SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303084|ref|YP_001190400.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303084|ref|YP_001190400.1|
Domain Number 1 Region: 1-167
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.51e-46
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000411
Further Details:      
 
Domain Number 2 Region: 173-277
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 6.15e-29
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146303084|ref|YP_001190400.1|
Sequence length 280
Comment glyceraldehyde oxidoreductase medium chain [Metallosphaera sedula DSM 5348]
Sequence
MYPAQVGYYKPDSVNEALDFLEGNEAKVLAGGQSLIPMLKLRILKPRYLVDIGDLGELSF
IREGETTSIGATTRHRELASRKIPGLEIIQETASKVGDIQVRNMGTVGGSLSNADPSADY
PALFTALDATMVIRSRRGTREVKAGEFFKGAFTTALEPSEVLEQVKVKAFKGYRQTYKKL
VRRAGDYALVGLALLLKMEAGEVKDVRIAFTGVRDRPHRPLEAENALKGTKLSDSDISKA
TELAVAGVNPPSDSRGSSSYRREVMKRLLRNTLEEMRREG
Download sequence
Identical sequences A0A088E3B3 A4YDH4
WP_011921444.1.15515 WP_011921444.1.27320 WP_011921444.1.28583 WP_011921444.1.31166 WP_011921444.1.34633 WP_011921444.1.8883 WP_011921444.1.99084 gi|146303084|ref|YP_001190400.1| 399549.Msed_0299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]