SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154148071|ref|YP_001407008.1| from Campylobacter hominis ATCC BAA-381

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154148071|ref|YP_001407008.1|
Domain Number 1 Region: 3-78
Classification Level Classification E-value
Superfamily TTHA1013/TTHA0281-like 0.00000128
Family TTHA0281-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154148071|ref|YP_001407008.1|
Sequence length 116
Comment hypothetical protein CHAB381_1472 [Campylobacter hominis ATCC BAA-381]
Sequence
MKKDLNYYLNLPYTISVKKLKDGDYYAEYTDAVLTKNTLMAGWGKNEMEAINDLKEAFSC
FVESALKDGDFIPEPNDKSVRVNICLPRSLLNAIDKVTKNRSKFLSEAANMKLAKI
Download sequence
Identical sequences A7I3B7
360107.CHAB381_1472 WP_012109312.1.87930 gi|154148071|ref|YP_001407008.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]