SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|146303300|ref|YP_001190616.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303300|ref|YP_001190616.1|
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.25e-17
Family Nitrogenase iron protein-like 0.017
Further Details:      
 
Domain Number 2 Region: 167-283
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 0.0000000000000942
Family ROO N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|146303300|ref|YP_001190616.1|
Sequence length 291
Comment hypothetical protein Msed_0517 [Metallosphaera sedula DSM 5348]
Sequence
MTNRIVKFSLFSIKGGVGKSTIAYFLAKKLSEKYKVLLVDRDYTNTIGRIFGLKTGLINV
IADKVEGKYLVQEGNLRVLTLVSILPTKLPNVKEFVEMYSKALKDIEVVITDNPPGMDEI
TALETEGYHLATGDSSCNAIFVTTPGLALDITLSRLSDTCESLLNSVGAKIPFGKSYIEA
VPAHFLHSPGNFHFYDPISKVYFSGDMGAAIFPKDKWYLIVENFEEHVKLMEGFHRRYIP
SKAAIEKWLNRIQGMDIRIIAPQHGSIFMEKDVKNFLDWLRSLDKVGLDLL
Download sequence
Identical sequences A0A088E2M0 A4YE40
gi|146303300|ref|YP_001190616.1| 399549.Msed_0517 WP_012020480.1.15515 WP_012020480.1.27320 WP_012020480.1.28583 WP_012020480.1.31166 WP_012020480.1.34633 WP_012020480.1.8883 WP_012020480.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]