SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|146303431|ref|YP_001190747.1| from Metallosphaera sedula DSM 5348

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|146303431|ref|YP_001190747.1|
Domain Number 1 Region: 3-170
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 6.41e-67
Family Inorganic pyrophosphatase 0.0000000927
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|146303431|ref|YP_001190747.1|
Sequence length 171
Comment inorganic pyrophosphatase [Metallosphaera sedula DSM 5348]
Sequence
MNLGPGKKAPEIVNVLVEIPSGSNIKYEYDEEEGVIKVDRVLYTSMVYPFNYGFVPGTLE
EDGDPIDVLVLTNYPLFPGTVIEVRPVGVVHMKDEEGVDEKIIAVPKEKTDPTFARIKDI
TDIDDATKNKIVHFFEHYKELEPGKWVKISGWGSASEAKEKIAKAIERKNK
Download sequence
Identical sequences A0A088E637 A4YEH1
gi|146303431|ref|YP_001190747.1| 399549.Msed_0648 WP_012020610.1.15515 WP_012020610.1.27320 WP_012020610.1.28583 WP_012020610.1.31166 WP_012020610.1.34633 WP_012020610.1.8883 WP_012020610.1.99084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]