SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|121606981|ref|YP_984310.1| from Polaromonas naphthalenivorans CJ2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|121606981|ref|YP_984310.1|
Domain Number 1 Region: 472-582
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000647
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|121606981|ref|YP_984310.1|
Sequence length 620
Comment sulfate transporter [Polaromonas naphthalenivorans CJ2]
Sequence
MKPSNASAAIPFTTLMRRLAERLFGHWVHQLTPATLRADAMAGLLGAVLVLPQGIAFATL
AGLPPEYGLYTAIVPCIIAALFGSSWHVMSGPTNANSLALFAMLSPLAMAFSPMYIQLAL
AVTVMVGVLQWLIGALRLGVLANFISPAVLFGFTSGAALLIAVHALPDFLGLAAAPEHSA
AGVLAHVLTQLPHANPAALAVAGITLAVALGLRRFRRNWPYMLIGLAVATVLAWGWGQWT
AGSATPSSALRTVGAIATPWPRFEVPRISWAQASDLIGLAFALTIVALGQDISIAKTVAL
RSGQRIDANREFRGQGLSNIIGGFFSSYVSCGSMNRSMPNLEAGARTPLSSVFSALLLLG
LVAVSAPVLAQIPMAALAGLLVLVALALLDLKRWRQLFALSRTDFGVALATLVATLTIRL
EMAILLGMLLSLMSFLYRTSRPAMRTMGFDSRGLDRQFVVIDTPDDPGEPPHPTLPECPQ
LKLLRMEGEVYFGATQHVADILHALRSQPNPQKHLLVMAKSMNFIDLAGAELWQAELAAR
RAMGGDLYFHRPRPEVIRMWRKTGFTDVLGPEHQFPDKFTAISTIFGKLDPEICRHCSAR
IFWECRAAPGADDPANQPTT
Download sequence
Identical sequences A1VUR1
365044.Pnap_4099 WP_011803451.1.22642 gi|121606981|ref|YP_984310.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]