SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303100|ref|YP_001190416.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303100|ref|YP_001190416.1|
Domain Number 1 Region: 36-125
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000955
Family Multidrug resistance efflux transporter EmrE 0.022
Further Details:      
 
Domain Number 2 Region: 171-266
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000994
Family Multidrug resistance efflux transporter EmrE 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146303100|ref|YP_001190416.1|
Sequence length 286
Comment hypothetical protein Msed_0315 [Metallosphaera sedula DSM 5348]
Sequence
MKILKYLIPYIVFGSLQYKFTKDGLTFASPFLFMSLRYFIGGLALLPFAKKVVLNRDVII
LTLLTTASSGLWAMGLNYVAPSESAVLSYTMPLFSIPIAYLILSERPRTFEVVGAIIGFL
GVTVYGLSLSGKLSVLGGILTVLNAVFWASFTVYYRKLRSMDPAVVNTSQMLLGSLVFLA
LTPVGFRFDPSLNFVGDLLFSALLGGTLLFYLWNVMLRMERVGKVTVMAFSVPVTSSIID
EVTGEVQLNHESYAGMLTMMAGIILSRKDEIFSKKRKVAVKTAKTS
Download sequence
Identical sequences A0A088E226 A4YDJ0
WP_011921460.1.15515 WP_011921460.1.27320 WP_011921460.1.28583 WP_011921460.1.31166 WP_011921460.1.34633 WP_011921460.1.8883 WP_011921460.1.99084 399549.Msed_0315 gi|146303100|ref|YP_001190416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]