SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303221|ref|YP_001190537.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303221|ref|YP_001190537.1|
Domain Number 1 Region: 15-201
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 2.8e-62
Family FAD-linked oxidases, N-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 209-434
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 4.74e-44
Family Vanillyl-alcohol oxidase-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146303221|ref|YP_001190537.1|
Sequence length 447
Comment D-lactate dehydrogenase [Metallosphaera sedula DSM 5348]
Sequence
MQSLKDMGLETSTETREDFVNFKINPSVVVYPRNEKEVVKVVRYAYENRIPIVPWGAGTS
LTGAVSCEGCILLDMKHMSNILEINDVDWYVRTQPGVNLEFLNKKLMEKGFFLPPDPASF
FLCSVGGAVANSSGGMRGVKYGTFRDWVLSLRVVLPTGEVVQVGEPFRKNRAGYDLVHLF
TGSEGTLGVITEIWFRIIPLPKEKMIPIVSFMPDLDSTAGVIQEMRKSGILPEIAEYIDS
EVIMALNTQLNAELRESKGGLLMLRVEEHDLEKIKEILGKWHGDVSILNDEEWERLYSLR
AQSAIALKAMAKEMYVEDIVVPVSRLMEAVKRLKELERKYQVKMPVIAHIGDGNLHPNIL
LKDKEIADELFHEVGMIAVELGGSVSGEHGIGVQKAKLMGIQVKRHGGMKVLEIMKGIKD
LVDPRGIMNPGKYVELAYNIMKQERNE
Download sequence
Identical sequences A0A088E5K5 A4YDW1
gi|146303221|ref|YP_001190537.1| WP_012020401.1.15515 WP_012020401.1.27320 WP_012020401.1.28583 WP_012020401.1.31166 WP_012020401.1.34633 WP_012020401.1.8883 WP_012020401.1.99084 399549.Msed_0436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]