SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303388|ref|YP_001190704.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303388|ref|YP_001190704.1|
Domain Number 1 Region: 28-239
Classification Level Classification E-value
Superfamily SIS domain 2.36e-20
Family double-SIS domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303388|ref|YP_001190704.1|
Sequence length 272
Comment hypothetical protein Msed_0605 [Metallosphaera sedula DSM 5348]
Sequence
MFIEALEEEAKRIRDVRPNVSISLEDGVITGAGDSYASCLALEGVSRGRFRCVDPYDLLE
WDPPHILVIVSVSGRPIVYQWLLEKFSGRSKIYVVTANTESRIANQANEVVEIPYTSKIQ
LPGTLSFVSTLKTLYALAGIDERDEKGAPLSLGHEPFFVGRAGNYGIAYFASLKMFEIFG
EVSNAERFEQFLHSPIFSTENRMVILLSSGNDREKRLTSEMKNVSLTECTTLLCNTESVI
LSLIQEMRVRKWDRIYYLENKNILRTSSNMIY
Download sequence
Identical sequences A0A088E4S1 A4YEC8
WP_012020567.1.15515 WP_012020567.1.27320 WP_012020567.1.28583 WP_012020567.1.31166 WP_012020567.1.34633 WP_012020567.1.8883 WP_012020567.1.99084 399549.Msed_0605 gi|146303388|ref|YP_001190704.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]