SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303122|ref|YP_001190438.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303122|ref|YP_001190438.1|
Domain Number 1 Region: 171-273
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000000288
Family Multidrug resistance efflux transporter EmrE 0.022
Further Details:      
 
Domain Number 2 Region: 61-129
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000000209
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Weak hits

Sequence:  gi|146303122|ref|YP_001190438.1|
Domain Number - Region: 125-183
Classification Level Classification E-value
Superfamily NAD(P)-linked oxidoreductase 0.0362
Family Aldo-keto reductases (NADP) 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303122|ref|YP_001190438.1|
Sequence length 279
Comment hypothetical protein Msed_0337 [Metallosphaera sedula DSM 5348]
Sequence
MPPKQYMGLILLILFWGSAFPIIKITLQFMSPFIIALIRVTVGGTLLFLVVRKLAYGVKE
SISALLNIGIFLVLLNLGIQYSANPGLASTLIYTQPVFVLILSRLVLKERINLLQVLGIV
LAFTGVIASVGLSNFDLGSVIALLGGLTWAVGTIYYRVYLRDRDVLALNAYMSLFSGLFL
APVSLVEPRFTPNLEGIGLALLVSVTAQALGFILWFNAVKSIGPVRASTIVLLVPVSSYL
FSYLLLGEIPTLEEAVGSAVTLFGIFLTFIPGINTRKLS
Download sequence
Identical sequences A0A088E2H6 A4YDL2
gi|146303122|ref|YP_001190438.1| WP_011921482.1.15515 WP_011921482.1.27320 WP_011921482.1.28583 WP_011921482.1.31166 WP_011921482.1.34633 WP_011921482.1.8883 WP_011921482.1.99084 399549.Msed_0337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]