molly
NoYes   Oreochromis niloticus 76_1.0 - Nile tilapia
NoYes   Astyanax mexicanus 76 - Mexican tetra
NoYes   Danio rerio 76_9 - Zebrafish
NoYes   Oikopleura dioica
NoYes   Ciona savignyi 76_2.0 - Pacific transparent sea squirt
NoYes   Ciona intestinalis 76 - Vase tunicate
NoYes   Strongylocentrotus purpuratus v3.1 - Purple sea urchin
NoYes   Adineta vaga
NoYes   Octopus bimaculoides 280
NoYes   Crassostrea gigas 22 - Pacific oyster
NoYes   Lottia gigantea - Owl limpet
NoYes   Helobdella robusta
NoYes   Capitella sp. I
NoYes   Danaus plexippus OGS1.0 - Monarch butterfly
NoYes   Heliconius melpomene - Postman butterfly
NoYes   Bombyx mori - Domestic silkworm
NoYes   Nasonia vitripennis - Jewel wasp
NoYes   Apis mellifera 38.2d - Honey bee
NoYes   Harpegnathos saltator v3.3 - Jerdon's jumping ant
NoYes   Linepithema humile v1.1 - Argentine ant
NoYes   Pogonomyrmex barbatus v1.2 - Red harvester ant
NoYes   Solenopsis invicta v.2.2.3 - Red fire ant
NoYes   Acromyrmex echinatior v3.8 - Panamanian leafcutter ant
NoYes   Atta cephalotes v1.1
NoYes   Camponotus floridanus v3.3 - Florida carpenter ant
NoYes   Lucilia cuprina - Australian sheep blowfly
NoYes   Drosophila grimshawi 1.3
NoYes   Drosophila willistoni 1.3
NoYes   Drosophila pseudoobscura 2.13
NoYes   Drosophila persimilis 1.3
NoYes   Drosophila suzukii
NoYes   Drosophila yakuba 1.3
NoYes   Drosophila simulans 1.3
NoYes   Drosophila sechellia 1.3
NoYes   Drosophila melanogaster 76_5 - Fruit fly
NoYes   Drosophila erecta 1.3
NoYes   Drosophila ananassae 1.3
NoYes   Drosophila virilis 1.2
NoYes   Drosophila mojavensis 1.3
NoYes   Megaselia scalaris 22
NoYes   Aedes aegypti 55 - Yellow fever mosquito
NoYes   Culex pipiens quinquefasciatus - Southern house mosquito
NoYes   Anopheles darlingi 22 - American malaria mosquito
NoYes   Anopheles gambiae 49_3j - African malaria mosquito
NoYes   Tribolium castaneum 3.0 - Red flour beetle
NoYes   Pediculus humanus corporis - Human body louse
NoYes   Acyrthosiphon pisum - Pea aphid
NoYes   Rhodnius prolixus 22
NoYes   Daphnia pulex - Common water flea
NoYes   Strigamia maritima 22
NoYes   Sarcoptes scabiei
NoYes   Tetranychus urticae - Two-spotted spider mite
NoYes   Ixodes scapularis - Black-legged tick
NoYes   Pristionchus pacificus
NoYes   Meloidogyne incognita - Southern root-knot nematode
NoYes   Meloidogyne hapla
NoYes   Onchocerca volvulus 22
NoYes   Brugia malayi WS250 - Agent of lymphatic filariasis
NoYes   Caenorhabditis japonica
NoYes   Caenorhabditis brenneri
NoYes   Caenorhabditis remanei
NoYes   Caenorhabditis elegans 76_235 - Roundworm
NoYes   Caenorhabditis briggsae 2
NoYes   Trichinella spiralis 22
NoYes   Hymenolepis microstoma
NoYes   Echinococcus multilocularis
NoYes   Echinococcus granulosus
NoYes   Taenia solium - Pork tapeworm
NoYes   Schistosoma mansoni
NoYes   Mnemiopsis leidyi - Sea walnut
NoYes   Thelohanellus kitauei
NoYes   Acropora digitifera v1.0
NoYes   Nematostella vectensis 1.0 - Starlet sea anemone
NoYes   Hydra vulgaris
NoYes   Amphimedon queenslandica
NoYes   Trichoplax adhaerens
NoYes   Proterospongia sp. ATCC 50818
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Capsaspora owczarzaki ATCC 30864
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Cronartium quercuum f. sp. fusiforme G11 v1.0
NoYes   Puccinia graminis f. sp. tritici CRL 75-36-700-3
NoYes   Melampsora laricis-populina
NoYes   Rhodotorula graminis WP1 v1.0
NoYes   Sporobolomyces roseus IAM 13481
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Postia placenta
NoYes   Wolfiporia cocos MD-104 SS10 v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Tremella mesenterica - Witches' butter
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium albo-atrum VaMs.102
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma longibrachiatum ATCC 18648 v1.0
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Histoplasma capsulatum class NAmI strain WU24
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus niger ATCC 1015
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Hansenula polymorpha v2.0
NoYes   Dekkera bruxellensis CBS 2499 v2.0
NoYes   Pichia membranifaciensv1.0
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Candida albicans SC5314
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Pichia stipitis CBS 6054
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Wickerhamomyces anomalus
NoYes   Pichia pastoris GS115
NoYes   Hanseniaspora valbyensis NRRL Y-1626 v1.1
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Vanderwaltozyma polyspora DSM 70294
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Zygosaccharomyces rouxii
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Schizosaccharomyces cryophilus OY26 22
NoYes   Schizosaccharomyces octosporus yFS286
NoYes   Schizosaccharomyces japonicus yFS275
NoYes   Schizosaccharomyces pombe - Fission yeast
NoYes   Catenaria anguillulae PL171 v1.0
NoYes   Allomyces macrogynus ATCC 38327
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Dictyostelium discoideum
NoYes   Dictyostelium purpureum
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Selaginella moellendorffii
NoYes   Pinus taeda - Loblolly pine
NoYes   Picea abies - Norway spruce
NoYes   Eucalyptus grandis v201 - Rose gum
NoYes   Theobroma cacao B97-61/B2 v1 - Cacao
NoYes   Gossypium raimondii v221
NoYes   Citrus clementina v165
NoYes   Citrus sinensis v154 - Sweet orange
NoYes   Thellungiella halophila v173
NoYes   Brassica rapa Chiifu-401 1.2 - Field mustard
NoYes   Capsella rubella v183
NoYes   Arabidopsis lyrata - Lyrate rockcress
NoYes   Arabidopsis thaliana 10 - Thale cress
NoYes   Carica papaya - Papaya
NoYes   Medicago truncatula - Barrel medic
NoYes   Phaseolus vulgaris v186 - String bean
NoYes   Glycine max v109 - Soybean
NoYes   Cucumis sativus v122 - Cucumber
NoYes   Fragaria vesca - Wild strawberry
NoYes   Malus domestica v196 - Apple
NoYes   Prunus persica v139 - Peach
NoYes   Linum usitatissimum v200 - Flax
NoYes   Manihot esculenta v147 - Cassava
NoYes   Populus trichocarpa v156 - Black cottonwood
NoYes   Vitis vinifera - Wine grape
NoYes   Mimulus guttatus v140 - Spotted monkey flower
NoYes   Solanum lycopersicum v.2.3 - Tomato
NoYes   Solanum tuberosum - Potato
NoYes   Actinidia chinensis Hongyang
NoYes   Aquilegia coerulea v195
NoYes   Triticum urartu 22
NoYes   Triticum aestivum 22 - Bread wheat
NoYes   Aegilops tauschii 22
NoYes   Brachypodium distachyon - Stiff brome
NoYes   Oryza barthii 22 - African wild rice
NoYes   Oryza meridionalis 22
NoYes   Oryza glumaepatula 22
NoYes   Oryza glaberrima - African rice
NoYes   Oryza punctata 22
NoYes   Oryza nivara 22
NoYes   Oryza brachyantha 22 - Malo sina
NoYes   Oryza sativa ssp. japonica 5.0 - Japanese rice
NoYes   Oryza sativa v193 - Rice
NoYes   Phyllostachys heterocyclavar. pubescens - Mosochiku
NoYes   Panicum virgatum v202 - Switchgrass
NoYes   Setaria italica v164 - Foxtail millet
NoYes   Zea mays subsp. mays - Maize
NoYes   Zea mays v181 - Maize
NoYes   Sorghum bicolor - Sorghum
NoYes   Musa balbisiana - Balbis banana
NoYes   Musa acuminata 22 - Wild Malaysian banana
NoYes   Amborella trichopoda 22
NoYes   Physcomitrella patens
NoYes   Coccomyxa subellipsoidea sp. C-169 v2
NoYes   Asterochloris sp. Cgr/DA1pho v1.0
NoYes   Chlorella variabilis sp. NC64A
NoYes   Chlorella vulgaris
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Ostreococcus sp. RCC809
NoYes   Ostreococcus lucimarinus CCE9901
NoYes   Ostreococcus tauri
NoYes   Bathycoccus prasinos
NoYes   Micromonas sp. RCC299
NoYes   Micromonas pusilla CCMP1545 v3.0
NoYes   Cyanidioschyzon merolae strain 10D 22
NoYes   Cyanidioschyzon merolae
NoYes   Porphyridium purpureum 02_2012
NoYes   Thecamonas trahens ATCC 50062
NoYes   Bigelowiella natans CCMP2755 22
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Leishmania mexicana 2.4
NoYes   Leishmania major strain Friedlin
NoYes   Leishmania infantum JPCM5 2.4
NoYes   Leishmania braziliensis MHOM/BR/75/M2904 2.4
NoYes   Trypanosoma vivax
NoYes   Trypanosoma cruzi strain CL Brener
NoYes   Trypanosoma congolense 2.4
NoYes   Trypanosoma brucei gambiense v4.1
NoYes   Trypanosoma brucei TREU927 v4.1
NoYes   Ectocarpus siliculosus
NoYes   Aureococcus anophagefferens
NoYes   Albugo laibachii 22
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium ultimum v1.7-2
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Hyaloperonospora arabidopsidis 22
NoYes   Phaeodactylum tricornutumCCAP 1055/1
NoYes   Fragilariopsis cylindrus
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Paramecium tetraurelia
NoYes   Tetrahymena thermophila SB210 1
NoYes   Ichthyophthirius multifiliis strain G5
NoYes   Cryptosporidium hominis
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Neospora caninum
NoYes   Toxoplasma gondii VEG
NoYes   Toxoplasma gondii ME49
NoYes   Toxoplasma gondii GT1
NoYes   Babesia bovis T2Bo
NoYes   Theileria parva
NoYes   Theileria annulata
NoYes   Plasmodium falciparum 3D7
NoYes   Plasmodium vivax SaI-1 7.0
NoYes   Plasmodium knowlesi strain H
NoYes   Plasmodium yoelii ssp. yoelii 1
NoYes   Plasmodium chabaudi
NoYes   Plasmodium berghei ANKA
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Naegleria gruberi
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Emiliania huxleyi CCMP1516
NoYes   Thermobaculum terrenum ATCC BAA-798
NoYes   Leptolyngbya sp. PCC 7376
NoYes   Pseudanabaena sp. PCC 7367
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Thermosynechococcus sp. NK55
NoYes   Thermosynechococcus elongatus BP-1
NoYes   Synechococcus sp. PCC 7502
NoYes   Synechococcus sp. PCC 6312
NoYes   Synechococcus sp. CC9311
NoYes   Synechococcus elongatus PCC 7942
NoYes   Prochlorococcus marinus str. MIT 9515
NoYes   Microcoleus sp. PCC 7113
NoYes   Trichodesmium erythraeum IMS101
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Gloeocapsa sp. PCC 7428
NoYes   cyanobacterium UCYN-A
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Gloeobacter violaceus PCC 7421
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   'Nostoc azollae' 0708
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Ureaplasma parvum serovar 3 str. ATCC 27815
NoYes   Ureaplasma urealyticum serovar 10 str. ATCC 33699
NoYes   Mycoplasma crocodyli MP145
NoYes   Mycoplasma mobile 163K
NoYes   Mycoplasma fermentans M64
NoYes   Mycoplasma synoviae 53
NoYes   Mycoplasma pulmonis UAB CTIP
NoYes   Mycoplasma hominis ATCC 23114
NoYes   Mycoplasma gallisepticum str. F
NoYes   Conexibacter woesei DSM 14684
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Rubrobacter xylanophilus DSM 9941
NoYes   Ilumatobacter coccineus
NoYes   Acidimicrobium ferrooxidans DSM 10331
NoYes   Thermobispora bispora DSM 43833
NoYes   Nakamurella multipartita DSM 44233
NoYes   Modestobacter marinus
NoYes   Blastococcus saxobsidens DD2
NoYes   Geodermatophilus obscurus DSM 43160
NoYes   Kineococcus radiotolerans SRS30216
NoYes   Catenulispora acidiphila DSM 44928
NoYes   Stackebrandtia nassauensis DSM 44728
NoYes   Frankia symbiont of Datisca glomerata
NoYes   Frankia sp. EAN1pec
NoYes   Frankia alni ACN14a
NoYes   Thermobifida fusca YX
NoYes   Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
NoYes   Thermomonospora curvata DSM 43183
NoYes   Streptosporangium roseum DSM 43021
NoYes   Kitasatospora setae KM-6054
NoYes   Streptomyces coelicolor A3(2)
NoYes   Streptomyces sp. PAMC26508
NoYes   Streptomyces flavogriseus ATCC 33331
NoYes   Streptomyces sp. SirexAA-E
NoYes   Streptomyces griseus subsp. griseus NBRC 13350
NoYes   Streptomyces violaceusniger Tu 4113
NoYes   Streptomyces avermitilis MA-4680
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces scabiei 87.22
NoYes   Streptomyces hygroscopicus subsp. jinggangensis 5008
NoYes   Actinosynnema mirum DSM 43827
NoYes   Saccharomonospora viridis DSM 43017
NoYes   Pseudonocardia dioxanivorans CB1190
NoYes   Saccharopolyspora erythraea NRRL 2338
NoYes   Amycolatopsis mediterranei U32
NoYes   Kribbella flavida DSM 17836
NoYes   Nocardioides sp. JS614
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Microlunatus phosphovorus NM-1
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Salinispora arenicola CNS-205
NoYes   Salinispora tropica CNB-440
NoYes   Verrucosispora maris AB-18-032
NoYes   Micromonospora sp. L5
NoYes   Micromonospora aurantiaca ATCC 27029
NoYes   Actinoplanes sp. N902-109
NoYes   Actinoplanes sp. SE50/110
NoYes   Actinoplanes missouriensis 431
NoYes   Segniliparus rotundus DSM 44985
NoYes   Tsukamurella paurometabola DSM 20162
NoYes   Gordonia sp. KTR9
NoYes   Gordonia polyisoprenivorans VH2
NoYes   Gordonia bronchialis DSM 43247
NoYes   Rhodococcus jostii RHA1
NoYes   Rhodococcus equi 103S
NoYes   Rhodococcus opacus B4
NoYes   Rhodococcus erythropolis PR4
NoYes   Nocardia cyriacigeorgica GUH-2
NoYes   Nocardia farcinica IFM 10152
NoYes   Amycolicicoccus subflavus DQS3-9A1
NoYes   Mycobacterium massiliense str. GO 06
NoYes   Mycobacterium abscessus ATCC 19977
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium intracellulare ATCC 13950
NoYes   Mycobacterium avium 104
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium canettii CIPT 140010059
NoYes   Mycobacterium africanum GM041182
NoYes   Mycobacterium tuberculosis KZN 1435
NoYes   Mycobacterium tuberculosis
NoYes   Mycobacterium bovis BCG str. Pasteur 1173P2
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium ulcerans Agy99
NoYes   Mycobacterium gilvum PYR-GCK
NoYes   Mycobacterium chubuense NBB4
NoYes   Mycobacterium marinum M
NoYes   Mycobacterium smegmatis str. MC2 155
NoYes   Corynebacterium resistens DSM 45100
NoYes   Corynebacterium aurimucosum ATCC 700975
NoYes   Corynebacterium kroppenstedtii DSM 44385
NoYes   Corynebacterium efficiens YS-314
NoYes   Corynebacterium ulcerans 0102
NoYes   Corynebacterium urealyticum DSM 7109
NoYes   Corynebacterium jeikeium K411
NoYes   Corynebacterium variabile DSM 44702
NoYes   Corynebacterium pseudotuberculosis 316
NoYes   Corynebacterium glutamicum R
NoYes   Corynebacterium diphtheriae NCTC 13129
NoYes   Kytococcus sedentarius DSM 20547
NoYes   Beutenbergia cavernae DSM 12333
NoYes   Microbacterium testaceum StLB037
NoYes   Clavibacter michiganensis subsp. michiganensis NCPPB 382
NoYes   Jonesia denitrificans DSM 20603
NoYes   Intrasporangium calvum DSM 43043
NoYes   Brachybacterium faecium DSM 4810
NoYes   Cellulomonas fimi ATCC 484
NoYes   Arthrobacter phenanthrenivorans Sphe3
NoYes   Arthrobacter chlorophenolicus A6
NoYes   Arthrobacter aurescens TC1
NoYes   Rothia mucilaginosa DY-18
NoYes   Rothia dentocariosa ATCC 17931
NoYes   Arthrobacter sp. Rue61a
NoYes   Arthrobacter sp. FB24
NoYes   Bifidobacterium longum subsp. longum JDM301
NoYes   Bifidobacterium animalis subsp. lactis Bl-04
NoYes   Bifidobacterium dentium Bd1
NoYes   Bifidobacterium breve ACS-071-V-Sch8b
NoYes   Bifidobacterium adolescentis ATCC 15703
NoYes   Mobiluncus curtisii ATCC 43063
NoYes   Actinomyces sp. F0330
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Dehalococcoides ethenogenes 195
NoYes   Dehalococcoides sp. BAV1
NoYes   Sphaerobacter thermophilus DSM 20745
NoYes   Herpetosiphon aurantiacus DSM 785
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Truepera radiovictrix DSM 17093
NoYes   Deinococcus deserti VCD115
NoYes   Deinococcus maricopensis DSM 21211
NoYes   Deinococcus geothermalis DSM 11300
NoYes   Deinococcus proteolyticus MRP
NoYes   Deinococcus radiodurans R1
NoYes   Oceanithermus profundus DSM 14977
NoYes   Meiothermus ruber DSM 1279
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Thermincola potens JR
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfotomaculum reducens MI-1
NoYes   Desulfotomaculum carboxydivorans CO-1-SRB
NoYes   Desulfotomaculum ruminis DSM 2154
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] torques
NoYes   Coprococcus sp. ART55/1
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Syntrophothermus lipocalidus DSM 12680
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Mahella australiensis 50-1 BON
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Thermodesulfobium narugense DSM 14796
NoYes   Enterococcus faecalis 62
NoYes   Oenococcus oeni PSU-1
NoYes   Leuconostoc citreum KM20
NoYes   Lactobacillus crispatus ST1
NoYes   Lactobacillus johnsonii FI9785
NoYes   Lactobacillus ruminis ATCC 27782
NoYes   Lactobacillus fermentum IFO 3956
NoYes   Lactobacillus amylovorus GRL1118
NoYes   Lactobacillus sakei subsp. sakei 23K
NoYes   Lactobacillus reuteri DSM 20016
NoYes   Lactobacillus gasseri ATCC 33323
NoYes   Lactobacillus plantarum JDM1
NoYes   Lactobacillus buchneri NRRL B-30929
NoYes   Lactobacillus buchneri
NoYes   Lactobacillus brevis ATCC 367
NoYes   Lactobacillus acidophilus 30SC
NoYes   Pediococcus claussenii ATCC BAA-344
NoYes   Pediococcus pentosaceus ATCC 25745
NoYes   Streptococcus sp. I-P16
NoYes   Streptococcus sp. I-G2
NoYes   Streptococcus gallolyticus UCN34
NoYes   Streptococcus pasteurianus ATCC 43144
NoYes   Streptococcus infantarius subsp. infantarius CJ18
NoYes   Streptococcus macedonicus ACA-DC 198
NoYes   Streptococcus pneumoniae P1031
NoYes   Streptococcus mutans NN2025
NoYes   Streptococcus suis P1/7
NoYes   Streptococcus salivarius 57.I
NoYes   Streptococcus gordonii str. Challis substr. CH1
NoYes   Exiguobacterium sp. MH3
NoYes   Exiguobacterium sp. AT1b
NoYes   Exiguobacterium sibiricum 255-15
NoYes   Kyrpidia tusciae DSM 2912
NoYes   Brevibacillus brevis NBRC 100599
NoYes   Paenibacillus sp. JDR-2
NoYes   Paenibacillus mucilaginosus 3016
NoYes   Bacillus selenitireducens MLS10
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   Geobacillus thermoglucosidasius C56-YS93
NoYes   Lysinibacillus sphaericus C3-41
NoYes   Oceanobacillus iheyensis HTE831
NoYes   Anoxybacillus flavithermus WK1
NoYes   Geobacillus thermoleovorans CCB_US3_UF5
NoYes   Geobacillus kaustophilus HTA426
NoYes   Geobacillus sp. GHH01
NoYes   Geobacillus sp. WCH70
NoYes   Geobacillus thermodenitrificans NG80-2
NoYes   Halobacillus halophilus DSM 2266
NoYes   Bacillus sp. JS
NoYes   Bacillus sp. 1NLA3E
NoYes   Bacillus amyloliquefaciens FZB42
NoYes   Bacillus atrophaeus 1942
NoYes   Bacillus subtilis subsp. subtilis str. 168
NoYes   Bacillus licheniformis DSM 13 = ATCC 14580
NoYes   Bacillus halodurans C-125
NoYes   Bacillus weihenstephanensis KBAB4
NoYes   Bacillus thuringiensis str. Al Hakam
NoYes   Bacillus cereus 03BB102
NoYes   Bacillus anthracis str. A0248
NoYes   Bacillus pseudofirmus OF4
NoYes   Bacillus clausii KSM-K16
NoYes   Bacillus cellulosilyticus DSM 2522
NoYes   Bacillus pumilus SAFR-032
NoYes   Bacillus megaterium DSM 319
NoYes   Bacillus coagulans 2-6
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Gemmatimonas aurantiaca T-27
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Saprospira grandis str. Lewin
NoYes   Niastella koreensis GR20-10
NoYes   Chitinophaga pinensis DSM 2588
NoYes   Salinibacter ruber M8
NoYes   Rhodothermus marinus DSM 4252
NoYes   Flexibacter litoralis DSM 6794
NoYes   Belliella baltica DSM 15883
NoYes   Cyclobacterium marinum DSM 745
NoYes   Marivirga tractuosa DSM 4126
NoYes   Fibrella aestuarina
NoYes   Cytophaga hutchinsonii ATCC 33406
NoYes   Spirosoma linguale DSM 74
NoYes   Runella slithyformis DSM 19594
NoYes   Parabacteroides distasonis ATCC 8503
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Prevotella intermedia 17
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Pedobacter saltans DSM 12145
NoYes   Solitalea canadensis DSM 3403
NoYes   Fluviicola taffensis DSM 16823
NoYes   Owenweeksia hongkongensis DSM 17368
NoYes   Zunongwangia profunda SM-A87
NoYes   Krokinobacter sp. 4H-3-7-5
NoYes   Gramella forsetii KT0803
NoYes   Lacinutrix sp. 5H-3-7-4
NoYes   Maribacter sp. HTCC2170
NoYes   Robiginitalea biformata HTCC2501
NoYes   Croceibacter atlanticus HTCC2559
NoYes   Aequorivita sublithincola DSM 14238
NoYes   Zobellia galactanivorans
NoYes   Muricauda ruestringensis DSM 13258
NoYes   Cellulophaga algicola DSM 14237
NoYes   Cellulophaga lytica DSM 7489
NoYes   Flavobacteriaceae bacterium 3519-10
NoYes   Polaribacter sp. MED152
NoYes   Riemerella anatipestifer ATCC 11845 = DSM 15868
NoYes   Ornithobacterium rhinotracheale DSM 15997
NoYes   Capnocytophaga canimorsus Cc5
NoYes   Capnocytophaga ochracea DSM 7271
NoYes   Weeksella virosa DSM 16922
NoYes   Flavobacterium indicum GPTSA100-9
NoYes   Flavobacterium psychrophilum JIP02/86
NoYes   Flavobacterium branchiophilum FL-15
NoYes   Flavobacterium columnare ATCC 49512
NoYes   Flavobacterium johnsoniae UW101
NoYes   Simkania negevensis Z
NoYes   Phycisphaera mikurensis NBRC 102666
NoYes   Isosphaera pallida ATCC 43644
NoYes   Planctomyces brasiliensis DSM 5305
NoYes   Planctomyces limnophilus DSM 3776
NoYes   Rhodopirellula baltica SH 1
NoYes   Pirellula staleyi DSM 6068
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Thermovirga lienii DSM 17291
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Turneriella parva DSM 21527
NoYes   Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema brennaborense DSM 12168
NoYes   Geobacillus sp. JF8
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Thermodesulfatator indicus DSM 15286
NoYes   Thermodesulfobacterium sp. OPB45
NoYes   Desulfurispirillum indicum S5
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Marinitoga piezophila KA3
NoYes   Petrotoga mobilis SJ95
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Kosmotoga olearia TBF 19.5.1
NoYes   Fervidobacterium pennivorans DSM 9078
NoYes   Fervidobacterium nodosum Rt17-B1
NoYes   Thermosipho melanesiensis BI429
NoYes   Thermosipho africanus TCF52B
NoYes   Thermotoga lettingae TMO
NoYes   Thermotoga thermarum DSM 5069
NoYes   Thermotoga sp. RQ2
NoYes   Thermotoga naphthophila RKU-10
NoYes   Thermotoga petrophila RKU-1
NoYes   Thermotoga neapolitana DSM 4359
NoYes   Thermotoga maritima MSB8
NoYes   Thermovibrio ammonificans HB-1
NoYes   Desulfurobacterium thermolithotrophum DSM 11699
NoYes   Sulfurihydrogenibium sp. YO3AOP1
NoYes   Sulfurihydrogenibium azorense Az-Fu1
NoYes   Persephonella marina EX-H1
NoYes   Hydrogenobaculum sp. SN
NoYes   Hydrogenobaculum sp. HO
NoYes   Hydrogenobaculum sp. Y04AAS1
NoYes   Aquifex aeolicus VF5
NoYes   Candidatus Chloracidobacterium thermophilum B
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Granulicella tundricola MP5ACTX9
NoYes   Granulicella mallensis MP5ACTX8
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Thermodesulfovibrio yellowstonii DSM 11347
NoYes   Leptospirillum ferrooxidans C2-3
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   candidate division SR1 bacterium RAAC1_SR1_1
NoYes   Candidatus Saccharimonas aalborgensis
NoYes   Acidithiobacillus ferrivorans SS3
NoYes   Acidithiobacillus caldus SM-1
NoYes   Acidithiobacillus ferrooxidans ATCC 53993
NoYes   Bacteriovorax marinus SJ
NoYes   Nautilia profundicola AmH
NoYes   Nitratifractor salsuginis DSM 16511
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Arcobacter sp. L
NoYes   Arcobacter nitrofigilis DSM 7299
NoYes   Arcobacter butzleri RM4018
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Sulfurimonas autotrophica DSM 16294
NoYes   Sulfurimonas denitrificans DSM 1251
NoYes   Wolinella succinogenes DSM 1740
NoYes   Helicobacter cetorum MIT 00-7128
NoYes   Helicobacter bizzozeronii CIII-1
NoYes   Helicobacter hepaticus ATCC 51449
NoYes   Helicobacter felis ATCC 49179
NoYes   Helicobacter cinaedi PAGU611
NoYes   Helicobacter acinonychis str. Sheeba
NoYes   Helicobacter pylori B38
NoYes   Nitratiruptor sp. SB155-2
NoYes   Sulfurovum sp. NBC37-1
NoYes   Desulfarculus baarsii DSM 2075
NoYes   Desulfobacca acetoxidans DSM 11109
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfomonile tiedjei DSM 6799
NoYes   Syntrophobacter fumaroxidans MPOB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Hippea maritima DSM 10411
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Haliangium ochraceum DSM 14365
NoYes   Stigmatella aurantiaca DW4/3-1
NoYes   Corallococcus coralloides DSM 2259
NoYes   Myxococcus xanthus DK 1622
NoYes   Myxococcus fulvus HW-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thauera sp. MZ1T
NoYes   Azoarcus sp. KH32C
NoYes   Pandoraea sp. RB-44
NoYes   Azoarcus sp. BH72
NoYes   Aromatoleum aromaticum EbN1
NoYes   Dechlorosoma suillum PS
NoYes   Pseudogulbenkiania sp. NH8B
NoYes   Laribacter hongkongensis HLHK9
NoYes   Chromobacterium violaceum ATCC 12472
NoYes   Candidatus Accumulibacter phosphatis clade IIA str. UW-1
NoYes   beta proteobacterium CB
NoYes   Methylibium petroleiphilum PM1
NoYes   Thiomonas arsenitoxydans
NoYes   Thiomonas intermedia K12
NoYes   Leptothrix cholodnii SP-6
NoYes   Burkholderia phytofirmans PsJN
NoYes   Burkholderia phymatum STM815
NoYes   Burkholderia xenovorans LB400
NoYes   Ralstonia eutropha JMP134
NoYes   Cupriavidus taiwanensis LMG 19424
NoYes   Cupriavidus metallidurans CH34
NoYes   Cupriavidus necator N-1
NoYes   Ralstonia eutropha H16
NoYes   Ralstonia pickettii 12D
NoYes   Ralstonia solanacearum CFBP2957
NoYes   Polynucleobacter necessarius subsp. asymbioticus QLW-P1DMWA-1
NoYes   Burkholderia sp. CCGE1002
NoYes   Burkholderia thailandensis E264
NoYes   Burkholderia pseudomallei 1106a
NoYes   Burkholderia mallei SAVP1
NoYes   Burkholderia ambifaria AMMD
NoYes   Burkholderia cenocepacia HI2424
NoYes   Burkholderia multivorans ATCC 17616
NoYes   Burkholderia vietnamiensis G4
NoYes   Ramlibacter tataouinensis TTB310
NoYes   Polaromonas sp. JS666
NoYes   Polaromonas naphthalenivorans CJ2
NoYes   Variovorax paradoxus S110
NoYes   Collimonas fungivorans Ter331
NoYes   Pusillimonas sp. T7-7
NoYes   Advenella kashmirensis WT001
NoYes   Bordetella avium 197N
NoYes   Bordetella pertussis Tohama I
NoYes   Bordetella parapertussis 12822
NoYes   Bordetella bronchiseptica RB50
NoYes   Achromobacter xylosoxidans A8
NoYes   Achromobacter xylosoxidans
NoYes   Nitrosospira multiformis ATCC 25196
NoYes   Nitrosomonas sp. Is79A3
NoYes   Sideroxydans lithotrophicus ES-1
NoYes   Gallionella capsiferriformans ES-2
NoYes   Methylotenera versatilis 301
NoYes   Methylotenera mobilis JLW8
NoYes   Methylovorus sp. MP688
NoYes   Methylovorus glucosetrophus SIP3-4
NoYes   Methylobacillus flagellatus KT
NoYes   Magnetococcus marinus MC-1
NoYes   Parvularcula bermudensis HTCC2503
NoYes   Asticcacaulis excentricus CB 48
NoYes   Brevundimonas subvibrioides ATCC 15264
NoYes   Caulobacter sp. K31
NoYes   Caulobacter crescentus NA1000
NoYes   Caulobacter segnis ATCC 21756
NoYes   Phenylobacterium zucineum HLK1
NoYes   Erythrobacter litoralis HTCC2594
NoYes   Sphingopyxis alaskensis RB2256
NoYes   Novosphingobium sp. PP1Y
NoYes   Novosphingobium aromaticivorans DSM 12444
NoYes   Sphingobium sp. SYK-6
NoYes   Sphingobium japonicum UT26S
NoYes   Sphingomonas sp. MM-1
NoYes   Sphingomonas wittichii RW1
NoYes   Maricaulis maris MCS10
NoYes   Hirschia baltica ATCC 49814
NoYes   Hyphomonas neptunium ATCC 15444
NoYes   Dinoroseobacter shibae DFL 12
NoYes   Phaeobacter gallaeciensis 2.10
NoYes   Pseudovibrio sp. FO-BEG1
NoYes   Jannaschia sp. CCS1
NoYes   Ruegeria sp. TM1040
NoYes   Ruegeria pomeroyi DSS-3
NoYes   Roseobacter litoralis Och 149
NoYes   Roseobacter denitrificans OCh 114
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Paracoccus denitrificans PD1222
NoYes   Tistrella mobilis KA081020-065
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum centenum SW
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Azospirillum brasilense Sp245
NoYes   Gluconacetobacter xylinus NBRC 3288
NoYes   Granulibacter bethesdensis CGDNIH1
NoYes   Gluconacetobacter diazotrophicus PAl 5
NoYes   Acidiphilium multivorum AIU301
NoYes   Acidiphilium cryptum JF-5
NoYes   Gluconobacter oxydans 621H
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Polymorphum gilvum SL003B-26A1
NoYes   Micavibrio aeruginosavorus ARL-13
NoYes   Candidatus Puniceispirillum marinum IMCC1322
NoYes   alpha proteobacterium HIMB5
NoYes   alpha proteobacterium HIMB59
NoYes   Starkeya novella DSM 506
NoYes   Xanthobacter autotrophicus Py2
NoYes   Azorhizobium caulinodans ORS 571
NoYes   Methylobacterium chloromethanicum CM4
NoYes   Methylobacterium extorquens AM1
NoYes   Methylobacterium sp. 4-46
NoYes   Methylobacterium nodulans ORS 2060
NoYes   Methylobacterium radiotolerans JCM 2831
NoYes   Parvibaculum lavamentivorans DS-1
NoYes   Sinorhizobium fredii NGR234
NoYes   Sinorhizobium medicae WSM419
NoYes   Sinorhizobium meliloti AK83
NoYes   Rhizobium etli CIAT 652
NoYes   Rhizobium leguminosarum bv. viciae 3841
NoYes   Agrobacterium radiobacter K84
NoYes   Mesorhizobium sp. BNC1
NoYes   Mesorhizobium opportunistum WSM2075
NoYes   Mesorhizobium ciceri biovar biserrulae WSM1271
NoYes   Mesorhizobium loti MAFF303099
NoYes   Methylocella silvestris BL2
NoYes   Beijerinckia indica subsp. indica ATCC 9039
NoYes   Pelagibacterium halotolerans B2
NoYes   Hyphomicrobium sp. MC1
NoYes   Oligotropha carboxidovorans OM4
NoYes   Rhodopseudomonas palustris BisA53
NoYes   Nitrobacter hamburgensis X14
NoYes   Bradyrhizobium japonicum USDA 110
NoYes   Bradyrhizobium sp. ORS 278
NoYes   Methylocystis sp. SC2
NoYes   Saccharophagus degradans 2-40
NoYes   Teredinibacter turnerae T7901
NoYes   Oceanimonas sp. GK1
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Aliivibrio salmonicida LFI1238
NoYes   Vibrio fischeri MJ11
NoYes   Vibrio sp. Ex25
NoYes   Vibrio harveyi ATCC BAA-1116
NoYes   Vibrio parahaemolyticus RIMD 2210633
NoYes   Vibrio splendidus LGP32
NoYes   Vibrio anguillarum 775
NoYes   Vibrio furnissii NCTC 11218
NoYes   Vibrio vulnificus MO6-24/O
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Psychromonas ingrahamii 37
NoYes   Psychromonas sp. CNPT3
NoYes   Idiomarina loihiensis L2TR
NoYes   Ferrimonas balearica DSM 9799
NoYes   Shewanella piezotolerans WP3
NoYes   Shewanella loihica PV-4
NoYes   Shewanella halifaxensis HAW-EB4
NoYes   Shewanella sediminis HAW-EB3
NoYes   Shewanella denitrificans OS217
NoYes   Shewanella pealeana ATCC 700345
NoYes   Shewanella oneidensis MR-1
NoYes   Shewanella baltica OS185
NoYes   Shewanella woodyi ATCC 51908
NoYes   Shewanella sp. MR-4
NoYes   Shewanella amazonensis SB2B
NoYes   Shewanella violacea DSS12
NoYes   Shewanella frigidimarina NCIMB 400
NoYes   Shewanella putrefaciens CN-32
NoYes   Colwellia psychrerythraea 34H
NoYes   Pseudoalteromonas sp. SM9913
NoYes   Pseudoalteromonas atlantica T6c
NoYes   Pseudoalteromonas haloplanktis TAC125
NoYes   Glaciecola sp. 4H-3-7+YE-5
NoYes   Glaciecola nitratireducens FR1064
NoYes   Marinobacter adhaerens HP15
NoYes   Marinobacter sp. BSs20148
NoYes   Marinobacter hydrocarbonoclasticus ATCC 49840
NoYes   Marinobacter aquaeolei VT8
NoYes   Alteromonas sp. SN2
NoYes   Alteromonas macleodii str. 'Deep ecotype'
NoYes   Kangiella koreensis DSM 16069
NoYes   Hahella chejuensis KCTC 2396
NoYes   Alcanivorax borkumensis SK2
NoYes   Marinomonas posidonica IVIA-Po-181
NoYes   Marinomonas sp. MWYL1
NoYes   Marinomonas mediterranea MMB-1
NoYes   Chromohalobacter salexigens DSM 3043
NoYes   Halomonas elongata DSM 2581
NoYes   Methylomicrobium alcaliphilum
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Dichelobacter nodosus VCS1703A
NoYes   Rhodanobacter denitrificans
NoYes   Pseudoxanthomonas spadix BD-a59
NoYes   Pseudoxanthomonas suwonensis 11-1
NoYes   Stenotrophomonas maltophilia K279a
NoYes   Xylella fastidiosa M23
NoYes   Xanthomonas axonopodis pv. citri str. 306
NoYes   Xanthomonas oryzae pv. oryzae PXO99A
NoYes   Xanthomonas campestris pv. campestris str. B100
NoYes   Alkalilimnicola ehrlichii MLHE-1
NoYes   Thioalkalivibrio sulfidophilus HL-EbGr7
NoYes   Thioalkalivibrio sp. K90mix
NoYes   Halorhodospira halophila SL1
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Nitrosococcus halophilus Nc4
NoYes   Nitrosococcus oceani ATCC 19707
NoYes   gamma proteobacterium HdN1
NoYes   Photorhabdus asymbiotica
NoYes   Photorhabdus luminescens subsp. laumondii TTO1
NoYes   Xenorhabdus nematophila ATCC 19061
NoYes   Providencia stuartii MRSN 2154
NoYes   Proteus mirabilis HI4320
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia proteamaculans 568
NoYes   Pectobacterium wasabiae WPP163
NoYes   Escherichia blattae DSM 4481
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Azotobacter vinelandii DJ
NoYes   Pseudomonas sp. TKP
NoYes   Pseudomonas sp. UW4
NoYes   Pseudomonas brassicacearum subsp. brassicacearum NFM421
NoYes   Pseudomonas entomophila L48
NoYes   Pseudomonas syringae pv. tomato str. DC3000
NoYes   Pseudomonas stutzeri A1501
NoYes   Pseudomonas fulva 12-X
NoYes   Pseudomonas putida F1
NoYes   Pseudomonas protegens Pf-5
NoYes   Pseudomonas fluorescens SBW25
NoYes   Pseudomonas mendocina ymp
NoYes   Pseudomonas aeruginosa UCBPP-PA14
NoYes   Pseudomonas sp. VLB120
NoYes   Psychrobacter sp. G
NoYes   Psychrobacter sp. PRwf-1
NoYes   Psychrobacter arcticus 273-4
NoYes   Psychrobacter cryohalolentis K5
NoYes   Moraxella catarrhalis RH4
NoYes   Acinetobacter oleivorans DR1
NoYes   Acinetobacter calcoaceticus PHEA-2
NoYes   Acinetobacter baumannii ATCC 17978
NoYes   Acinetobacter sp. ADP1
NoYes   Methylophaga sp. JAM1
NoYes   Cycloclasticus sp. P1
NoYes   Thiomicrospira crunogena XCL-2
NoYes   Thioalkalimicrobium cyclicum ALM1
NoYes   Francisella noatunensis subsp. orientalis str. Toba 04
NoYes   Francisella sp. TX077308
NoYes   Francisella philomiragia subsp. philomiragia ATCC 25017
NoYes   Francisella cf. novicida 3523
NoYes   Francisella novicida U112
NoYes   Candidatus Caldiarchaeum subterraneum
NoYes   Candidatus Nitrosopumilus sp. AR2
NoYes   Nitrosopumilus maritimus SCM1
NoYes   Acidilobus saccharovorans 345-15
NoYes   Pyrolobus fumarii 1A
NoYes   Hyperthermus butylicus DSM 5456
NoYes   Aeropyrum pernix K1
NoYes   Ignicoccus hospitalis KIN4/I
NoYes   Staphylothermus marinus F1
NoYes   Metallosphaera cuprina Ar-4
NoYes   Metallosphaera sedula DSM 5348
NoYes   Acidianus hospitalis W1
NoYes   Sulfolobus tokodaii str. 7
NoYes   Sulfolobus islandicus Y.N.15.51
NoYes   Sulfolobus solfataricus P2
NoYes   Sulfolobus acidocaldarius DSM 639
NoYes   Vulcanisaeta moutnovskia 768-28
NoYes   Vulcanisaeta distributa DSM 14429
NoYes   Caldivirga maquilingensis IC-167
NoYes   halophilic archaeon DL31
NoYes   Methanocella arvoryzae MRE50
NoYes   Methanocella paludicola SANAE
NoYes   Methanosaeta harundinacea 6Ac
NoYes   Methanosaeta thermophila PT
NoYes   Methanosaeta concilii GP6
NoYes   Methanosalsum zhilinae DSM 4017
NoYes   Methanococcoides burtonii DSM 6242
NoYes   Methanosarcina acetivorans C2A
NoYes   Methanosarcina mazei Go1
NoYes   Methanosarcina barkeri str. Fusaro
NoYes   Methanohalophilus mahii DSM 5219
NoYes   Methanosphaerula palustris E1-9c
NoYes   Methanoregula boonei 6A8
NoYes   Methanospirillum hungatei JF-1
NoYes   Methanoplanus petrolearius DSM 11571
NoYes   Methanoculleus bourgensis MS2
NoYes   Methanoculleus marisnigri JR1
NoYes   Methanopyrus kandleri AV19
NoYes   Ferroglobus placidus DSM 10642
NoYes   Archaeoglobus profundus DSM 5631
NoYes   Archaeoglobus veneficus SNP6
NoYes   Archaeoglobus fulgidus DSM 4304
NoYes   Thermococcus sp. 4557
NoYes   Thermococcus onnurineus NA1
NoYes   Thermococcus kodakarensis KOD1
NoYes   Thermococcus gammatolerans EJ3
NoYes   Thermococcus sibiricus MM 739
NoYes   Thermococcus barophilus MP
NoYes   Pyrococcus sp. ST04
NoYes   Pyrococcus yayanosii CH1
NoYes   Pyrococcus horikoshii OT3
NoYes   Pyrococcus abyssi GE5
NoYes   Pyrococcus furiosus COM1
NoYes   Thermoplasma volcanium GSS1
NoYes   Thermoplasma acidophilum DSM 1728
NoYes   Picrophilus torridus DSM 9790
NoYes   Salinarchaeum sp. Harcht-Bsk1
NoYes   Halopiger xanaduensis SH-6
NoYes   Methanobacterium sp. AL-21
NoYes   Haloterrigena turkmenica DSM 5511
NoYes   Natrinema sp. J7-2
NoYes   Natrialba magadii ATCC 43099
NoYes   Halorubrum lacusprofundi ATCC 49239
NoYes   Haloquadratum walsbyi DSM 16790
NoYes   Halogeometricum borinquense DSM 11551
NoYes   Haloferax mediterranei ATCC 33500
NoYes   Haloferax volcanii DS2
NoYes   Halomicrobium mukohataei DSM 12286
NoYes   Halorhabdus utahensis DSM 12940
NoYes   Natronomonas pharaonis DSM 2160
NoYes   Haloarcula hispanica ATCC 33960
NoYes   Haloarcula marismortui ATCC 43049
NoYes   Halalkalicoccus jeotgali B3
NoYes   Halobacterium salinarum R1
NoYes   Halobacterium sp. NRC-1
NoYes   Methanotorris igneus Kol 5
NoYes   Methanocaldococcus sp. FS406-22
NoYes   Methanocaldococcus fervens AG86
NoYes   Methanocaldococcus vulcanius M7
NoYes   methanocaldococcus infernus ME
NoYes   Methanocaldococcus jannaschii DSM 2661
NoYes   Methanothermococcus okinawensis IH1
NoYes   Methanococcus aeolicus Nankai-3
NoYes   Methanococcus maripaludis C5
NoYes   Methanococcus voltae A3
NoYes   Methanothermus fervidus DSM 2088
NoYes   Methanothermobacter marburgensis str. Marburg
NoYes   Methanothermobacter thermautotrophicus str. Delta H
NoYes   Methanosphaera stadtmanae DSM 3091
NoYes   Methanobrevibacter sp. AbM4
NoYes   Methanobrevibacter ruminantium M1
NoYes   Complete genome sequence of Methanobacterium sp. Mb1
NoYes   Aciduliprofundum sp. MAR08-339
NoYes   Aciduliprofundum boonei T469
NoYes   Xenopus (Silurana) tropicalis v7.1 (annotation v7.2) - Tropical clawed frog
NoYes   Drosophila melanogaster FlyBase 5.12 - Fruit fly
NoYes   Anopheles gambiae VectorBase AgamP3.6 - African malaria mosquito
NoYes   Ascaris suum Victoria/Ghent - Pig roundworm
NoYes   Caenorhabditis elegans WormBase WS218 - Roundworm
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Cryptococcus neoformans JEC21
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae FL100
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersB
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae VL3
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae LalvinQA23
NoYes   Saccharomyces cerevisiae AWRI796
NoYes   Saccharomyces cerevisiae Sigma1278b
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae AWRI1631
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae RM11-1a
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Schizosaccharomyces pombe 972h-
NoYes   Batrachochytrium dendrobatidis JEL423
NoYes   Batrachochytrium dendrobatidis JAM81
NoYes   Theobroma cacao Matina 1-6 v0.9 - Cacao
NoYes   Hordeum vulgare 22 - Domesticated barley
NoYes   Oryza sativa ssp. Indica - Long-grained rice
NoYes   Trypanosoma brucei Lister 427 v4.1
NoYes   Neospora caninum Nc-Liverpool 6.2
NoYes   Plasmodium falciparum HB3
NoYes   Plasmodium falciparum Dd2
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Chamaesiphon minutus PCC 6605
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Cyanobium gracile PCC 6307
NoYes   Dactylococcopsis salina PCC 8305
NoYes   Synechococcus sp. JA-2-3B'a(2-13)
NoYes   Synechococcus sp. JA-3-3Ab
NoYes   Synechococcus sp. CC9902
NoYes   Synechococcus sp. RCC307
NoYes   Synechococcus sp. CC9605
NoYes   Synechococcus sp. WH 8102
NoYes   Synechococcus sp. WH 7803
NoYes   Synechococcus sp. PCC 7002
NoYes   Synechococcus elongatus PCC 6301
NoYes   Prochlorococcus marinus str. NATL1A
NoYes   Prochlorococcus marinus str. MIT 9301
NoYes   Prochlorococcus marinus str. AS9601
NoYes   Prochlorococcus marinus subsp. marinus str. CCMP1375
NoYes   Prochlorococcus marinus subsp. pastoris str. CCMP1986
NoYes   Prochlorococcus marinus str. MIT 9215
NoYes   Prochlorococcus marinus str. MIT 9211
NoYes   Prochlorococcus marinus str. MIT 9313
NoYes   Prochlorococcus marinus str. MIT 9312
NoYes   Prochlorococcus marinus str. MIT 9303
NoYes   Prochlorococcus marinus str. NATL2A
NoYes   Crinalium epipsammum PCC 9333
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Cyanobacterium aponinum PCC 10605
NoYes   Cyanobacterium stanieri PCC 7202
NoYes   Gloeobacter kilaueensis Gloeobacter sp. JS
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Stanieria cyanosphaera PCC 7437
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Ureaplasma parvum serovar 3 str. ATCC 700970
NoYes   Mycoplasma cynos C142
NoYes   Mycoplasma fermentans JER
NoYes   Mycoplasma fermentans PG18
NoYes   Mycoplasma gallisepticum NC08_2008.031-4-3P
NoYes   Mycoplasma gallisepticum CA06_2006.052-5-2P
NoYes   Mycoplasma gallisepticum NC06_2006.080-5-2P
NoYes   Mycoplasma gallisepticum WI01_2001.043-13-2P
NoYes   Mycoplasma gallisepticum NY01_2001.047-5-1P
NoYes   Mycoplasma gallisepticum NC96_1596-4-2P
NoYes   Mycoplasma gallisepticum NC95_13295-2-2P
NoYes   Mycoplasma gallisepticum VA94_7994-1-7P
NoYes   Mycoplasma gallisepticum S6
NoYes   Mycoplasma gallisepticum str. R(high)
NoYes   Mycoplasma gallisepticum str. R(low)
NoYes   Adlercreutzia equolifaciens DSM 19450
NoYes   Frankia sp. EuI1c
NoYes   Frankia sp. CcI3
NoYes   Nocardiopsis alba ATCC BAA-2165
NoYes   Streptomyces albus J1074
NoYes   Streptomyces rapamycinicus NRRL 5491
NoYes   Streptomyces davawensis JCM 4913
NoYes   Streptomyces fulvissimus DSM 40593
NoYes   Streptomyces venezuelae ATCC 10712
NoYes   Streptomyces collinus Tu 365
NoYes   Streptomyces cattleya NRRL 8057 = DSM 46488
NoYes   Streptomyces hygroscopicus subsp. jinggangensis TL01
NoYes   Saccharothrix espanaensis DSM 44229
NoYes   Amycolatopsis mediterranei RB
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis mediterranei S699
NoYes   Amycolatopsis orientalis HCCB10007
NoYes   Propionibacterium avidum 44067
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Actinoplanes friuliensis DSM 7358
NoYes   Rhodococcus pyridinivorans SB3094
NoYes   Rhodococcus erythropolis CCM2595
NoYes   Nocardia brasiliensis ATCC 700358
NoYes   Mycobacterium sp. MOTT36Y
NoYes   Mycobacterium sp. JDM601
NoYes   Mycobacterium abscessus subsp. bolletii 50594
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium yongonense 05-1390
NoYes   Mycobacterium intracellulare MOTT-64
NoYes   Mycobacterium indicus pranii MTCC 9506
NoYes   Mycobacterium intracellulare MOTT-02
NoYes