SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303120|ref|YP_001190436.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303120|ref|YP_001190436.1|
Domain Number 1 Region: 36-49,85-228
Classification Level Classification E-value
Superfamily vWA-like 1.05e-26
Family Integrin A (or I) domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303120|ref|YP_001190436.1|
Sequence length 394
Comment von Willebrand factor, type A [Metallosphaera sedula DSM 5348]
Sequence
MVLSLRLEGSHLFSWNGELKFAFRATIVPERVKPVPLDLFIVLDVSGSMGIIDNPPEVDD
SLIAGTAEVDGHVVRYLKDDIGVNNRLEVALEAIRNLLENADTSTRVTIITFSDHVNVLC
RRVTPSTALEHLEEIVPDGNTALYSAVKKAISLIDEHPARVLLITDGYPTDVEDETEYSK
LEVPRFSQFIPIGVGEYNAKILRSLADLSNGRFYHVNDVSEISRIMEEERAKPSGGVKVR
VDVLSKFPVNYVNYTPPIYIGTVEGVTRIYGFIQVPPKYSGELVRVKLTYTDTLDDREYS
LEKFISVIPATDSAQFVSGLNKYLLWEAEYYEKMKEISKLLESGMQVEATRKMQELKDIA
ERTRKADLIEATKKLMNSSDEKEISSEITRKMRS
Download sequence
Identical sequences A0A088E247 A4YDL0
399549.Msed_0335 WP_011921480.1.15515 WP_011921480.1.27320 WP_011921480.1.28583 WP_011921480.1.31166 WP_011921480.1.34633 WP_011921480.1.8883 WP_011921480.1.99084 gi|146303120|ref|YP_001190436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]