SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146303279|ref|YP_001190595.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303279|ref|YP_001190595.1|
Domain Number 1 Region: 20-102
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000000000000257
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146303279|ref|YP_001190595.1|
Sequence length 107
Comment DNA polymerase subunit beta [Metallosphaera sedula DSM 5348]
Sequence
MVWGLRYIEYLRKNWSDIAERVKEVAKRYGKVHRIVVFGSVVKDKITGSSDLDIAIFYDE
NLSDKEKLRRTLEILNELDEEVAIDLKVMRKDEVEFFLKLVDKYVDL
Download sequence
Identical sequences A0A088E3X3 A4YE19
399549.Msed_0494 WP_012020459.1.15515 WP_012020459.1.27320 WP_012020459.1.28583 WP_012020459.1.31166 WP_012020459.1.34633 WP_012020459.1.8883 WP_012020459.1.99084 gi|146303279|ref|YP_001190595.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]