SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146302882|ref|YP_001190198.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146302882|ref|YP_001190198.1|
Domain Number 1 Region: 87-186
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 5.36e-25
Family Ribosomal protein S3 C-terminal domain 0.00075
Further Details:      
 
Domain Number 2 Region: 8-96
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 1.73e-23
Family Prokaryotic type KH domain (KH-domain type II) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146302882|ref|YP_001190198.1|
Sequence length 240
Comment 30S ribosomal protein S3 [Metallosphaera sedula DSM 5348]
Sequence
MVDIKKYFLQKSMTRVMVDEFLAKEYYNAEYAGSEISKTPMGTRVTIYAGRPAIIIGKDG
KTIKRLAQILEKYFNLENPQITVTQPEKPELNARVMAFRLAVTLEKGYHFRRAAFMTIRR
IMNAGALGAEVIVSGKITSERAKFEKLKEGIVYKTGNNLDVMVDRAIAIATLKMGIYGVE
VVITKPLRTIDKISLKQTAGTSTGGESGEVRVTNVRIIDETQNVKLEEQLGGAENDQKSQ
Download sequence
Identical sequences A0A088E1U8 A4YCX2
WP_011921243.1.15515 WP_011921243.1.27320 WP_011921243.1.28583 WP_011921243.1.31166 WP_011921243.1.34633 WP_011921243.1.8883 WP_011921243.1.99084 gi|146302882|ref|YP_001190198.1| 399549.Msed_0097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]