SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303336|ref|YP_001190652.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303336|ref|YP_001190652.1|
Domain Number 1 Region: 208-445
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 4.91e-59
Family Vanillyl-alcohol oxidase-like 0.068
Further Details:      
 
Domain Number 2 Region: 2-205
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 7.01e-51
Family FAD-linked oxidases, N-terminal domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|146303336|ref|YP_001190652.1|
Sequence length 460
Comment FAD linked oxidase domain-containing protein [Metallosphaera sedula DSM 5348]
Sequence
MNLHDELASIVGDEWVITGQEAKLYSYDGFTAVEGDPSMVVLPGNEEEAIRVVRLLLEKG
AKFVMRGTGTSLSGATVPLDGEVVVGMARLNRVYSQSGLEIEVGPGIANVMVTKNAPPHL
FYAPDPSSYTVSSIGGNISHDSGGVHVVKYGPTVNSVLGVRVILPHGEVEDLEYGPFLSA
LPIFVGSEGTLGGILRARLRLFPKPATRKSMFATFDSVRDAGRAVVGIFKAGVIPSALEM
MDRNTIRVVERSRYRANAPDVEALLLIELDGSEEAVNEQEILVSQVIKDNNGERIYPDDG
GTKLWNARKGAFPAMGVVAPAYLTLDCNVPREALPDVLAGVAEIGRKKGVLVANVFHAGD
GNLHPLIPYYPDKAESLKLALETSAEIMKLALRMGGVPSGEHGIGIEKLKYMDMYYTEEE
LQVQRRIKRTFDQDNLLNPCKLLGGCKPRNEVTRWMWEWD
Download sequence
Identical sequences A0A088E5U2 A4YE76
gi|146303336|ref|YP_001190652.1| 399549.Msed_0553 WP_012020516.1.15515 WP_012020516.1.27320 WP_012020516.1.28583 WP_012020516.1.31166 WP_012020516.1.34633 WP_012020516.1.8883 WP_012020516.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]