SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303213|ref|YP_001190529.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303213|ref|YP_001190529.1|
Domain Number 1 Region: 4-196
Classification Level Classification E-value
Superfamily Flavoproteins 1.8e-49
Family WrbA-like 0.0000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303213|ref|YP_001190529.1|
Sequence length 197
Comment NADPH-dependent FMN reductase [Metallosphaera sedula DSM 5348]
Sequence
MACPKILVLFYGYGSIVDLAMEIAEGAKAEGAEVKVVRVPELFPKEVVAKFNVDLSRVEK
IPEATMQDLEWADGIVMGSPTRYGNITGQLKFFLDQTRDLWLKGALYGKPVGFFTEAATI
HGGHESTILTMSAYAYHQGMVIVPLGYAIKEISTTTTGGSPYGPSHLGSMKNLDDNEKAI
ARFMGKRITEVARKLRC
Download sequence
Identical sequences A0A088E4B6 A4YDV3
WP_012020393.1.15515 WP_012020393.1.27320 WP_012020393.1.28583 WP_012020393.1.31166 WP_012020393.1.34633 WP_012020393.1.8883 WP_012020393.1.99084 gi|146303213|ref|YP_001190529.1| 399549.Msed_0428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]