SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121606655|ref|YP_983984.1| from Polaromonas naphthalenivorans CJ2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121606655|ref|YP_983984.1|
Domain Number 1 Region: 72-220
Classification Level Classification E-value
Superfamily MtlR-like 7.72e-26
Family MtlR-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|121606655|ref|YP_983984.1|
Sequence length 265
Comment hypothetical protein Pnap_3767 [Polaromonas naphthalenivorans CJ2]
Sequence
MQLSIYTAELAVYITLGIMNNGLDPDIAAMKLSDAEKWGLQVYGNYSRAFGEHRVKEFVE
QASPFEAEVTLFEQIAGLVVSEEARVIPVIAAAYADDRLEEMFKREIPDGVPGGRSALMS
GFGPLARLSQRLQMAFAFGWLSKDLLIEFDHIRKIRNDLSHKWDVELLVRKMNEFIEEKQ
TPFEEQLGDGVRLPENFHESMQPVDRFRVRAVWMLGRLTYEARLWVPAIKAGIAPKKALY
GPNAPVMLRAIAAISVKATREIACL
Download sequence
Identical sequences A1VTT5
WP_011803129.1.22642 365044.Pnap_3767 gi|121606655|ref|YP_983984.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]