SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.


Thiamin diphosphate-binding fold (THDP-binding) alignments

These alignments are sequences aligned to the 0045858 model.

Sophisticated options are available for refining alignments:


Jump to [ Top of page · Refine alignments · Add alignments from genomes ]

Alignments

The numbers along the top are the segment numbers of the HMM states, and each sequence is seperately aligned to the model.
The first sequence is the seed the model was built from.
Upper case letters are aligned, lower case letters are insertions, '-' signifies a deletion and '.' is nothing.

                 10        20        30        40        50        60        70        80        90 
                  |         |         |         |         |         |         |         |         | 
d1b0pa2 v-KSEVLPRDSLKGSQFQEPLMEFSGACSGCGETPYVRVITQLFGERMFIANATGCSSIWGASAPSMPYKTNRLGQGPAWGNSLFEDAAEYG


              100       110       120       130       140       150       160       170       180   
                |         |         |         |         |         |         |         |         |   
d1b0pa2 FGMNMSMFARRTHLADLAAKALESDASGDVKEALQGWLAGKNDPIKSKEYGDKLKKLLAGQKDGLLGQIAAMSDLYTKKSVWIFGGDGWAYD


            190       200       210       220       230       240       250       260       270     
              |         |         |         |         |         |         |         |         |     
d1b0pa2 IGYGGLDHVLASGEDVNVFVMDTEVYSNTGGQSSKATPTGAVAKFAAAGKRTGKKDLARMVMTYGYVYVATVSMGYSKQQFLKVLKEAESFP


          280       290       300       310       320       330       340       350       360       
            |         |         |         |         |         |         |         |         |       
d1b0pa2 GPSLVIAYATCINQGLRKGMGKSQDVMNTAVKSGYWPLFRYDPRLAAQGKNPFQLDSKAPDGSVEEFLMAQNRFAVLDRSFPEDAKRLRAQV


        370       380       390       400       410       420       430       440           
          |         |         |         |         |         |         |         |           
d1b0pa2 AHELDVRFKELEHMAATNIFESFAPAGGKADGSVDFGEGAEFCTRDDTPMMARPDSGEACDQNRAGTSEQQGDLSK----rtkk


Statistics on alignment.   Save alignment.

Jump to [ Top of page · Alignments · Add alignments from genomes ]

Refine alignments

Sophisticated options are available for refining alignments:

Add your sequences to the alignment:
Members of the same: including
Include all superfamily members: , or just those assigned by the selected model:
Initial T99 seed sequence: NoYes

You may enter many sequences at once using
FASTA format:

Upload a multiple sequence FASTA file:




Model: 0045858 (list models)
Initial SAMT99 seed:
Alignment:



Display Options:
Output in FASTA-like format: NoYes
Output column indices: NoYes
Sequence index (number) on each line: NoYes

Max number of insertions shown: (0 does not show insertions)
Characters per line:
Character to show inserts:
Maximum number of sequences:
Exclude sequences shorter than: residues



Jump to [ Top of page · Alignments · Refine alignments ]

Add alignments from genomes

Select below additional genomes you would like to see alignments for, then click on 'Re-Submit'. The genome assignments will be added to this page.


Select to display   Genome
NoYes   Capitella sp. I
NoYes   Monosiga brevicollis
NoYes   Sphaeroforma arctica JP610
NoYes   Conidiobolus coronatus NRRL28638 v1.0
NoYes   Mortierella verticillata NRRL 6337
NoYes   Phycomyces blakesleeanus
NoYes   Rhizopus oryzae RA 99-880
NoYes   Mucor circinelloides
NoYes   Rhizomucor miehei CAU432
NoYes   Malassezia globosa CBS 7966
NoYes   Sporisorium reilianum 22
NoYes   Ustilago maydis
NoYes   Mixia osmundae IAM 14324 v1.0
NoYes   Microbotryum violaceum 22
NoYes   Wallemia sebi v1.0
NoYes   Sphaerobolus stellatus v1.0
NoYes   Piloderma croceum F 1598 v1.0
NoYes   Serpula lacrymans var. lacrymans S7.9
NoYes   Coniophora puteana
NoYes   Hydnomerulius pinastri v2.0
NoYes   Paxillus rubicundulus Ve08.2h10 v1.0
NoYes   Pisolithus microcarpus 441 v1.0
NoYes   Pisolithus tinctorius Marx 270 v1.0
NoYes   Scleroderma citrinum Foug A v1.0
NoYes   Coprinopsis cinerea okayama7 130 v3
NoYes   Pleurotus ostreatus - Oyster mushroom
NoYes   Amanita thiersii Skay4041 v1.0
NoYes   Amanita muscaria Koide v1.0 - Fly agaric
NoYes   Galerina marginata v1.0
NoYes   Hebeloma cylindrosporum h7 v2.0
NoYes   Laccaria bicolor S238N-H82
NoYes   Agaricus bisporus var. bisporus
NoYes   Schizophyllum commune
NoYes   Stereum hirsutum FP-91666 SS1 v1.0
NoYes   Heterobasidion annosum
NoYes   Gloeophyllum trabeumv1.0
NoYes   Punctularia strigosozonata v1.0
NoYes   Sebacina vermifera MAFF 305830 v1.0
NoYes   Fomitiporia mediterranea v1.0
NoYes   Tulasnella calospora AL13/4D v1.0
NoYes   Fomitopsis pinicolav1.0
NoYes   Fomitopsis pinicola FP-58527 SS1 v3.0
NoYes   Phanerochaete chrysosporium RP-78 2.1
NoYes   Dichomitus squalens
NoYes   Trametes versicolor v1.0
NoYes   Daldinia eschscholzii EC12 v1.0
NoYes   Apiospora montagnei NRRL 25634 v1.0
NoYes   Magnaporthe poae ATCC 64411 22
NoYes   Magnaporthe grisea 70-15
NoYes   Podospora anserina
NoYes   Sporotrichum thermophile ATCC 42464
NoYes   Thielavia terrestris NRRL 8126
NoYes   Chaetomium globosum CBS 148.51
NoYes   Neurospora tetrasperma
NoYes   Neurospora discreta FGSC 8579
NoYes   Neurospora crassa OR74A
NoYes   Cryphonectria parasitica - Chestnut blight fungus
NoYes   Verticillium dahliae VdLs.17
NoYes   Acremonium alcalophilumv 1.0
NoYes   Glomerella graminicola 22
NoYes   Fusarium graminearum
NoYes   Nectria haematococca mpVI
NoYes   Fusarium oxysporum f. sp. lycopersici 4286
NoYes   Fusarium verticillioides 7600
NoYes   Trichoderma asperellum CBS 433.97 v1.0
NoYes   Trichoderma atroviride
NoYes   Trichoderma citrinoviride v1.0
NoYes   Trichoderma reesei 1.2
NoYes   Trichoderma virens Gv29-8
NoYes   Trichoderma harzianum CBS 226.95 v1.0
NoYes   Amorphotheca resinae v1.0 - Creosote fungus
NoYes   Botrytis cinerea B05.10
NoYes   Sclerotinia sclerotiorum
NoYes   Blumeria graminis 22
NoYes   Didymella exigua CBS 183.55 v1.0
NoYes   Leptosphaeria maculans 22
NoYes   Setosphaeria turcica v1.0
NoYes   Cochliobolus miyabeanus ATCC 44560 v1.0
NoYes   Cochliobolus victoriae FI3 v1.0
NoYes   Cochliobolus carbonum 26-R-13 v1.0
NoYes   Cochliobolus heterostrophus - Southern corn leaf blight pathogen
NoYes   Alternaria brassicicola
NoYes   Cochliobolus lunatus m118 v2.0
NoYes   Pyrenophora teres f. teres 22
NoYes   Pyrenophora tritici-repentis
NoYes   Stagonospora nodorum
NoYes   Mycosphaerella graminicola IPO323
NoYes   Microsporum gypseum
NoYes   Zasmidium cellare ATCC 36951 v1.0
NoYes   Dothistroma septosporum
NoYes   Septoria musiva v1.0
NoYes   Mycosphaerella fijiensis CIRAD86
NoYes   Aureobasidium pullulans var. subglaciale EXF-2481 v1.0
NoYes   Paracoccidioides brasiliensis Pb18
NoYes   Coccidioides posadasii RMSCC 3488
NoYes   Coccidioides immitis RS
NoYes   Ajellomyces dermatitidis SLH14081
NoYes   Microsporum canis CBS 113480
NoYes   Trichophyton equinum CBS 127.97
NoYes   Trichophyton verrucosum HKI 0517
NoYes   Arthroderma benhamiae CBS 112371
NoYes   Trichophyton tonsurans CBS 112818
NoYes   Trichophyton rubrum CBS 118892
NoYes   Uncinocarpus reesii 1704
NoYes   Aspergillus zonatus v1.0
NoYes   Penicillium chrysogenum Wisconsin 54-1255
NoYes   Penicillium chrysogenum v1.0
NoYes   Aspergillus acidus v1.0
NoYes   Aspergillus fumigatus Af293
NoYes   Aspergillus brasiliensis v1.0
NoYes   Aspergillus nidulans FGSC A4
NoYes   Aspergillus sydowii v1.0
NoYes   Aspergillus versicolor v1.0
NoYes   Aspergillus glaucus
NoYes   Aspergillus carbonarius ITEM 5010
NoYes   Neosartorya fischeri NRRL 181
NoYes   Aspergillus terreus NIH2624
NoYes   Aspergillus tubingensis v1.0
NoYes   Aspergillus wentii v1.0
NoYes   Aspergillus oryzae RIB40
NoYes   Aspergillus niger 22
NoYes   Aspergillus flavus NRRL3357
NoYes   Aspergillus clavatus NRRL 1
NoYes   Penicillium marneffei ATCC 18224
NoYes   Tuber melanosporum Mel28 22
NoYes   Tuber melanosporum Vittad - Perigord truffle
NoYes   Candida tanzawaensis NRRL Y-17324 v1.0
NoYes   Candida dubliniensis CD36
NoYes   Candida tropicalis MYA-3404
NoYes   Candida parapsilosis
NoYes   Lodderomyces elongisporus NRRL YB-4239
NoYes   Babjeviella inositovora NRRL Y-12698 v1.0
NoYes   Candida guilliermondii ATCC 6260
NoYes   Hyphopichia burtonii NRRL Y-1933 v1.0
NoYes   Debaromyces hansenii
NoYes   Pichia pastoris GS115
NoYes   Yarrowia lipolytica CLIB122
NoYes   Candida lusitaniae ATCC 42720
NoYes   Metschnikowia bicuspidata NRRL YB-4993 v1.0
NoYes   Candida glabrata CBS138
NoYes   Kluyveromyces thermotolerans CBS 6340
NoYes   Lachancea kluyveri
NoYes   Kluyveromyces waltii
NoYes   Ashbya gossypii ATCC 10895
NoYes   Saccharomyces mikatae MIT
NoYes   Saccharomyces paradoxus MIT
NoYes   Saccharomyces cerevisiae 76 - Baker's yeast
NoYes   Saccharomyces bayanus MIT
NoYes   Kluyveromyces lactis
NoYes   Spizellomyces punctatus DAOM BR117
NoYes   Entamoeba dispar 1.2
NoYes   Entamoeba invadens 1.2
NoYes   Entamoeba histolytica 1
NoYes   Chlorella variabilis sp. NC64A
NoYes   Volvox carteri f. nagariensis
NoYes   Volvox carteri v199
NoYes   Chlamydomonas reinhardtii 4.0
NoYes   Giardia lamblia 2.3
NoYes   Cyanophora paradoxa
NoYes   Pythium iwayamai DAOM BR242034 22
NoYes   Pythium arrhenomanes ATCC 12531 22
NoYes   Pythium aphanidermatum DAOM BR444 22
NoYes   Pythium irregulare DAOM BR486 22
NoYes   Pythium vexans DAOM BR484 22
NoYes   Phytophthora ramorum 1.1 - Sudden oak death agent
NoYes   Phytophthora sojae 1.1
NoYes   Phytophthora infestans T30-4
NoYes   Phytophthora capsici
NoYes   Thalassiosira pseudonana CCMP1335
NoYes   Perkinsus marinus ATCC 50983
NoYes   Cryptosporidium muris
NoYes   Cryptosporidium parvum Iowa II
NoYes   Symbiodinium minutum clade B1 v1.2
NoYes   Trichomonas vaginalis
NoYes   Guillardia theta CCMP2712 v1.0
NoYes   Acaryochloris marina MBIC11017
NoYes   Synechocystis sp. PCC 6803
NoYes   Synechococcus elongatus PCC 7942
NoYes   Microcoleus sp. PCC 7113
NoYes   Geitlerinema sp. PCC 7407
NoYes   Cyanothece sp. PCC 8802
NoYes   Halothece sp. PCC 7418
NoYes   Microcystis aeruginosa NIES-843
NoYes   Rivularia sp. PCC 7116
NoYes   Calothrix sp. PCC 7507
NoYes   Anabaena variabilis ATCC 29413
NoYes   Nostoc sp. PCC 7107
NoYes   Nostoc punctiforme PCC 73102
NoYes   Nostoc sp. PCC 7120
NoYes   Nostoc sp. PCC 7524
NoYes   Anabaena sp. 90
NoYes   Cryptobacterium curtum DSM 15641
NoYes   Eggerthella sp. YY7918
NoYes   Eggerthella lenta DSM 2243
NoYes   Slackia heliotrinireducens DSM 20476
NoYes   Olsenella uli DSM 7084
NoYes   Atopobium parvulum DSM 20469
NoYes   Coriobacterium glomerans PW2
NoYes   Frankia alni ACN14a
NoYes   Propionibacterium propionicum F0230a
NoYes   Propionibacterium acnes SK137
NoYes   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
NoYes   Mycobacterium sp. JLS
NoYes   Mycobacterium vanbaalenii PYR-1
NoYes   Mycobacterium rhodesiae NBB3
NoYes   Mycobacterium marinum M
NoYes   Intrasporangium calvum DSM 43043
NoYes   Caldilinea aerophila DSM 14535 = NBRC 104270
NoYes   Anaerolinea thermophila UNI-1
NoYes   Roseiflexus sp. RS-1
NoYes   Roseiflexus castenholzii DSM 13941
NoYes   Chloroflexus sp. MS-G
NoYes   Chloroflexus sp. Y-400-fl
NoYes   Chloroflexus aggregans DSM 9485
NoYes   Chloroflexus aurantiacus J-10-fl
NoYes   Thermus sp. CCB_US3_UF1
NoYes   Thermus scotoductus SA-01
NoYes   Anaerococcus prevotii DSM 20548
NoYes   Finegoldia magna ATCC 29328
NoYes   Veillonella parvula DSM 2008
NoYes   Megasphaera elsdenii DSM 20460
NoYes   Acidaminococcus intestini RyC-MR95
NoYes   Acidaminococcus fermentans DSM 20731
NoYes   Megamonas hypermegale
NoYes   Selenomonas sputigena ATCC 35185
NoYes   Selenomonas ruminantium subsp. lactilytica TAM6421
NoYes   Natranaerobius thermophilus JW/NM-WN-LF
NoYes   Symbiobacterium thermophilum IAM 14863
NoYes   Clostridiales genomosp. BVAB3 str. UPII9-5
NoYes   Clostridium clariflavum DSM 19732
NoYes   Eubacterium siraeum
NoYes   Clostridium cellulolyticum H10
NoYes   Clostridium thermocellum ATCC 27405
NoYes   Ethanoligenens harbinense YUAN-3
NoYes   Faecalibacterium prausnitzii
NoYes   Ruminococcus sp.
NoYes   Ruminococcus albus 7
NoYes   Oscillibacter valericigenes Sjm18-20
NoYes   butyrate-producing bacterium SS3/4
NoYes   Pelotomaculum thermopropionicum SI
NoYes   Desulfosporosinus acidiphilus SJ4
NoYes   Desulfosporosinus orientis DSM 765
NoYes   Dehalobacter sp. DCA
NoYes   Dehalobacter sp. CF
NoYes   Syntrophobotulus glycolicus DSM 8271
NoYes   Desulfitobacterium hafniense Y51
NoYes   Desulfitobacterium dehalogenans ATCC 51507
NoYes   Desulfotomaculum acetoxidans DSM 771
NoYes   Acetobacterium woodii DSM 1030
NoYes   Eubacterium eligens ATCC 27750
NoYes   Eubacterium limosum KIST612
NoYes   Clostridium difficile 630
NoYes   Clostridium sticklandii DSM 519
NoYes   Filifactor alocis ATCC 35896
NoYes   Clostridium saccharolyticum WM1
NoYes   Clostridium phytofermentans ISDg
NoYes   Clostridium lentocellum DSM 5427
NoYes   [Ruminococcus] obeum
NoYes   [Ruminococcus] torques
NoYes   Eubacterium rectale M104/1
NoYes   Eubacterium rectale ATCC 33656
NoYes   Roseburia hominis A2-183
NoYes   Roseburia intestinalis
NoYes   Butyrivibrio proteoclasticus B316
NoYes   Butyrivibrio fibrisolvens
NoYes   Heliobacterium modesticaldum Ice1
NoYes   Alkaliphilus oremlandii OhILAs
NoYes   Alkaliphilus metalliredigens QYMF
NoYes   Candidatus Arthromitus sp. SFB-mouse-Japan
NoYes   Clostridium sp. BNL1100
NoYes   Clostridium novyi NT
NoYes   Clostridium ljungdahlii DSM 13528
NoYes   Clostridium kluyveri DSM 555
NoYes   Clostridium beijerinckii NCIMB 8052
NoYes   Clostridium tetani E88
NoYes   Clostridium perfringens ATCC 13124
NoYes   Clostridium cellulovorans 743B
NoYes   Clostridium botulinum A str. ATCC 3502
NoYes   Clostridium acetobutylicum ATCC 824
NoYes   Thermoanaerobacterium xylanolyticum LX-11
NoYes   Thermoanaerobacterium thermosaccharolyticum DSM 571
NoYes   Tepidanaerobacter acetatoxydans Re1
NoYes   Thermoanaerobacter tengcongensis MB4
NoYes   Moorella thermoacetica ATCC 39073
NoYes   Thermoanaerobacter mathranii subsp. mathranii str. A3
NoYes   Thermoanaerobacter pseudethanolicus ATCC 33223
NoYes   Thermoanaerobacter sp. X514
NoYes   Thermoanaerobacter italicus Ab9
NoYes   Thermoanaerobacter wiegelii Rt8.B1
NoYes   Thermoanaerobacter brockii subsp. finnii Ako-1
NoYes   Halothermothrix orenii H 168
NoYes   Halanaerobium hydrogeniformans
NoYes   Halanaerobium praevalens DSM 2228
NoYes   Tetragenococcus halophilus NBRC 12172
NoYes   Melissococcus plutonius DAT561
NoYes   Enterococcus sp. 7L76
NoYes   Enterococcus hirae ATCC 9790
NoYes   Enterococcus faecium Aus0004
NoYes   Enterococcus faecalis 62
NoYes   Lactococcus garvieae ATCC 49156
NoYes   Lactococcus lactis subsp. cremoris MG1363
NoYes   Streptococcus intermedius JTH08
NoYes   Listeria welshimeri serovar 6b str. SLCC5334
NoYes   Listeria innocua Clip11262
NoYes   Listeria seeligeri serovar 1/2b str. SLCC3954
NoYes   Listeria monocytogenes serotype 4b str. CLIP 80459
NoYes   Listeria ivanovii subsp. ivanovii PAM 55
NoYes   butyrate-producing bacterium SSC/2
NoYes   Candidatus Cloacamonas acidaminovorans
NoYes   Melioribacter roseus P3M
NoYes   Ignavibacterium album JCM 16511
NoYes   Pelodictyon phaeoclathratiforme BU-1
NoYes   Chlorobium luteolum DSM 273
NoYes   Chlorobium chlorochromatii CaD3
NoYes   Chlorobium phaeobacteroides DSM 266
NoYes   Chlorobium phaeovibrioides DSM 265
NoYes   Chlorobium limicola DSM 245
NoYes   Chlorobaculum parvum NCIB 8327
NoYes   Chlorobium tepidum TLS
NoYes   Chloroherpeton thalassium ATCC 35110
NoYes   Prosthecochloris aestuarii DSM 271
NoYes   Haliscomenobacter hydrossis DSM 1100
NoYes   Niastella koreensis GR20-10
NoYes   Cyclobacterium marinum DSM 745
NoYes   Tannerella forsythia ATCC 43037
NoYes   Paludibacter propionicigenes WB4
NoYes   Odoribacter splanchnicus DSM 20712
NoYes   Candidatus Azobacteroides pseudotrichonymphae genomovar. CFP2
NoYes   Bacteroides sp. CF50
NoYes   Prevotella melaninogenica ATCC 25845
NoYes   Prevotella intermedia 17
NoYes   Prevotella denticola F0289
NoYes   Prevotella ruminicola 23
NoYes   Porphyromonas asaccharolytica DSM 20707
NoYes   Porphyromonas gingivalis ATCC 33277
NoYes   Alistipes finegoldii DSM 17242
NoYes   Bacteroides salanitronis DSM 18170
NoYes   Bacteroides helcogenes P 36-108
NoYes   Bacteroides vulgatus ATCC 8482
NoYes   Bacteroides thetaiotaomicron VPI-5482
NoYes   Bacteroides fragilis YCH46
NoYes   Maribacter sp. HTCC2170
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Methylacidiphilum infernorum V4
NoYes   Coraliomargarita akajimensis DSM 45221
NoYes   Opitutus terrae PB90-1
NoYes   Akkermansia muciniphila ATCC BAA-835
NoYes   Fretibacterium fastidiosum
NoYes   Aminobacterium colombiense DSM 12261
NoYes   Thermanaerovibrio acidaminovorans DSM 6589
NoYes   Anaerobaculum mobile DSM 13181
NoYes   Spirochaeta smaragdinae DSM 11293
NoYes   Sphaerochaeta pleomorpha str. Grapes
NoYes   Sphaerochaeta globus str. Buddy
NoYes   Sphaerochaeta coccoides DSM 17374
NoYes   Spirochaeta caldaria DSM 7334
NoYes   Treponema azotonutricium ZAS-9
NoYes   Treponema primitia ZAS-2
NoYes   Treponema brennaborense DSM 12168
NoYes   Treponema paraluiscuniculi Cuniculi A
NoYes   Treponema pallidum subsp. pallidum SS14
NoYes   Treponema denticola ATCC 35405
NoYes   Spirochaeta africana DSM 8902
NoYes   Spirochaeta thermophila DSM 6192
NoYes   Calditerrivibrio nitroreducens DSM 19672
NoYes   Denitrovibrio acetiphilus DSM 12809
NoYes   Deferribacter desulfuricans SSM1
NoYes   Flexistipes sinusarabici DSM 4947
NoYes   Mesotoga prima MesG1.Ag.4.2
NoYes   Elusimicrobium minutum Pei191
NoYes   Candidatus Solibacter usitatus Ellin6076
NoYes   Candidatus Koribacter versatilis Ellin345
NoYes   Acidobacterium capsulatum ATCC 51196
NoYes   Streptobacillus moniliformis DSM 12112
NoYes   Sebaldella termitidis ATCC 33386
NoYes   Leptotrichia buccalis C-1013-b
NoYes   Ilyobacter polytropus DSM 2926
NoYes   Fusobacterium nucleatum subsp. nucleatum ATCC 25586
NoYes   Candidatus Methylomirabilis oxyfera
NoYes   Sulfurospirillum deleyianum DSM 6946
NoYes   Sulfurospirillum barnesii SES-3
NoYes   Campylobacter hominis ATCC BAA-381
NoYes   Campylobacter lari RM2100
NoYes   Campylobacter curvus 525.92
NoYes   Campylobacter concisus 13826
NoYes   Campylobacter jejuni subsp. doylei 269.97
NoYes   Campylobacter sp. 03-427
NoYes   Campylobacter fetus subsp. fetus 82-40
NoYes   uncultured Sulfuricurvum sp. RIFRC-1
NoYes   Sulfuricurvum kujiense DSM 16994
NoYes   Syntrophus aciditrophicus SB
NoYes   Desulfurivibrio alkaliphilus AHT2
NoYes   Desulfotalea psychrophila LSv54
NoYes   Desulfobulbus propionicus DSM 2032
NoYes   Desulfatibacillum alkenivorans AK-01
NoYes   Desulfobacterium autotrophicum HRM2
NoYes   Desulfococcus oleovorans Hxd3
NoYes   Desulfohalobium retbaense DSM 5692
NoYes   Desulfomicrobium baculatum DSM 4028
NoYes   Desulfovibrio piezophilus
NoYes   Desulfovibrio aespoeensis Aspo-2
NoYes   Lawsonia intracellularis PHE/MN1-00
NoYes   Desulfovibrio magneticus RS-1
NoYes   Desulfovibrio alaskensis G20
NoYes   Desulfovibrio vulgaris subsp. vulgaris DP4
NoYes   Desulfovibrio salexigens DSM 2638
NoYes   Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774
NoYes   Desulfovibrio africanus str. Walvis Bay
NoYes   Geobacter daltonii FRC-32
NoYes   Geobacter sp. M21
NoYes   Geobacter uraniireducens Rf4
NoYes   Geobacter lovleyi SZ
NoYes   Geobacter bemidjiensis Bem
NoYes   Geobacter sulfurreducens KN400
NoYes   Geobacter metallireducens GS-15
NoYes   Pelobacter propionicus DSM 2379
NoYes   Pelobacter carbinolicus DSM 2380
NoYes   Anaeromyxobacter sp. Fw109-5
NoYes   Anaeromyxobacter dehalogenans 2CP-1
NoYes   Dechloromonas aromatica RCB
NoYes   Thiobacillus denitrificans ATCC 25259
NoYes   Phenylobacterium zucineum HLK1
NoYes   Novosphingobium sp. PP1Y
NoYes   Rhodobacter capsulatus SB 1003
NoYes   Rhodospirillum photometricum DSM 122
NoYes   Magnetospirillum magneticum AMB-1
NoYes   Rhodospirillum rubrum F11
NoYes   Azospirillum lipoferum 4B
NoYes   Azospirillum sp. B510
NoYes   Acetobacter pasteurianus IFO 3283-01
NoYes   Methylocella silvestris BL2
NoYes   Teredinibacter turnerae T7901
NoYes   Tolumonas auensis DSM 9187
NoYes   Aeromonas veronii B565
NoYes   Aeromonas salmonicida subsp. salmonicida A449
NoYes   Aeromonas hydrophila subsp. hydrophila ATCC 7966
NoYes   Vibrio cholerae O395
NoYes   Photobacterium profundum SS9
NoYes   Shewanella sediminis HAW-EB3
NoYes   Marinobacter adhaerens HP15
NoYes   Methylomonas methanica MC09
NoYes   Methylococcus capsulatus str. Bath
NoYes   Allochromatium vinosum DSM 180
NoYes   Thiocystis violascens DSM 198
NoYes   Baumannia cicadellinicola str. Hc (Homalodisca coagulata)
NoYes   Edwardsiella ictaluri 93-146
NoYes   Edwardsiella tarda EIB202
NoYes   Rahnella sp. Y9602
NoYes   Rahnella aquatilis CIP 78.65 = ATCC 33071
NoYes   Yersinia pseudotuberculosis IP 31758
NoYes   Yersinia pestis Pestoides F
NoYes   Yersinia enterocolitica subsp. enterocolitica 8081
NoYes   Serratia sp. AS12
NoYes   Serratia sp. ATCC 39006
NoYes   Serratia plymuthica AS9
NoYes   Serratia proteamaculans 568
NoYes   Dickeya dadantii Ech703
NoYes   Dickeya zeae Ech1591
NoYes   Pectobacterium wasabiae WPP163
NoYes   Pectobacterium sp. SCC3193
NoYes   Pectobacterium atrosepticum SCRI1043
NoYes   Pectobacterium carotovorum subsp. carotovorum PC1
NoYes   Pantoea sp. At-9b
NoYes   Escherichia blattae DSM 4481
NoYes   Candidatus Moranella endobia PCIT
NoYes   Cronobacter turicensis z3032
NoYes   Cronobacter sakazakii ES15
NoYes   Enterobacteriaceae bacterium strain FGI 57
NoYes   Shigella sonnei Ss046
NoYes   Shigella flexneri 5 str. 8401
NoYes   Shigella dysenteriae Sd197
NoYes   Shigella boydii CDC 3083-94
NoYes   Salmonella bongori NCTC 12419
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi C strain RKS4594
NoYes   Klebsiella oxytoca E718
NoYes   Klebsiella variicola At-22
NoYes   Klebsiella pneumoniae NTUH-K2044
NoYes   Enterobacter aerogenes KCTC 2190
NoYes   Escherichia fergusonii ATCC 35469
NoYes   Escherichia coli 'BL21-Gold(DE3)pLysS AG'
NoYes   Enterobacter sp. R4-368
NoYes   Enterobacter sp. 638
NoYes   Enterobacter asburiae LF7a
NoYes   Enterobacter cloacae subsp. dissolvens SDM
NoYes   Citrobacter rodentium ICC168
NoYes   Citrobacter koseri ATCC BAA-895
NoYes   Cryptococcus neoformans var. grubii H99
NoYes   Cryptococcus neoformans B-3501A
NoYes   Paracoccidioides brasiliensis Pb01
NoYes   Paracoccidioides brasiliensis Pb03
NoYes   Coccidioides posadasii str. Silveira
NoYes   Coccidioides immitis RMSCC 3703
NoYes   Coccidioides immitis RMSCC 2394
NoYes   Coccidioides immitis H538.4
NoYes   Ajellomyces dermatitidis ER-3
NoYes   Histoplasma capsulatum H143
NoYes   Histoplasma capsulatum H88
NoYes   Histoplasma capsulatum G186AR
NoYes   Aspergillus fumigatus A1163
NoYes   Candida albicans WO-1
NoYes   Saccharomyces cerevisiae UC5
NoYes   Saccharomyces cerevisiae PW5
NoYes   Saccharomyces cerevisiae CLIB324
NoYes   Saccharomyces cerevisiae CBS7960
NoYes   Saccharomyces cerevisiae YJM269
NoYes   Saccharomyces cerevisiae T7
NoYes   Saccharomyces cerevisiae FostersO
NoYes   Saccharomyces cerevisiae Vin13
NoYes   Saccharomyces cerevisiae W303
NoYes   Saccharomyces cerevisiae JAY291
NoYes   Saccharomyces cerevisiae CLIB215
NoYes   Saccharomyces cerevisiae Y10
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae YJM789
NoYes   Saccharomyces cerevisiae SGD - Baker's yeast
NoYes   Chroococcidiopsis thermalis PCC 7203
NoYes   Synechocystis sp. PCC 6803 substr. PCC-P
NoYes   Synechocystis sp. PCC 6803 substr. PCC-N
NoYes   Synechocystis sp. PCC 6803 substr. GT-I
NoYes   Synechocystis sp. PCC 6803
NoYes   Cyanobium gracile PCC 6307
NoYes   Synechococcus sp. PCC 7002
NoYes   Synechococcus elongatus PCC 6301
NoYes   Oscillatoria nigro-viridis PCC 7112
NoYes   Oscillatoria acuminata PCC 6304
NoYes   Arthrospira platensis NIES-39
NoYes   Cyanothece sp. PCC 7822
NoYes   Cyanothece sp. PCC 7425
NoYes   Cyanothece sp. PCC 7424
NoYes   Cyanothece sp. ATCC 51142
NoYes   Cyanothece sp. PCC 8801
NoYes   Pleurocapsa minor Pleurocapsa sp. PCC 7327
NoYes   Calothrix parietina Calothrix sp. PCC 6303
NoYes   Cylindrospermum stagnale PCC 7417
NoYes   Anabaena cylindrica PCC 7122
NoYes   Gordonibacter pamelaeae 7-10-1-b
NoYes   Adlercreutzia equolifaciens DSM 19450
NoYes   Frankia sp. CcI3
NoYes   Propionibacterium avidum 44067
NoYes   Propionibacterium acnes ATCC 11828
NoYes   Propionibacterium acnes TypeIA2 P.acn31
NoYes   Propionibacterium acnes TypeIA2 P.acn17
NoYes   Propionibacterium acnes TypeIA2 P.acn33
NoYes   Propionibacterium acnes C1
NoYes   Propionibacterium acnes HL096PA1
NoYes   Propionibacterium acnes 6609
NoYes   Propionibacterium acnes 266
NoYes   Propionibacterium acnes KPA171202
NoYes   Propionibacterium acidipropionici ATCC 4875
NoYes   Mycobacterium liflandii 128FXT
NoYes   Mycobacterium sp. KMS
NoYes   Mycobacterium sp. MCS
NoYes   Mycobacterium kansasii ATCC 12478
NoYes   Thermus oshimai JL-2
NoYes   [Eubacterium] cylindroides [Eubacterium] cylindroides T2-87
NoYes   Eubacterium siraeum V10Sc8a
NoYes   Clostridium thermocellum DSM 1313
NoYes   [Clostridium] stercorarium Clostridiu subsp. stercorarium DSM 8532
NoYes   Faecalibacterium prausnitzii L2-6
NoYes   Ruminococcus champanellensis 18P13
NoYes   Clostridium acidurici 9a
NoYes   Desulfosporosinus meridiei DSM 13257
NoYes   Desulfitobacterium dichloroeliminans LMG P-21439
NoYes   Desulfitobacterium hafniense DCB-2
NoYes   Clostridium difficile BI1
NoYes   Clostridium difficile R20291
NoYes   Clostridium difficile CD196
NoYes   Clostridium saccharolyticum Clostridium cf. saccharolyticum K10
NoYes   Coprococcus catus GD/7
NoYes   Roseburia intestinalis XB6B4
NoYes   Candidatus Arthromitus sp. SFB-rat-Yit
NoYes   Candidatus Arthromitus sp. SFB-mouse-Yit
NoYes   Clostridium sp. SY8519
NoYes   Clostridium saccharobutylicum DSM 13864
NoYes   Clostridium autoethanogenum DSM 10061
NoYes   Clostridium saccharoperbutylacetonicum N1-4(HMT)
NoYes   Clostridium kluyveri NBRC 12016
NoYes   Clostridium tetani genome 12124569
NoYes   Clostridium perfringens SM101
NoYes   Clostridium perfringens str. 13
NoYes   Clostridium pasteurianum BC1
NoYes   Clostridium botulinum H04402 065
NoYes   Clostridium botulinum BKT015925
NoYes   Clostridium botulinum F str. 230613
NoYes   Clostridium botulinum F str. Langeland
NoYes   Clostridium botulinum E3 str. Alaska E43
NoYes   Clostridium botulinum B1 str. Okra
NoYes   Clostridium botulinum Ba4 str. 657
NoYes   Clostridium botulinum A2 str. Kyoto
NoYes   Clostridium botulinum A3 str. Loch Maree
NoYes   Clostridium botulinum A str. Hall
NoYes   Clostridium botulinum A str. ATCC 19397
NoYes   Clostridium acetobutylicum DSM 1731
NoYes   Clostridium acetobutylicum EA 2018
NoYes   Thermoanaerobacterium saccharolyticum JW/SL-YS485
NoYes   Thermoanaerobacterium thermosaccharolyticum M0795
NoYes   Thermoanaerobacter sp. X513
NoYes   Halobacteroides halobius DSM 5150
NoYes   Carnobacterium maltaromaticum LMA28
NoYes   Melissococcus plutonius ATCC 35311
NoYes   Enterococcus mundtii QU 25
NoYes   Enterococcus casseliflavus EC20
NoYes   Enterococcus faecium Aus0085
NoYes   Enterococcus faecium NRRL B-2354
NoYes   Enterococcus faecium DO
NoYes   Enterococcus faecalis str. Symbioflor 1
NoYes   Enterococcus faecalis D32
NoYes   Enterococcus faecalis OG1RF
NoYes   Enterococcus faecalis V583
NoYes   Lactococcus garvieae Lg2
NoYes   Lactococcus lactis subsp. lactis IO-1
NoYes   Lactococcus lactis subsp. lactis CV56
NoYes   Lactococcus lactis subsp. lactis KF147
NoYes   Lactococcus lactis subsp. lactis Il1403
NoYes   Lactococcus lactis subsp. cremoris KW2
NoYes   Lactococcus lactis subsp. cremoris UC509.9
NoYes   Lactococcus lactis subsp. cremoris A76
NoYes   Lactococcus lactis subsp. cremoris NZ9000
NoYes   Lactococcus lactis subsp. cremoris SK11
NoYes   Streptococcus dysgalactiae subsp. equisimilis 167
NoYes   Streptococcus dysgalactiae subsp. equisimilis ATCC 12394
NoYes   Streptococcus dysgalactiae subsp. equisimilis RE378
NoYes   Streptococcus iniae SF1
NoYes   Clostridium botulinum B str. Eklund 17B
NoYes   Listeria monocytogenes EGD sequence
NoYes   Listeria monocytogenes serotype 4b str. LL195
NoYes   Listeria monocytogenes 07PF0776
NoYes   Listeria monocytogenes M7
NoYes   Listeria monocytogenes J1-220
NoYes   Listeria monocytogenes J1816
NoYes   Listeria monocytogenes SLCC2376
NoYes   Listeria monocytogenes SLCC5850
NoYes   Listeria monocytogenes ATCC 19117
NoYes   Listeria monocytogenes L312
NoYes   Listeria monocytogenes SLCC2479
NoYes   Listeria monocytogenes SLCC7179
NoYes   Listeria monocytogenes SLCC2540
NoYes   Listeria monocytogenes SLCC2378
NoYes   Listeria monocytogenes serotype 1/2b str. SLCC2755
NoYes   Listeria monocytogenes serotype 1/2c str. SLCC2372
NoYes   Listeria monocytogenes serotype 7 str. SLCC2482
NoYes   Listeria monocytogenes 08-5578
NoYes   Listeria monocytogenes 08-5923
NoYes   Listeria monocytogenes L99
NoYes   Listeria monocytogenes HCC23
NoYes   Listeria monocytogenes 10403S
NoYes   Listeria monocytogenes J0161
NoYes   Listeria monocytogenes Finland 1998
NoYes   Listeria monocytogenes FSL R2-561
NoYes   Listeria monocytogenes serotype 4b str. F2365
NoYes   Listeria monocytogenes EGD-e
NoYes   Chlorobium phaeobacteroides BS1
NoYes   Prevotella sp. oral taxon 299 str. F0039
NoYes   Prevotella dentalis DSM 3688
NoYes   Porphyromonas gingivalis TDC60
NoYes   Porphyromonas gingivalis W83
NoYes   Alistipes shahii WAL 8301
NoYes   Bacteroides xylanisolvens XB1A
NoYes   Bacteroides fragilis 638R
NoYes   Bacteroides fragilis NCTC 9343
NoYes   Fibrobacter succinogenes subsp. succinogenes S85
NoYes   Treponema pedis str. T A4
NoYes   Treponema pallidum str. Fribourg-Blanc
NoYes   Treponema pallidum subsp. pertenue str. Gauthier
NoYes   Treponema pallidum subsp. pertenue str. CDC2
NoYes   Treponema pallidum subsp. pertenue str. SamoaD
NoYes   Treponema pallidum subsp. pallidum str. Mexico A
NoYes   Treponema pallidum subsp. pallidum str. Chicago
NoYes   Treponema pallidum subsp. pallidum DAL-1
NoYes   Treponema pallidum subsp. pallidum str. Nichols
NoYes   Spirochaeta thermophila DSM 6578
NoYes   Fusobacterium nucleatum subsp. vincentii 3_1_36A2
NoYes   Fusobacterium nucleatum subsp. animalis 4_8
NoYes   Campylobacter jejuni Waterborne C.jejuni Outbreak
NoYes   Campylobacter jejuni RM1221
NoYes   Campylobacter jejuni subsp. jejuni 00-2544
NoYes   Campylobacter jejuni subsp. jejuni 00-2538
NoYes   Campylobacter jejuni subsp. jejuni 00-2426
NoYes   Campylobacter jejuni subsp. jejuni 00-2425
NoYes   Campylobacter jejuni subsp. jejuni PT14
NoYes   Campylobacter jejuni subsp. jejuni ICDCCJ07001
NoYes   Campylobacter jejuni subsp. jejuni S3
NoYes   Campylobacter jejuni subsp. jejuni M1
NoYes   Campylobacter jejuni subsp. jejuni IA3902
NoYes   Campylobacter jejuni subsp. jejuni 81116
NoYes   Campylobacter jejuni subsp. jejuni 81-176
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168-BN148
NoYes   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
NoYes   Campylobacter coli 76339
NoYes   Campylobacter coli 15-537360
NoYes   Campylobacter coli CVM N29710
NoYes   Desulfocapsa sulfexigens DSM 10523
NoYes   Desulfobacula toluolica Tol2
NoYes   Lawsonia intracellularis N343
NoYes   Desulfovibrio hydrothermalis AM13 = DSM 14728
NoYes   Desulfovibrio vulgaris RCH1
NoYes   Desulfovibrio vulgaris str. 'Miyazaki F'
NoYes   Desulfovibrio vulgaris str. Hildenborough
NoYes   Desulfovibrio gigas DSM 1382 = ATCC 19364
NoYes   Desulfovibrio desulfuricans ND132
NoYes   Geobacter sp. M18
NoYes   Geobacter sulfurreducens PCA
NoYes   Anaeromyxobacter sp. K
NoYes   Anaeromyxobacter dehalogenans 2CP-C
NoYes   Sulfuricella denitrificans skB26
NoYes   Rhodospirillum rubrum ATCC 11170
NoYes   Acetobacter pasteurianus 386B
NoYes   Acetobacter pasteurianus IFO 3283-12
NoYes   Acetobacter pasteurianus IFO 3283-01-42C
NoYes   Acetobacter pasteurianus IFO 3283-32
NoYes   Acetobacter pasteurianus IFO 3283-26
NoYes   Acetobacter pasteurianus IFO 3283-22
NoYes   Acetobacter pasteurianus IFO 3283-07
NoYes   Acetobacter pasteurianus IFO 3283-03
NoYes   Aeromonas hydrophila ML09-119
NoYes   Vibrio cholerae LMA3984-4
NoYes   Vibrio cholerae M66-2
NoYes   Vibrio cholerae O395
NoYes   Vibrio cholerae IEC224
NoYes   Vibrio cholerae O1 str. 2010EL-1786
NoYes   Vibrio cholerae MJ-1236
NoYes   Vibrio cholerae O1 biovar El Tor str. N16961
NoYes   Thioflavicoccus mobilis 8321
NoYes   Morganella morganii subsp. morganii KT
NoYes   Edwardsiella tarda C07-087
NoYes   Edwardsiella tarda FL6-60
NoYes   Rahnella aquatilis HX2
NoYes   Yersinia pseudotuberculosis PB1/+
NoYes   Yersinia pseudotuberculosis YPIII
NoYes   Yersinia pseudotuberculosis IP 32953
NoYes   Yersinia pestis biovar Microtus str. 91001
NoYes   Yersinia pestis A1122
NoYes   Yersinia pestis Z176003
NoYes   Yersinia pestis D182038
NoYes   Yersinia pestis D106004
NoYes   Yersinia pestis biovar Medievalis str. Harbin 35
NoYes   Yersinia pestis Nepal516
NoYes   Yersinia pestis Antiqua
NoYes   Yersinia pestis CO92
NoYes   Yersinia pestis KIM10+
NoYes   Yersinia enterocolitica subsp. palearctica 105.5R(r)
NoYes   Yersinia enterocolitica subsp. palearctica Y11
NoYes   Serratia sp. AS13
NoYes   Serratia plymuthica S13
NoYes   Serratia plymuthica 4Rx13
NoYes   Serratia marcescens FGI94
NoYes   Serratia marcescens WW4
NoYes   Serratia liquefaciens ATCC 27592
NoYes   Dickeya dadantii Ech586
NoYes   Dickeya dadantii 3937
NoYes   Pectobacterium carotovorum subsp. carotovorum PCC21
NoYes   Candidatus Moranella endobia PCVAL
NoYes   Cronobacter sakazakii CMCC 45402
NoYes   Cronobacter sakazakii SP291
NoYes   Cronobacter sakazakii ATCC BAA-894
NoYes   Raoultella ornithinolytica B6
NoYes   Shigella sonnei 53G
NoYes   Shigella flexneri 2002017
NoYes   Shigella flexneri 2a str. 2457T
NoYes   Shigella flexneri 2a str. 301
NoYes   Shigella dysenteriae 1617
NoYes   Shigella boydii Sb227
NoYes   Salmonella bongori N268-08
NoYes   Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980
NoYes   Salmonella enterica subsp. enterica serovar 4,[5],12:i:- str. 08-1736
NoYes   Salmonella enterica subsp. enterica serovar Javiana str. CFSAN001992
NoYes   Salmonella enterica subsp. enterica serovar Schwarzengrund str. CVM19633
NoYes   Salmonella enterica subsp. enterica Serovar Cubana str. CFSAN002050
NoYes   Salmonella enterica subsp. enterica serovar Enteritidis str. P125109
NoYes   Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67
NoYes   Salmonella enterica subsp. enterica serovar Newport str. USMARC-S3124.1
NoYes   Salmonella enterica subsp. enterica serovar Newport str. SL254
NoYes   Salmonella enterica subsp. enterica serovar Dublin str. CT_02021853
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium var. 5- str. CFSAN001921
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. U288
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 798
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. UK-1
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. ST4/74
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. T000240
NoYes   Salmonella enterica The genome of subsp. enterica serovar Typhimurium str. DT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. D23580
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. 14028S
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
NoYes   Salmonella enterica subsp. enterica serovar Typhimurium Definitive Type 104
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. P-stx-12
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty21a
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. CT18
NoYes   Salmonella enterica subsp. enterica serovar Typhi str. Ty2
NoYes   Salmonella enterica serovar Bovismorbificans genomics
NoYes   Salmonella enterica subsp. enterica serovar Bareilly str. CFSAN000189
NoYes   Salmonella enterica subsp. enterica serovar Agona str. 24249
NoYes   Salmonella enterica subsp. enterica serovar Agona str. SL483
NoYes   Salmonella enterica subsp. enterica serovar Weltevreden str. 2007-60-3289-1
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi B str. SPB7
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. AKU_12601
NoYes   Salmonella enterica subsp. enterica serovar Paratyphi A str. ATCC 9150
NoYes   Salmonella enterica subsp. enterica Serovar Heidelberg str. CFSAN002069
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. B182
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. 41578
NoYes   Salmonella enterica subsp. enterica serovar Heidelberg str. SL476
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. CDC1983-67
NoYes   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum str. RKS5078
NoYes   Salmonella enterica subsp. enterica serovar Thompson str. RM6836
NoYes   Klebsiella oxytoca KCTC 1686
NoYes   Klebsiella pneumoniae JM45
NoYes   Klebsiella pneumoniae CG43
NoYes   Klebsiella pneumoniae KCTC 2242
NoYes   Klebsiella pneumoniae 342
NoYes   Klebsiella pneumoniae subsp. pneumoniae 1084
NoYes   Klebsiella pneumoniae subsp. pneumoniae HS11286
NoYes   Klebsiella pneumoniae subsp. pneumoniae MGH 78578
NoYes   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
NoYes   Enterobacter aerogenes EA1509E
NoYes   Escherichia coli E24377A
NoYes   Escherichia coli E. coli PMV-1
NoYes   Escherichia coli JJ1886
NoYes   Escherichia coli LY180
NoYes   Escherichia coli APEC O78
NoYes   Escherichia coli O7:K1 str. CE10
NoYes   Escherichia coli O104:H4 str. 2009EL-2050
NoYes   Escherichia coli O104:H4 str. 2009EL-2071
NoYes   Escherichia coli O104:H4 str. 2011C-3493
NoYes   Escherichia coli NA114
NoYes   Escherichia coli P12b
NoYes   Escherichia coli str. 'clone D i2'
NoYes   Escherichia coli str. 'clone D i14'
NoYes   Escherichia coli UM146
NoYes   Escherichia coli 042
NoYes   Escherichia coli Xuzhou21
NoYes   Escherichia coli IHE3034
NoYes   Escherichia coli UMNK88
NoYes   Escherichia coli O83:H1 str. NRG 857C
NoYes   Escherichia coli ABU 83972
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli KO11FL
NoYes   Escherichia coli LF82
NoYes   Escherichia coli ED1a
NoYes   Escherichia coli IAI39
NoYes   Escherichia coli UMN026
NoYes   Escherichia coli 55989
NoYes   Escherichia coli S88
NoYes   Escherichia coli IAI1
NoYes   Escherichia coli W
NoYes   Escherichia coli W
NoYes   Escherichia coli DH1
NoYes   Escherichia coli DH1
NoYes   Escherichia coli ATCC 8739
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli BL21(DE3)
NoYes   Escherichia coli SMS-3-5
NoYes   Escherichia coli SE15
NoYes   Escherichia coli SE11
NoYes   Escherichia coli APEC O1
NoYes   Escherichia coli O103:H2 str. 12009
NoYes   Escherichia coli UTI89
NoYes   Escherichia coli 536
NoYes   Escherichia coli HS
NoYes   Escherichia coli ETEC H10407
NoYes   Escherichia coli O55:H7 str. RM12579
NoYes   Escherichia coli O55:H7 str. CB9615
NoYes   Escherichia coli O26:H11 str. 11368
NoYes   Escherichia coli CFT073
NoYes   Escherichia coli O111:H- str. 11128
NoYes   Escherichia coli O127:H6 str. E2348/69
NoYes   Escherichia coli O157:H7 str. TW14359
NoYes   Escherichia coli O157:H7 str. EC4115
NoYes   Escherichia coli O157:H7 str. Sakai
NoYes   Escherichia coli O157:H7 str. EDL933
NoYes   Escherichia coli BW2952
NoYes   Escherichia coli str. K-12 substr. MG1655
NoYes   Escherichia coli str. K-12 substr. W3110
NoYes   Escherichia coli str. K-12 substr. DH10B
NoYes   Escherichia coli B str. REL606
NoYes   Enterobacter cloacae SCF1
NoYes   Enterobacter cloacae EcWSU1
NoYes   Enterobacter cloacae subsp. cloacae ENHKU01
NoYes   Enterobacter cloacae subsp. cloacae ATCC 13047
NoYes   Saccharomyces cerevisiae 69_4 - Baker's yeast
NoYes   Lotus japonicus
NoYes   1_050719N (meta-genome)
NoYes   4_050719Q (meta-genome)
NoYes   5_050719P (meta-genome)
NoYes   Atta cephalotes fungus garden (ACEF) (meta-genome)
NoYes   Bath Hot Springs, planktonic community (meta-genome)
NoYes   Combined (meta-genome)
NoYes   Cyphomyrmex longiscapus fungus garden (meta-genome)
NoYes   Dendroctonus ponderosae beetle community (MPB hybrid beetle) (Lodgepole pine) (meta-genome)
NoYes   Dendroctonus ponderosae fungus gallery (Hybrid pine) (MPB hybrid gallery) (meta-genome)
NoYes   Endophytic microbiome from Rice (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #1 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #2 (meta-genome)
NoYes   Fossil microbial community from Whale Fall at Santa Cruz Basin of the Pacific Ocean Sample #3 (meta-genome)
NoYes   Freshwater propionate enrichment of Brocadia fulgida (meta-genome)
NoYes   Fungus garden combined (combined) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden bottom (Fungus garden bottom) (meta-genome)
NoYes   Fungus garden microbial communities from Atta colombica in Panama, sample from fungus garden top (meta-genome)
NoYes   Groundwater dechlorinating community (KB-1) from synthetic mineral medium in Toronto, ON, sample from Site contaminated with chlorinated ethenes
NoYes   Guerrero Negro salt ponds hypersaline mat 02(H) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 03(I) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 04(N) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 05(O) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 06(P) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 07(S) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 08(T) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 09(Y) (meta-genome)
NoYes   Guerrero Negro salt ponds hypersaline mat 10(Z) (meta-genome)
NoYes   Hindgut microbiome of Nasutitermes sp. (Costa Rica) (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP11 from Octopus Springs (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP12 from Calcite Springs, Tower Falls Region (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP15 from Mushroom Spring (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP16 from Fairy Spring Red Layer (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP17 from Obsidian Pool Prime (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP18 from Washburn Springs #1 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP20 from Bath Lake Vista Annex - Purple-Sulfur Mats (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP5 from Bath Lake Vista Annex (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP6 from White Creek Site 3 (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP7 from Chocolate Pots (meta-genome)
NoYes   Hot spring microbial community from Yellowstone Hot Springs, sample YNP9 from Dragon Spring, Norris Geyser Basin (meta-genome)
NoYes   Human Gut Community Subject 7 (meta-genome)
NoYes   Human Gut Community Subject 8 (meta-genome)
NoYes   Macropus eugenii forestomach microbiome from Canberra, Australia, sample Macropus_eugenii_combined (meta-genome)
NoYes   Maize field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing corn (Zea may (meta-genome)
NoYes   Maize rhizosphere soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Soil sample from rhizosphere of corn (Zea mays))< (meta-genome)
NoYes   Marine anammox bioreactor enriched for Scalindua species (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment combined (v2) (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formaldehyde enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Formate enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methane enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methanol enrichment (meta-genome)
NoYes   Methylotrophic community from Lake Washington sediment Methylamine enrichment (meta-genome)
NoYes   Miscanthus field bulk soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Bulk soil sample from field growing Miscanthu (meta-genome)
NoYes   Mountain Pine Beetle microbial communities from Grand Prairie, Alberta, sample from Hybrid pine (MPB hybrid beetle) (meta-genome)
NoYes   Mouse Gut Community lean2 (meta-genome)
NoYes   Mouse Gut Community lean3 (meta-genome)
NoYes   Mouse Gut Community ob2 (meta-genome)
NoYes   NCBI 2017_08 genome
NoYes   Oak Ridge Pristine Groundwater FRC FW301 (meta-genome)
NoYes   Olavius algarvensis endosymbiont metagenome Delta1 (meta-genome)
NoYes   Protozoadb 2010_08 (Protozoadb)
NoYes   simHC - Simulated High Complexity Metagenome (meta-genome)
NoYes   simLC - Simulated Low Complexity Metagenome (meta-genome)
NoYes   simMC - Simulated Medium Complexity Metagenome (meta-genome)
NoYes   Sludge/Australian, Phrap Assembly (meta-genome)
NoYes   Soil microbial communities from Minnesota Farm (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 1 Maryland Estuary CO2- (Maryland Estuary ambient) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 4 Nevada Test Site Crust CO2- (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ (Oak Ridge elevated CO2) (meta-genome)
NoYes   Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2- (Oak Ridge ambient) (meta-genome)
NoYes   Soil microbial community from bioreactor at Alameda Naval Air Station, CA, contaminated with Chloroethene, Sample 196 (meta-genome)
NoYes   STRING v9.0.5 (STRING)
NoYes   Switchgrass rhizosphere microbial community from Michigan, US, sample from East Lansing bulk soil (meta-genome)
NoYes   Switchgrass soil microbial communities from University of Illinois Energy Farm, Urbana, IL (Rhizosphere soil sample from switchgrass (Panicum virg (meta-genome)
NoYes   Termite Protist Endosymbiont Community (meta-genome)
NoYes   Uniprot 2018_03 genome
NoYes   Wastewater Terephthalate-degrading communities from Bioreactor (meta-genome)
NoYes   Global Ocean Sampling Expedition (GOS)
NoYes   NCBI plasmid sequences (Plasmids)
NoYes   NCBI viral sequences (Viral)
NoYes   PDB chains (SCOP 1.75) (PDB)
NoYes   Protein Data Bank (all PDB sequenc)
NoYes   SCOP2 SCOPe CATH ECOD (all domain sequ)
NoYes   TargetDB (Targets)
NoYes   The Salmonella enterica Pan-genome (meta-genome)
NoYes   ALL (only advised for small superfamilies)


Jump to [ Top of page · Alignments · Refine alignments · Add alignments from genomes ]