SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303357|ref|YP_001190673.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303357|ref|YP_001190673.1|
Domain Number 1 Region: 5-66
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.00000239
Family TrmB middle domain-like 0.042
Further Details:      
 
Weak hits

Sequence:  gi|146303357|ref|YP_001190673.1|
Domain Number - Region: 77-162
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.00628
Family ABC transporter transmembrane region 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303357|ref|YP_001190673.1|
Sequence length 235
Comment hypothetical protein Msed_0574 [Metallosphaera sedula DSM 5348]
Sequence
MELIETQEVFDRVSQLINSATERLIVLTDRIRDSIAQDLLRKAGSGVDVKLITSDLNWAR
WLENRAKGYMKDEEEKISQEVQELSNKIEFFNRVPWIALVVVGAVWIVLLVRGLRGLEMI
PALLVGLGVIYYIMYYSYKRRRSYREEIAVKAENRERIAEEYKGVRESLSKHLHVIEIDF
ELSFSVIISDTSAIITSTPLETEKERGYHVFTELEVEEAMKIVDSITSIQSLKRP
Download sequence
Identical sequences A0A088E382 A4YE97
gi|146303357|ref|YP_001190673.1| WP_012020537.1.15515 WP_012020537.1.27320 WP_012020537.1.28583 WP_012020537.1.31166 WP_012020537.1.34633 WP_012020537.1.8883 WP_012020537.1.99084 399549.Msed_0574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]