SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|154148616|ref|YP_001406073.1| from Campylobacter hominis ATCC BAA-381

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|154148616|ref|YP_001406073.1|
Domain Number 1 Region: 43-195
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.71e-41
Family Myf domain 0.0042
Further Details:      
 
Domain Number 2 Region: 457-670
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.44e-23
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.002
Further Details:      
 
Domain Number 3 Region: 677-769
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.96e-19
Family Anticodon-binding domain of PheRS 0.0023
Further Details:      
 
Domain Number 4 Region: 393-465
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 3.48e-16
Family Domains B1 and B5 of PheRS-beta, PheT 0.0047
Further Details:      
 
Domain Number 5 Region: 227-366
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000000000445
Family B3/B4 domain of PheRS, PheT 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|154148616|ref|YP_001406073.1|
Sequence length 772
Comment phenylalanyl-tRNA synthetase subunit beta [Campylobacter hominis ATCC BAA-381]
Sequence
MIITRNWLNEWIDITEISTDKILKALNSIGLEVDSYKKFSVADKVVIGYVKSKKAHENSD
HLSVCEVDTGSQSLQIVCGAKNVESGQFVAVSLIGAVLPNGLTIKPAKLRGVESNGMICS
SSELGFPKLNDGIMVLDDSIGELVLGRNLNEYLAFNDELIDIDLTPNRGDCLSIYGIARD
LSAALNIPLKNKNFTEEAEKLLGIGRILSVHADEKIDASFIYRAFEIKNRFDITLTHKLR
LAFAEILSNDTLVNLLNYTTHSTGVLLRAYDFNKITNKDKISIDIKKQENGELAVFCDDK
LLGIAGINQNSDFKANKDSKICIVEANYTNPQIIAEALGENRKLKGDEHTYRSTRGSEPN
LILGLNLLFSFLKNKDEFALFAGAQQILNTKEPKIVSFTNAEIDEMIGTKIEKNQILKIL
KSLGIDVNMDNELITATIPTFRHDISNSHDICEEIVRIIGIDNIASKPLVFAENCRFNET
FFDYENAKKIRYKSANIGFFECVHYIFDNEEELKNLGFVPCEVKILNPINAELSVLRPTL
INHLLNSSNLNLRNSKKSIKLFEFGKIFDEKGVEKDCFGFIASGLKNEPSLLNSAKPENV
DFLYFASLIQNIIGKFSCVLPDKNIKFLNDFEQAEIWQNGVKVGIIGRFKFENERDLAKT
YVCEMDFKALKFNEINAKNYSKFPSISRDLSVVVPNNMRFEVIKNALNNLQISDLKEFLP
VDIYKDENLKDSYSLTIKFIFQNLEKTLEDEQIEAKITQILKALNNLGLNLR
Download sequence
Identical sequences A7I0N2
WP_012108358.1.87930 gi|154148616|ref|YP_001406073.1| 360107.CHAB381_0485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]