SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146302803|ref|YP_001190119.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302803|ref|YP_001190119.1|
Domain Number 1 Region: 7-446
Classification Level Classification E-value
Superfamily L-aspartase-like 1.88e-120
Family L-aspartase/fumarase 0.000000035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146302803|ref|YP_001190119.1|
Sequence length 458
Comment adenylosuccinate lyase [Metallosphaera sedula DSM 5348]
Sequence
MSMDVVCPIDWRYGSKEMRRIFTREGIIEYRIKVELALLYALKELGYVSEEEYGKVEKAS
ESVTPEEVDNLEAKLGHDVMALVVSMAEKAGDAGRFVHFGATSYDIVDTAYALMFRDALS
ILKAKFVKSLDKLKDLSLKYQDQVMVGRTHAQHAVPITLGFKFANYLYEMTRSLERLVET
EKRVVLGKMSGAVGTMASWGKDGLKVEELVMRRLNLRPHSISTQVAPRDGFAELISDLAI
AGSVMDRFAIEVRELMRPEIGEMAEGVGDRVGSSTMPHKENPVTAEKISGLSKLLRGMVV
SELENIPLWHERDLTNSSSERFIISHAFLVMDEMLDSFNELLSNLRINLDAMERNLRLSK
GLNMAESLMINLTLKGLPRHKAHEIVSKISREARKGNSSLLEEAIKDKTISSMFSQEELE
RILNPKAYLGQYKTLIQRAIDYYENLVRELNETRGVIH
Download sequence
Identical sequences A0A088E2Z5 A4YCP3
gi|146302803|ref|YP_001190119.1| WP_011921164.1.15515 WP_011921164.1.27320 WP_011921164.1.28583 WP_011921164.1.31166 WP_011921164.1.34633 WP_011921164.1.8883 WP_011921164.1.99084 399549.Msed_0018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]