SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146302810|ref|YP_001190126.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302810|ref|YP_001190126.1|
Domain Number 1 Region: 6-130
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 4.68e-41
Family Cytidine deaminase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146302810|ref|YP_001190126.1|
Sequence length 134
Comment cytidine deaminase [Metallosphaera sedula DSM 5348]
Sequence
MQVTDPSDEELLNLAANAAKNSYSPYSGIRVGAALVGENGEVILGTNVENSSYGLSICAE
RVAVFTAVTKGIRKFKKIAISLSDGSGIMPCGACRQVLREFGRDILVITRDKTGKTTTFY
LDDLLPHSFTLKGE
Download sequence
Identical sequences A0A088E164 A4YCQ0
399549.Msed_0025 WP_011921171.1.15515 WP_011921171.1.27320 WP_011921171.1.28583 WP_011921171.1.31166 WP_011921171.1.34633 WP_011921171.1.8883 WP_011921171.1.99084 gi|146302810|ref|YP_001190126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]